Everful

Wholesale steel bottles

Factory-direct selection, vetted for quality and ready to order.

Sign Up
Steel Bottles

Find the perfect pieces: vacuum flasks & thermoses, tumblers, mugs and more

filterShow Filters
Best Seller
New Arrivals
Price Drop
Free Shipping
Christmas Wine Bottle Cover Buffalo Plaid Fabric With Faux Fur Collar Pom Poms Bow Knot Holiday Table Decoration
Christmas Wine Bottle Cover Buffalo Plaid Fabric With Faux Fur Collar Pom Poms Bow Knot Holiday Table Decoration
like
Find Similar
Detail of red and black plaid wine bottle cover with faux fur collar and bow decoration - Red and Black Plaid
Detail of Christmas buffalo check wine bottle cover with faux fur collar and pompom bow - Black and White Plaid
Christmas Wine Bottle Cover Buffalo Plaid Fabric With Faux Fur Collar Pom Poms Bow Knot Holiday Table Decoration
-4%
$1.29
No MOQ
Christmas Gnome Wine Bottle Covers Felt Snowflake Embroidery Long Beard Wine Bottle Decorations For Holiday Dining Table
Christmas Gnome Wine Bottle Covers Felt Snowflake Embroidery Long Beard Wine Bottle Decorations For Holiday Dining Table
like
Find Similar
Christmas gnome wine bottle cover with grey snowflake hat and long white beard decoration - Snowflake Gnome / Gray
Christmas gnome wine bottle cover with green snowflake hat and white faux fur beard - Snowflake Gnome / Green
Christmas Gnome Wine Bottle Covers Felt Snowflake Embroidery Long Beard Wine Bottle Decorations For Holiday Dining Table
$1.01
No MOQ
Free Shipping
Christmas Wine Bottle Cover Plush Non-woven Fabric Santa Claus Snowman Cartoon Decorative Bag Holiday Table Decor Dinner Party
Christmas Wine Bottle Cover Plush Non-woven Fabric Santa Claus Snowman Cartoon Decorative Bag Holiday Table Decor Dinner Party
like
Find Similar
Christmas Santa Claus wine bottle cover decoration for holiday party tabletop setting - Santa Claus
Christmas snowman wine bottle cover decoration for holiday party tabletop decor - Snowman
Christmas Wine Bottle Cover Plush Non-woven Fabric Santa Claus Snowman Cartoon Decorative Bag Holiday Table Decor Dinner Party
-4%
$2.14
No MOQ
Christmas Stickers Vinyl Waterproof Decorative Decals For Holiday Gift Wrapping Laptop Water Bottle Scrapbooking Designs
Christmas Stickers Vinyl Waterproof Decorative Decals For Holiday Gift Wrapping Laptop Water Bottle Scrapbooking Designs
like
Find Similar
Detail view of Merry Christmas stickers in packaging with 8cm by 9cm dimensions - 25 Original Designs (N52) / 50 Sheets
Detail view of holographic Christmas stickers with Santa Claus and red gift bag patterns - 25 Original Designs (N53) / 100 Sheets
Christmas Stickers Vinyl Waterproof Decorative Decals For Holiday Gift Wrapping Laptop Water Bottle Scrapbooking Designs
$0.75-1.51
Mix MOQ : 3
Christmas Wine Bottle Covers Dimensional Santa Snowman Reindeer Long Leg Knitted Fabric Holiday Party Table Decor
Christmas Wine Bottle Covers Dimensional Santa Snowman Reindeer Long Leg Knitted Fabric Holiday Party Table Decor
like
Find Similar
Christmas snowman wine bottle cover with red plaid scarf and green legs on wood base - Snowman
Santa Claus themed wine bottle cover with knit hat and wooden buttons for Christmas decor - Santa Claus
Christmas reindeer wine bottle cover with brown plush fabric and long hanging legs - Elk Style
Christmas Wine Bottle Covers Dimensional Santa Snowman Reindeer Long Leg Knitted Fabric Holiday Party Table Decor
$2.25
Mix MOQ : 2
Christmas Wine Bottle Cover Knitted Mini Sweater Hat Table Decor Cartoon Santa Snowman Reindeer Festive Party Holiday Ornament
Christmas Wine Bottle Cover Knitted Mini Sweater Hat Table Decor Cartoon Santa Snowman Reindeer Festive Party Holiday Ornament
like
Find Similar
Christmas wine bottle cover set with knitted sweater and Santa Claus design - Santa Claus Style
Christmas wine bottle cover set featuring red snowman knitted sweater and matching mini hat - Snowman Style
Christmas wine bottle cover set with knitted sweater and reindeer decor for holiday table - Reindeer Style
Christmas Wine Bottle Cover Knitted Mini Sweater Hat Table Decor Cartoon Santa Snowman Reindeer Festive Party Holiday Ornament
-4%
$1.29
No MOQ
Christmas Wine Bottle Covers Knitted Fabric Santa Snowman Reindeer Cartoon Decoration For Holiday Party Table Dinner
Christmas Wine Bottle Covers Knitted Fabric Santa Snowman Reindeer Cartoon Decoration For Holiday Party Table Dinner
like
Find Similar
Christmas snowman wine bottle cover decoration with hat and red scarf detail - Snowman
Santa Claus knitted wine bottle cover with belt detail and white beard, size 28.5x10cm - Santa Claus
Christmas reindeer wine bottle cover with size 28.5x10cm and cute knit elk design - Elk Style
Christmas Wine Bottle Covers Knitted Fabric Santa Snowman Reindeer Cartoon Decoration For Holiday Party Table Dinner
-4%
$1.37
No MOQ
Christmas Wine Bottle Cover Linen Plaid Faux Fur Santa Snowman Reindeer Holiday Party Dinner Table Decor Festive Gift Bag
Christmas Wine Bottle Cover Linen Plaid Faux Fur Santa Snowman Reindeer Holiday Party Dinner Table Decor Festive Gift Bag
like
Find Similar
Christmas snowman wine bottle cover with red plaid burlap and faux fur trim decor - Snowman / Gray
Christmas burlap wine bottle cover featuring red plaid design and Santa Claus applique - Santa Claus / Red
Beige burlap Christmas wine bottle cover featuring a cute 3D reindeer with red plaid trim - Elk Style / Beige
Christmas Wine Bottle Cover Linen Plaid Faux Fur Santa Snowman Reindeer Holiday Party Dinner Table Decor Festive Gift Bag
$1.30
No MOQ
Funny Christmas Wine Bottle Labels Humorous Holiday Stickers Santa Favorite Ho Christmas Juice Bottle Decor Party Accessories
Funny Christmas Wine Bottle Labels Humorous Holiday Stickers Santa Favorite Ho Christmas Juice Bottle Decor Party Accessories
like
Find Similar
Set of 4 festive Christmas wine bottle stickers with red glitter Santa design - Santa Favorite Style (QT1521-1)
Funny Christmas wine bottle stickers with Santa Claus illustration and festive border - Humorous Santa Blessing Style (QT1521-2)
Set of 4 Christmas Juice wine bottle stickers featuring white background and golden glitter toast - Christmas Juice Glass Style (QT1521-3)
Set of 4 festive Merry and Bright Christmas wine bottle labels with colorful snowflakes - Merry and Bright Snowflake Style (QT1521-4)
+1
Funny Christmas Wine Bottle Labels Humorous Holiday Stickers Santa Favorite Ho Christmas Juice Bottle Decor Party Accessories
$0.86
Mix MOQ : 2
Free Shipping
Christmas Wine Bottle Cover Knitted Mini Sweater Hat Set Reindeer Snowman Tree Design Festive Holiday Table Party Decor
Christmas Wine Bottle Cover Knitted Mini Sweater Hat Set Reindeer Snowman Tree Design Festive Holiday Table Party Decor
like
Find Similar
Knitted Christmas wine bottle cover set with green snowman sweater and red mini hat - Snowman Style (ML-O769C)
Christmas wine bottle cover set with knitted mini sweater and hat in green and white - Christmas Tree Style (ML-O769B)
Christmas wine bottle cover with red knitted mini sweater featuring JOY text and snowflake - Letter JOY Style (ML-O769D)
Blue knitted Christmas wine bottle cover with reindeer pattern and matching hat - Reindeer Style (ML-O769A)
NewChristmas Wine Bottle Cover Knitted Mini Sweater Hat Set Reindeer Snowman Tree Design Festive Holiday Table Party Decor
$1.87
Mix MOQ : 2
Christmas Wine Bottle Cover Burlap Linen Gift Bag With Applique Santa Claus Snowman Reindeer Holiday Party Table Decoration
Christmas Wine Bottle Cover Burlap Linen Gift Bag With Applique Santa Claus Snowman Reindeer Holiday Party Table Decoration
like
Find Similar
Linen Christmas wine bottle cover featuring Santa Claus design in army green burlap - Santa Claus Green
Linen Christmas wine bottle bag featuring a 3D reindeer design with red plaid accents - Reindeer Natural Burlap
Red burlap Christmas wine bottle cover featuring a 3D snowman with plaid hat - Snowman Red
Christmas burlap wine bottle cover featuring a 3D snowman with green plaid hat - Snowman Natural Burlap
Christmas Wine Bottle Cover Burlap Linen Gift Bag With Applique Santa Claus Snowman Reindeer Holiday Party Table Decoration
-5%
$1.04
Mix MOQ : 2
Book Reading Theme Waterproof PVC Stickers For Laptop Notebook Water Bottle Students Kids DIY Decorative Graffiti Stickers
Book Reading Theme Waterproof PVC Stickers For Laptop Notebook Water Bottle Students Kids DIY Decorative Graffiti Stickers
like
Find Similar
50pcs library themed waterproof stickers for books, computers and student stationery decor - List T01040383-1: 50 Doodles/graffiti
Book Reading Theme Waterproof PVC Stickers For Laptop Notebook Water Bottle Students Kids DIY Decorative Graffiti Stickers
$0.95
Mix MOQ : 2
Self Adhesive English Label Stickers Ins Style Paper Decals For Flower Vase Glass Bottle Jar Home Decor Minimalist
Self Adhesive English Label Stickers Ins Style Paper Decals For Flower Vase Glass Bottle Jar Home Decor Minimalist
like
Find Similar
Ins style minimalist English label stickers for vases on textured linen background - Cactus Text / White
Ins style glass storage jar with white circular label and black artistic typography - Round/Accept My Mind
Self Adhesive English Label Stickers Ins Style Paper Decals For Flower Vase Glass Bottle Jar Home Decor Minimalist
$0.02
No MOQ
 · 
20 views
Christmas Candy Jar Gingerbread Man Plush Lid Clear Plastic Storage Bottle Holiday Party Gifts Cute Cartoon Decoration
Christmas Candy Jar Gingerbread Man Plush Lid Clear Plastic Storage Bottle Holiday Party Gifts Cute Cartoon Decoration
like
Find Similar
Miniature gingerbread man Christmas candy jar with festive plush toy top and clear base - Red Hat Style
Mini Christmas gingerbread man candy jar with festive knitted hat and clear round base - White Hat Style
Christmas Candy Jar Gingerbread Man Plush Lid Clear Plastic Storage Bottle Holiday Party Gifts Cute Cartoon Decoration
-4%
$1.78
No MOQ
Vintage Gold Celestial Mythology Stickers Waterproof Blue Moon Sun Goddess Astrology Decals For Laptop Water Bottle Phone Case Decor
Vintage Gold Celestial Mythology Stickers Waterproof Blue Moon Sun Goddess Astrology Decals For Laptop Water Bottle Phone Case Decor
like
Find Similar
Macro view of vintage gold and navy stickers with celestial, moon and sun patterns - Star Moon Mythology Style (T01042591)
NewVintage Gold Celestial Mythology Stickers Waterproof Blue Moon Sun Goddess Astrology Decals For Laptop Water Bottle Phone Case Decor
$0.86
Mix MOQ : 5
Cute Raccoon Cartoon Stickers Waterproof PVC Vinyl Decals For Laptop Water Bottle Scrapbook Luggage Guitar DIY Decoration
Cute Raccoon Cartoon Stickers Waterproof PVC Vinyl Decals For Laptop Water Bottle Scrapbook Luggage Guitar DIY Decoration
like
Find Similar
Set of 56 cute cartoon raccoon doodle stickers in various poses and costumes - Cartoon Raccoon Style (T01042924)
Cute Raccoon Cartoon Stickers Waterproof PVC Vinyl Decals For Laptop Water Bottle Scrapbook Luggage Guitar DIY Decoration
$0.86
Mix MOQ : 2
Mini Christmas Hats Non-Woven Felt Plaid Fabric Wine Bottle Covers Lollipop Decorations Cutlery Holders Festive Holiday Party Decor
Mini Christmas Hats Non-Woven Felt Plaid Fabric Wine Bottle Covers Lollipop Decorations Cutlery Holders Festive Holiday Party Decor
like
Find Similar
Close-up of mini red and white plush Christmas hat for wine bottles and cutlery decor - Lollipop Hat (3.5*8.5cm)
Close-up of a red and white mini plush Christmas hat on a green festive background - Classic Red Wine Bottle/Cutlery Hat (6*12cm)
Red and black plaid Christmas mini hats silverware holders on white dinner plate - Red and Black Plaid Cutlery Hat (6*12cm)
Mini Christmas Hats Non-Woven Felt Plaid Fabric Wine Bottle Covers Lollipop Decorations Cutlery Holders Festive Holiday Party Decor
$0.07-0.10
No MOQ
Christmas Candy Jar Storage Bottle With Plush Cartoon Santa Snowman Reindeer Bear For Holiday Festive Party Gifts
Christmas Candy Jar Storage Bottle With Plush Cartoon Santa Snowman Reindeer Bear For Holiday Festive Party Gifts
like
Find Similar
Mini Santa Claus Christmas candy jar with felt hat and transparent ball on wood base - Mini Candy Jar [Round Bottle Santa Claus]
Mini Christmas snowman candy jar with pink hat and clear container for holiday treats - Mini Candy Jar [Round Bottle Snowman]
Macro view of Christmas bear candy jar with blue knit hat on round wooden base - Mini Candy Jar [Round Bottle Bear]
Christmas Candy Jar Storage Bottle With Plush Cartoon Santa Snowman Reindeer Bear For Holiday Festive Party Gifts
-4%
$0.77
No MOQ
 · 
20 sold recently
Cartoon Animal Stickers For Kids Waterproof Vinyl PVC Decals For Laptop Water Bottle Luggage Skateboard Scrapbook Kawaii Decoration
Cartoon Animal Stickers For Kids Waterproof Vinyl PVC Decals For Laptop Water Bottle Luggage Skateboard Scrapbook Kawaii Decoration
like
Find Similar
Detailed collection of cute animal stickers featuring colorful cartoon designs in flat layout - Animal Theme 100 Sheets (Style 1)
Collection of 100 colorful cartoon animal stickers with waterproof matte finish for kids - Animal Theme 100 Sheets (Style 2)
Cartoon Animal Stickers For Kids Waterproof Vinyl PVC Decals For Laptop Water Bottle Luggage Skateboard Scrapbook Kawaii Decoration
$0.97
No MOQ
Christmas Wine Bottle Cover Linen Burlap 3D Santa Snowman Reindeer Doll Holiday Table Decor Cartoon Party Home Ornament
Christmas Wine Bottle Cover Linen Burlap 3D Santa Snowman Reindeer Doll Holiday Table Decor Cartoon Party Home Ornament
like
Find Similar
Green Christmas burlap wine bottle gift bag with 3D Santa Claus doll and measurements - Green Santa Claus
Handcrafted Christmas burlap wine bottle bag featuring 3D reindeer doll design - Burlap Reindeer
Christmas burlap wine bottle bag with 3D snowman doll decoration, 30.5x14.5cm - Linen Snowman
Christmas linen snowman wine bottle bag with dimensions and weight specs. - Red Snowman Style
Christmas Wine Bottle Cover Linen Burlap 3D Santa Snowman Reindeer Doll Holiday Table Decor Cartoon Party Home Ornament
$1.04
No MOQ
Christmas Wine Bottle Cover Santa Claus Snowman Reindeer Bear Mini Sweater Hat Xmas Dinner Table Holiday Party Decoration
Christmas Wine Bottle Cover Santa Claus Snowman Reindeer Bear Mini Sweater Hat Xmas Dinner Table Holiday Party Decoration
like
Find Similar
Detail of red knitted Christmas wine bottle cover with Santa applique and mini hat - Santa Claus
Close-up of a Christmas wine bottle cover featuring a red knit sweater with a 3D snowman motif - Snowman
Detailed view of a plush reindeer wine bottle sweater with a matching mini Santa hat - Elk Style
Close-up of a festive Christmas wine bottle cover featuring a red sweater with a 3D bear - Bear Style
Christmas Wine Bottle Cover Santa Claus Snowman Reindeer Bear Mini Sweater Hat Xmas Dinner Table Holiday Party Decoration
$1.67
No MOQ
Christmas Wine Bottle Cover Burlap Polyester Drawstring Bag With 3D Santa Snowman Reindeer Bear Doll Holiday Table Decor
Christmas Wine Bottle Cover Burlap Polyester Drawstring Bag With 3D Santa Snowman Reindeer Bear Doll Holiday Table Decor
like
Find Similar
Green burlap Christmas wine bottle cover with Santa Claus and glitter tree design - Santa Claus Style
Red burlap Christmas wine bottle bag with 3D snowman and festive glitter tree design - Snowman Style
Christmas burlap wine bottle bag featuring a plush reindeer and green tree decoration - Reindeer Style
Christmas burlap wine bottle gift bag with a 3D plush teddy bear and festive holiday tree - Bear Style
Christmas Wine Bottle Cover Burlap Polyester Drawstring Bag With 3D Santa Snowman Reindeer Bear Doll Holiday Table Decor
-4%
$1.34
No MOQ
Christmas Knitted Wine Bottle Cover Mini Sweater And Hat Snowman Reindeer Christmas Tree Joy Design Holiday Party Supplies
Christmas Knitted Wine Bottle Cover Mini Sweater And Hat Snowman Reindeer Christmas Tree Joy Design Holiday Party Supplies
like
Find Similar
Knitted red Christmas wine bottle cover featuring a snowman pattern and a matching mini hat - Snowman
Knitted Christmas wine bottle cover set with green and red JOY sweater and hat - JOY Letter Style
Blue knitted Christmas wine bottle sweater with reindeer pattern and matching mini hat - Elk Style
Christmas knitted wine bottle cover with red mini sweater and green tree design - Christmas Tree
Christmas Knitted Wine Bottle Cover Mini Sweater And Hat Snowman Reindeer Christmas Tree Joy Design Holiday Party Supplies
-4%
$1.97
Mix MOQ : 2
Free Shipping
Mini Christmas Hats Red White Velvet Wine Bottle Covers Cutlery Holders Lollipop Decorations Festive Party Ornaments
Mini Christmas Hats Red White Velvet Wine Bottle Covers Cutlery Holders Lollipop Decorations Festive Party Ornaments
like
Find Similar
Mini red and white plush Santa hat 7x4cm for wine bottles and holiday cutlery decor - 4*7cm Mini Lollipop Hat
Mini red and white Christmas hat for wine bottles and cutlery, size 12x6cm on white background - 6*12cm Wine Bottle/Cutlery Cap
Mini Christmas Hats Red White Velvet Wine Bottle Covers Cutlery Holders Lollipop Decorations Festive Party Ornaments
-11%
$0.08-0.09
No MOQ
 · 
105 sold recently
Christmas Wine Bottle Covers Felt Faux Fur Swedish Gnome Tomte With Bell Holly For Holiday Dinner Party Table Decoration
Christmas Wine Bottle Covers Felt Faux Fur Swedish Gnome Tomte With Bell Holly For Holiday Dinner Party Table Decoration
like
Find Similar
Christmas gnome wine bottle cover with red knit hat and white beard on a festive table - Red
Christmas gnome wine bottle cover with long beard and green bell hat for holiday decor - Green
Christmas gnome wine bottle cover with grey felt hat, bells and long white beard decoration - Gray
Christmas Wine Bottle Covers Felt Faux Fur Swedish Gnome Tomte With Bell Holly For Holiday Dinner Party Table Decoration
$1.82
No MOQ
Free Shipping
Christmas Wine Bottle Decoration Knitted Mini Hat And Scarf Santa Reindeer Xmas Tree Pattern Festive Party Table Ornament
Christmas Wine Bottle Decoration Knitted Mini Hat And Scarf Santa Reindeer Xmas Tree Pattern Festive Party Table Ornament
like
Find Similar
Christmas knitted mini hat and scarf wine bottle set with Ho Ho Ho pattern - Santa Claus
Christmas striped knitted hat and deer scarf set for wine bottle decoration - Christmas Reindeer Style
Christmas wine bottle decoration set with red and green striped knit hat and scarf - Christmas Tree
Christmas Wine Bottle Decoration Knitted Mini Hat And Scarf Santa Reindeer Xmas Tree Pattern Festive Party Table Ornament
$1.24
No MOQ
Christmas Wine Bottle Cover Cute Cartoon Long Leg Santa Claus Snowman Reindeer Knitted Fabric Dining Table Decor Gift
Christmas Wine Bottle Cover Cute Cartoon Long Leg Santa Claus Snowman Reindeer Knitted Fabric Dining Table Decor Gift
like
Find Similar
Christmas snowman wine bottle cover with long legs for festive holiday table decoration - Snowman
Christmas Santa Claus long leg wine bottle cover decoration for festive holiday tables - Santa Claus
Christmas reindeer wine bottle cover with brown plush fabric and long legs ornament - Elk Style
Christmas Wine Bottle Cover Cute Cartoon Long Leg Santa Claus Snowman Reindeer Knitted Fabric Dining Table Decor Gift
-5%
$2.60
No MOQ
Christmas Wine Bottle Cover Knitted Acrylic Santa Snowman Reindeer Pattern Holiday Dinner Table Decor Novelty Gift
Christmas Wine Bottle Cover Knitted Acrylic Santa Snowman Reindeer Pattern Holiday Dinner Table Decor Novelty Gift
like
Find Similar
Christmas Santa knit wine bottle cover with white pom-poms for festive table decor - Santa Claus
Christmas snowman knitted wine bottle cover with red bow and plush pompoms decoration - Snowman
Knitted red and white reindeer pattern wine bottle cover with white pom-pom drawstrings - Elk Style
Christmas Wine Bottle Cover Knitted Acrylic Santa Snowman Reindeer Pattern Holiday Dinner Table Decor Novelty Gift
$2.07
Mix MOQ : 2
Christmas Wine Bottle Covers Gnome Faceless Elder Reindeer Antler Top Hat Tree Fabric Faux Fur Holiday Table Decoration
Christmas Wine Bottle Covers Gnome Faceless Elder Reindeer Antler Top Hat Tree Fabric Faux Fur Holiday Table Decoration
like
Find Similar
Christmas gnome wine bottle cover with red reindeer antler hat and white plush beard - Red Hat with Reindeer Antlers
Christmas gnome wine bottle cover with black hat and white beard for holiday decor - Black Top Hat
Christmas gnome wine bottle cover with green tree hat and long white plush beard decoration - Christmas Tree Hat
Christmas Wine Bottle Covers Gnome Faceless Elder Reindeer Antler Top Hat Tree Fabric Faux Fur Holiday Table Decoration
-5%
$1.42
No MOQ
Free Shipping
Christmas Gnome Wine Bottle Covers Felt Faux Fur Holiday Dinner Table Decor Handmade Rudolph Snowman Tree Designs
Christmas Gnome Wine Bottle Covers Felt Faux Fur Holiday Dinner Table Decor Handmade Rudolph Snowman Tree Designs
like
Find Similar
Christmas gnome wine bottle cover with reindeer antlers and red hat festive decor - Rudolph Style
Christmas gnome wine bottle cover with red striped hat and white faux fur beard decor - Elf
Christmas gnome wine bottle cover with long white beard and black top hat decoration - Snowman
Christmas Gnome Wine Bottle Covers Felt Faux Fur Holiday Dinner Table Decor Handmade Rudolph Snowman Tree Designs
-5%
$1.42
No MOQ
Christmas Wine Bottle Covers Gnome Nordic Faceless Plaid Antler Top Hat Fabric Plush Holiday Dining Table Decor
Christmas Wine Bottle Covers Gnome Nordic Faceless Plaid Antler Top Hat Fabric Plush Holiday Dining Table Decor
like
Find Similar
Red and black plaid Christmas wine bottle cover with white beard and pine decoration - Red and Black Plaid Hat Gnome
Christmas gnome wine bottle cover with black hat and red plaid ribbon decoration - Top Hat Gnome
Christmas gnome wine bottle cover featuring reindeer antlers and a long white beard - Reindeer Antler Gnome
Christmas Wine Bottle Covers Gnome Nordic Faceless Plaid Antler Top Hat Fabric Plush Holiday Dining Table Decor
-5%
$1.70
No MOQ
Knitted Wine Bottle Cover Christmas Gnome Santa Claus Design With Pom Pom Drawstring Holiday Party Table Decoration Nordic Style
Knitted Wine Bottle Cover Christmas Gnome Santa Claus Design With Pom Pom Drawstring Holiday Party Table Decoration Nordic Style
like
Find Similar
Knitted Santa gnome wine bottle cover in red and grey with festive ribbon bow and pompoms - Red
Knitted Christmas wine bottle cover with purple gnome pattern and plush pom-poms - Gray
Knitted Christmas gnome wine bottle cover in red and green with a decorative pom-pom - Green
Knitted Wine Bottle Cover Christmas Gnome Santa Claus Design With Pom Pom Drawstring Holiday Party Table Decoration Nordic Style
$1.87
Mix MOQ : 2
Christmas Wine Bottle Cover Red Black Buffalo Plaid Cloth Embroidery Faux Fur Collar Holiday Party Decoration
Christmas Wine Bottle Cover Red Black Buffalo Plaid Cloth Embroidery Faux Fur Collar Holiday Party Decoration
like
Find Similar
3 options
Christmas Wine Bottle Cover Red Black Buffalo Plaid Cloth Embroidery Faux Fur Collar Holiday Party Decoration
$1.87
Mix MOQ : 2
Christmas Wine Bottle Cover Decor Mini Hat And Scarf Red Plaid Cloth Festive Table Decoration Novelty Accessory
Christmas Wine Bottle Cover Decor Mini Hat And Scarf Red Plaid Cloth Festive Table Decoration Novelty Accessory
like
Find Similar
Christmas wine bottle decoration set with red felt mini hat and red black plaid scarf - Red Hat Plaid Scarf Set
Christmas wine bottle decoration set with red black plaid hat and knit scarf on table - Plaid Hat Red Scarf Set
Mini Christmas wine bottle decor set featuring red and black plaid hat and matching scarf - Plaid Pointed Hat + Plaid Scarf Set
Christmas Wine Bottle Cover Decor Mini Hat And Scarf Red Plaid Cloth Festive Table Decoration Novelty Accessory
$0.61
No MOQ
Christmas Gnome Candy Jar Knitted Hat Faceless Doll Plastic Storage Bottle Forest Man Holiday Gift Home Table Decor
Christmas Gnome Candy Jar Knitted Hat Faceless Doll Plastic Storage Bottle Forest Man Holiday Gift Home Table Decor
like
Find Similar
Christmas gnome candy jar with red snowflake knit hat and transparent globe base - Red Snowflake Hat/White Long Beard / Red
Grey knitted gnome Christmas candy jar ornament with snowflake hat on wooden sleigh - Grey Snowflake Hat/White Long Beard / Gray
Gnome candy jar with green snowflake knit hat and white beard Christmas decoration - Green Snowflake Hat/White Long Beard / Green
Christmas Gnome Candy Jar Knitted Hat Faceless Doll Plastic Storage Bottle Forest Man Holiday Gift Home Table Decor
-5%
$1.51
No MOQ
50Pcs Cute Cartoon Capybara Stickers Waterproof PVC Vinyl Decals For Laptop Guitar Luggage Water Bottle DIY Decoration
50Pcs Cute Cartoon Capybara Stickers Waterproof PVC Vinyl Decals For Laptop Guitar Luggage Water Bottle DIY Decoration
like
Find Similar
Pack of 50 waterproof cartoon Capybara stickers for laptop, guitar and DIY decoration - 50 Pieces Non-repeating
50Pcs Cute Cartoon Capybara Stickers Waterproof PVC Vinyl Decals For Laptop Guitar Luggage Water Bottle DIY Decoration
$0.98
No MOQ
Creative Christmas Wine Bottle Cover Printed Polyester Decorative Bag Santa Claus Snowman Reindeer Pattern Holiday Party Table Decoration
Creative Christmas Wine Bottle Cover Printed Polyester Decorative Bag Santa Claus Snowman Reindeer Pattern Holiday Party Table Decoration
like
Find Similar
Christmas Santa Claus wine bottle bag with festive illustration and gold ribbon bow - Santa Claus
Light blue snowman wine bottle bag with a gold ribbon for Christmas table decoration - Snowman
Christmas reindeer wine bottle bag with snowy scene and golden silk bow decoration - Elk Style
Creative Christmas Wine Bottle Cover Printed Polyester Decorative Bag Santa Claus Snowman Reindeer Pattern Holiday Party Table Decoration
-5%
$0.52
No MOQ
Funny Peeking Black Cat Stickers PVC Waterproof Decorative Decals For Car Truck Laptop Water Bottle Luggage Wall Home
Funny Peeking Black Cat Stickers PVC Waterproof Decorative Decals For Car Truck Laptop Water Bottle Luggage Wall Home
like
Find Similar
Size specifications for 8pcs waterproof cat stickers showing various dimensions in cm and inches - 30x20cm/2 Sheets/8 Patterns / Black Cat
Funny Peeking Black Cat Stickers PVC Waterproof Decorative Decals For Car Truck Laptop Water Bottle Luggage Wall Home
$1.15
Mix MOQ : 2
Christmas Gnome Wine Bottle Topper Knitted Swedish Tomte Long Beard Wine Bottle Cover Holiday Dinner Table Party Decor Ornament
Christmas Gnome Wine Bottle Topper Knitted Swedish Tomte Long Beard Wine Bottle Cover Holiday Dinner Table Party Decor Ornament
like
Find Similar
Christmas gnome wine bottle cover with knitted snowflake hat and wooden base decor - Light Brown Beard Gray Knitted Hat
Knitted Christmas gnome decoration with long brown beard and grey striped hat on wood - Dark Beard Gray Hat
Christmas gnome wine bottle cover with red knitted snowflake hat and grey faux fur beard - Gray Beard Red Knitted Hat
Knitted Christmas gnome wine bottle cover with red striped hat and long white beard - White Beard Red Knitted Hat Red Arms
Christmas Gnome Wine Bottle Topper Knitted Swedish Tomte Long Beard Wine Bottle Cover Holiday Dinner Table Party Decor Ornament
$1.61
Mix MOQ : 2
Christmas Wine Bottle Cover Santa Claus Snowman Reindeer Bear Brushed Fabric Merry Christmas Decoration Festive Table Ornament
Christmas Wine Bottle Cover Santa Claus Snowman Reindeer Bear Brushed Fabric Merry Christmas Decoration Festive Table Ornament
like
Find Similar
Detail of red felt wine bottle cover with Santa Claus and Merry Christmas gold pendant - Santa Claus
Red Christmas wine bottle cover featuring a 3D snowman and gold Merry Christmas tag - Snowman
Christmas wine bottle cover with 3D reindeer plush and golden Merry Christmas sign - Elk
Christmas wine bottle cover with plush bear decor and gold Merry Christmas lettering - Bear
NewChristmas Wine Bottle Cover Santa Claus Snowman Reindeer Bear Brushed Fabric Merry Christmas Decoration Festive Table Ornament
-4%
$0.88
Mix MOQ : 2
Christmas Wine Bottle Cover Knitted Gnome Tomte Faceless Doll Long Beard Snowflake Nordic Holiday Table Decoration Gift
Christmas Wine Bottle Cover Knitted Gnome Tomte Faceless Doll Long Beard Snowflake Nordic Holiday Table Decoration Gift
like
Find Similar
Christmas gnome wine bottle cover with red and grey knitted hat and long white beard - Red Gray Snowflake Style (Knitted Long Hair Face Cover 1)
Christmas gnome wine bottle cover with red and grey wave patterns and brown beard - Red Gray Wavy Geometric Style (Knitted Long Hair Face Cover 3)
Gnome wine bottle cover with grey snowflake knit hat and long white beard for Christmas décor - Gray Base Snowflake Red Wavy Style (Knitted Long Hair Face Cover 2)
Christmas gnome wine bottle cover with red knitted snowflake hat and long grey beard - Red White Snowflake Geometric Style (Knitted Long Hair Face Cover 4)
Christmas Wine Bottle Cover Knitted Gnome Tomte Faceless Doll Long Beard Snowflake Nordic Holiday Table Decoration Gift
-5%
$1.64
Mix MOQ : 2
Cute Cartoon Girl Stickers Waterproof PVC Decorative Decals For Luggage Water Bottle Fridge Helmet DIY Craft Stickers
Cute Cartoon Girl Stickers Waterproof PVC Decorative Decals For Luggage Water Bottle Fridge Helmet DIY Craft Stickers
like
Find Similar
64pcs cute cartoon girl stickers for DIY decoration of suitcase and water bottles - Original Cute Girl Style
Cute Cartoon Girl Stickers Waterproof PVC Decorative Decals For Luggage Water Bottle Fridge Helmet DIY Craft Stickers
$0.95
No MOQ
Burlap Christmas Wine Bottle Cover Gift Bag With Drawstring Merry Christmas Plaid Tree Poinsettia Red Truck Holiday Decor
Burlap Christmas Wine Bottle Cover Gift Bag With Drawstring Merry Christmas Plaid Tree Poinsettia Red Truck Holiday Decor
like
Find Similar
Linen Christmas wine bottle bag with red black plaid tree and Merry Christmas print - Christmas Tree Style (Type A)
Linen Christmas wine bottle cover with red plaid neck and poinsettia flower decor - Poinsettia Style (Type B)
Linen Christmas wine bottle cover with red buffalo plaid neck and gnomes design - Christmas Truck Style (Type C)
Burlap Christmas Wine Bottle Cover Gift Bag With Drawstring Merry Christmas Plaid Tree Poinsettia Red Truck Holiday Decor
-5%
$1.64
Mix MOQ : 2
Christmas Gnome Wine Bottle Covers Faceless Old Man Wine Bottle Bags With Long Beard And Wood Buttons Table Decor
Christmas Gnome Wine Bottle Covers Faceless Old Man Wine Bottle Bags With Long Beard And Wood Buttons Table Decor
like
Find Similar
Green Forest Gnome Christmas wine bottle cover set with wood button felt bag - Green
Christmas gnome wine bottle cover set with red hat and 35cm striped hat decorative bag - Red
Grey Christmas gnome and felt gift bag set with dimensions 35cm height for holiday decor - Grey
Christmas Gnome Wine Bottle Covers Faceless Old Man Wine Bottle Bags With Long Beard And Wood Buttons Table Decor
-5%
$2.05
Mix MOQ : 2
Christmas Candy Jar Clear Plastic Storage Bottle With Plush Reindeer Polar Bear Head And Knit Scarf Holiday Decor Gift
Christmas Candy Jar Clear Plastic Storage Bottle With Plush Reindeer Polar Bear Head And Knit Scarf Holiday Decor Gift
like
Find Similar
Christmas reindeer plush candy jar with transparent container and striped scarf variant - White Antler Reindeer
Polar bear Christmas candy jar with white plush details and colorful striped scarf - White Polar Bear
Christmas reindeer candy jar with brown plush head and blue scarf, 26cm tall storage gift - Brown Antler Reindeer
Christmas Candy Jar Clear Plastic Storage Bottle With Plush Reindeer Polar Bear Head And Knit Scarf Holiday Decor Gift
-5%
$2.38
No MOQ
Waterproof PVC Matte Inspirational English Stickers For Laptop Water Bottle Suitcase Skateboard Graffiti Decals
Waterproof PVC Matte Inspirational English Stickers For Laptop Water Bottle Suitcase Skateboard Graffiti Decals
like
Find Similar
Set of 100 colorful English motivational stickers for laptop and water bottle decoration - English Quotes Set
Waterproof PVC Matte Inspirational English Stickers For Laptop Water Bottle Suitcase Skateboard Graffiti Decals
$1.91
No MOQ
Christmas Wine Bottle Cover Sequin Reindeer Antler Gnome Wine Bottle Topper Rudolph Santa Beard Xmas Table Decor Red Gold Grey
Christmas Wine Bottle Cover Sequin Reindeer Antler Gnome Wine Bottle Topper Rudolph Santa Beard Xmas Table Decor Red Gold Grey
like
Find Similar
Detail of Christmas wine bottle cover with red sequins, reindeer antlers and white beard - Red Hat Gnome Wine Bottle Cover
Detail of Christmas wine bottle cover with gold sequins, white beard and reindeer antlers - Gold Hat Gnome Wine Bottle Cover
Close-up of a Christmas gnome wine bottle cover with grey sequins and white beard decor - Grey Hat Gnome Wine Bottle Cover
Christmas Wine Bottle Cover Sequin Reindeer Antler Gnome Wine Bottle Topper Rudolph Santa Beard Xmas Table Decor Red Gold Grey
-4%
$1.92
Mix MOQ : 2
Christmas Sequin Gnome Wine Bottle Cover Rudolph Reindeer Antler White Beard Striped Sleeve Festive Table Decor Holiday Gift
Christmas Sequin Gnome Wine Bottle Cover Rudolph Reindeer Antler White Beard Striped Sleeve Festive Table Decor Holiday Gift
like
Find Similar
Detail of Christmas wine bottle cover with red sequins, reindeer antlers and white beard - Red Sequin Bottle Cover
Detail of Christmas wine bottle cover with gold sequins, white beard and reindeer antlers - Gold Sequin Bottle Cover
Close-up of a Christmas gnome wine bottle cover with grey sequins and white beard decor - Silver Sequin Bottle Cover
Christmas Sequin Gnome Wine Bottle Cover Rudolph Reindeer Antler White Beard Striped Sleeve Festive Table Decor Holiday Gift
-4%
$1.92
Mix MOQ : 2
56Pcs Skull Book Reading Stickers Waterproof PVC Gothic Vintage Skeleton Decals For Laptop Water Bottle Scrapbooking Decoration
56Pcs Skull Book Reading Stickers Waterproof PVC Gothic Vintage Skeleton Decals For Laptop Water Bottle Scrapbooking Decoration
like
Find Similar
Waterproof skull and book stickers for DIY scrapbooking with 'Friends with books' design - Skull Reading Mix (T01042890)
56Pcs Skull Book Reading Stickers Waterproof PVC Gothic Vintage Skeleton Decals For Laptop Water Bottle Scrapbooking Decoration
$0.86
Mix MOQ : 2
50Pcs Halloween Zombie Food Stickers Horror Funny Waterproof PVC Decals For DIY Notebook Water Bottle Laptop Party Decor
50Pcs Halloween Zombie Food Stickers Horror Funny Waterproof PVC Decals For DIY Notebook Water Bottle Laptop Party Decor
like
Find Similar
Detail view showing 50 colorful cartoon zombie food stickers for Halloween DIY decor - 50 Sheets/Pack
50Pcs Halloween Zombie Food Stickers Horror Funny Waterproof PVC Decals For DIY Notebook Water Bottle Laptop Party Decor
$0.86
No MOQ
Cute Cartoon Little Yellow Duck Waterproof PVC Stickers For Laptop Luggage Skateboard Water Bottle Non Repeating Decorative Decals
Cute Cartoon Little Yellow Duck Waterproof PVC Stickers For Laptop Luggage Skateboard Water Bottle Non Repeating Decorative Decals
like
Find Similar
50 pieces of waterproof cartoon yellow duck stickers for luggage and laptops in vivid colors - Occupational Little Yellow Duck Style (T01041929)
Cute Cartoon Little Yellow Duck Waterproof PVC Stickers For Laptop Luggage Skateboard Water Bottle Non Repeating Decorative Decals
$0.95
Mix MOQ : 2
Waterproof PVC Book Reading Graffiti Stickers Cartoon Decorative Decals For Laptop Water Bottle Luggage Library Theme Gift
Waterproof PVC Book Reading Graffiti Stickers Cartoon Decorative Decals For Laptop Water Bottle Luggage Library Theme Gift
like
Find Similar
50pcs waterproof reading stickers set for book lovers DIY laptops and luggage decor - Book Reading Theme
Waterproof PVC Book Reading Graffiti Stickers Cartoon Decorative Decals For Laptop Water Bottle Luggage Library Theme Gift
$0.96
No MOQ
Christmas Elf Pants Gift Bag Felt Wine Bottle Cover Candy Pouch Festive Holiday Party Decoration Red Green Striped
Christmas Elf Pants Gift Bag Felt Wine Bottle Cover Candy Pouch Festive Holiday Party Decoration Red Green Striped
like
Find Similar
Christmas elf pants gift bag for wine bottles and candy with red and green festive colors - Green Wave Style
Christmas elf pants gift bag with red and green stripe design and pom-pom boots - All Green Legs Style
Christmas elf pants gift bag in red and green felt for candy and wine bottles - All Red Legs Style
Christmas Elf Pants Gift Bag Felt Wine Bottle Cover Candy Pouch Festive Holiday Party Decoration Red Green Striped
-4%
$4.38
No MOQ
Velvet Christmas Wine Bottle Cover Mini Santa Clothes And Dress With Faux Fur Holiday Party Table Decoration Home Ornament
Velvet Christmas Wine Bottle Cover Mini Santa Clothes And Dress With Faux Fur Holiday Party Table Decoration Home Ornament
like
Find Similar
Christmas wine bottle cover in Santa suit style with red velvet and a gold belt - Coat Style (G-JT103)
Christmas wine bottle cover in red velvet dress style with white fur trim and belt - Dress Style (G-JT104)
Velvet Christmas Wine Bottle Cover Mini Santa Clothes And Dress With Faux Fur Holiday Party Table Decoration Home Ornament
-25%
$0.97-1.05
No MOQ
Handheld Hot Water Bottle With Plush Faux Fur Cover Plaid Handle Lucky Embroidery Warm Winter Belly Hand Warmer For Girls
Handheld Hot Water Bottle With Plush Faux Fur Cover Plaid Handle Lucky Embroidery Warm Winter Belly Hand Warmer For Girls
like
Find Similar
Detail of plush brown hot water bottle featuring lucky star embroidery and plaid handle - Portable Lucky - Coffee (With Liner)
Detailed view of plush pink hot water bottle with heart embroidery and blue bow accent - Portable Lucky - Pink (With Liner)
Detail of black plush hot water bag with red checkered handle and apple embroidery - Portable Lucky - Black (With Liner)
Handheld Hot Water Bottle With Plush Faux Fur Cover Plaid Handle Lucky Embroidery Warm Winter Belly Hand Warmer For Girls
$4.03
No MOQ
Christmas Mini Knit Hats Pompom Yarn Pendants Snowflake Pattern For Doll Accessories Wine Bottles Decorative Hanging Ornaments
Christmas Mini Knit Hats Pompom Yarn Pendants Snowflake Pattern For Doll Accessories Wine Bottles Decorative Hanging Ornaments
like
Find Similar
Mini red knitted Christmas hat with green pattern for festive doll decorations - Knitted Red Hat
Mini green knitted Christmas hat with red snowflake pattern and white pompom 7x6cm - Knitted Green Hat with White Ball
Mini knitted green Christmas hat with red wave pattern for festive tree decoration - Knitted Green Hat
Christmas Mini Knit Hats Pompom Yarn Pendants Snowflake Pattern For Doll Accessories Wine Bottles Decorative Hanging Ornaments
$0.69
Mix MOQ : 2
Free Shipping
Christmas Wine Bottle Covers Linen Plush Plaid Santa Snowman Reindeer Styles Decorative Drawstring Wine Bags For Party Decor
Christmas Wine Bottle Covers Linen Plush Plaid Santa Snowman Reindeer Styles Decorative Drawstring Wine Bags For Party Decor
like
Find Similar
Christmas snowman wine bottle cover with red scarf and plaid hat decoration - New Linen Plaid Snowman Style
Christmas Santa red wine bottle cover with plaid fabric and white plush beard decor - New Linen Plaid Santa Style
Christmas reindeer wine bottle cover with red scarf and knit texture for table decor - New Linen Plaid Reindeer Style
NewChristmas Wine Bottle Covers Linen Plush Plaid Santa Snowman Reindeer Styles Decorative Drawstring Wine Bags For Party Decor
-4%
$2.14
No MOQ
Nordic Christmas Gnome Wine Bottle Cover Knitted Snowflake Faceless Old Man Wine Bag Holiday Table Dining Decoration
Nordic Christmas Gnome Wine Bottle Cover Knitted Snowflake Faceless Old Man Wine Bag Holiday Table Dining Decoration
like
Find Similar
Christmas gnome wine bottle cover with green snowflake knit hat and long beard decoration - Green
Christmas gnome wine bottle cover with red knitted snowflake hat and white faux fur beard - Red
Christmas gnome wine bottle cover with grey snowflake knitted hat and long white beard decor - Gray
Nordic Christmas Gnome Wine Bottle Cover Knitted Snowflake Faceless Old Man Wine Bag Holiday Table Dining Decoration
-5%
$1.45
Mix MOQ : 2
New Year 2026 Cheers Year Banner And Champagne Bottle Bunting Glitter Paper Party Decoration Eve Celebration Shiny
New Year 2026 Cheers Year Banner And Champagne Bottle Bunting Glitter Paper Party Decoration Eve Celebration Shiny
like
Find Similar
2025 New Year decoration banner with gold glitter Cheers Year text and bottle shapes - Black Gold Cheers Year 2026 Banner With Bottle Garland
Sparkly silver Cheers 2025 glitter banner with champagne bottle party decorations - Black Silver Cheers Year 2026 Banner With Bottle Garland
Glittering Rose Gold 2025 New Year Banner with Cheers Text and Champagne Bottle Shapes - Black Rose Gold Cheers Year 2026 Banner With Bottle Garland
New Year 2026 Cheers Year Banner And Champagne Bottle Bunting Glitter Paper Party Decoration Eve Celebration Shiny
-4%
$2.14
Mix MOQ : 5
Christmas Wine Bottle Cover Knitted Gnome Wine Bag With Snowflake Pattern Nordic Forest Man Champagne Bottle Sleeves For Xmas Party Table Decor
Christmas Wine Bottle Cover Knitted Gnome Wine Bag With Snowflake Pattern Nordic Forest Man Champagne Bottle Sleeves For Xmas Party Table Decor
like
Find Similar
3 options
Christmas Wine Bottle Cover Knitted Gnome Wine Bag With Snowflake Pattern Nordic Forest Man Champagne Bottle Sleeves For Xmas Party Table Decor
-5%
$2.08
Mix MOQ : 2
Go to

More in home & kitchen

Explore more in steel bottles

steeldoubledisplaymagnetickidsstrapdiywidetitaniumgirls
304 stainless steel316 stainless steelnaturalstylebarplasticmetalpolishedshapenecklace stainless steel

Ready to source like an insider

Get a direct line to the factory floor — no minimums, no middlemen, no guesswork.
iconReal factory pricing, no markup in betweeniconEvery order hand-inspected before it shipsicon5,000+ new products added daily
Get Inside Access