Everful

Wholesale steel bottles

Factory-direct selection, vetted for quality and ready to order.

Sign Up
Steel Bottles

Find the perfect pieces: vacuum flasks & thermoses, tumblers, mugs and more

filterShow Filters
Best Seller
New Arrivals
Price Drop
Free Shipping
Cartoon Embroidered Patch Heart Rose Slogan Skeleton Iron On Applique For Clothing Backpack DIY Decorative Repair Patch
Cartoon Embroidered Patch Heart Rose Slogan Skeleton Iron On Applique For Clothing Backpack DIY Decorative Repair Patch
like
Find Similar
Detail of embroidered patch showing purple ribbon with text You Are Safe With Me - Purple Pin Safe With Me Design (PE5145CT)
Detail of Brain Freeze embroidered patch with colorful drink design and neat borders - Brain Freeze Slushie Drink Design (PE5149CT)
Cartoon embroidery patch with broken red heart and black wine bottle design, 7.2x5.5cm - Broken Heart And Wine Bottle Design (PE5151CT)
Sitting leopard cartoon embroidery patch with orange and black spots 8.2x6.5cm - Orange Leopard Pattern (PE5157CT)
+3
Cartoon Embroidered Patch Heart Rose Slogan Skeleton Iron On Applique For Clothing Backpack DIY Decorative Repair Patch
-6%
$0.22-0.55
Mix MOQ : 10
 · 
10 sold recently
Free Shipping
Dollhouse Miniature Simulation Candy Glass Jar With Cork Stopper Micro Landscape Scene Accessories For DIY Handmade Decoration
Dollhouse Miniature Simulation Candy Glass Jar With Cork Stopper Micro Landscape Scene Accessories For DIY Handmade Decoration
like
Find Similar
Miniature glass candy jar with colorful beads and cork lid for dollhouse decor, 2.1cm height - Long Multicolor Bottle
Miniature glass jar with cork stopper filled with colorful beads for dollhouse DIY decor - Short Multicolor Bottle
Miniature glass candy jar with cork stopper and colorful beads for dollhouse DIY - Long Candy Multicolor Bottle
Miniature glass candy jar with colorful beads and cork stopper for dollhouse DIY 1.2x1.8cm - Short Candy Multicolor Bottle
Dollhouse Miniature Simulation Candy Glass Jar With Cork Stopper Micro Landscape Scene Accessories For DIY Handmade Decoration
$0.13
Mix MOQ : 6
 · 
56 sold recently
Cartoon Astronaut Space Whale Wall Stickers For Kids Room Bedroom Nursery Home Decor Self Adhesive PVC DIY Space Art Decal
Cartoon Astronaut Space Whale Wall Stickers For Kids Room Bedroom Nursery Home Decor Self Adhesive PVC DIY Space Art Decal
like
Find Similar
3 options
Cartoon Astronaut Space Whale Wall Stickers For Kids Room Bedroom Nursery Home Decor Self Adhesive PVC DIY Space Art Decal
$1.38
Mix MOQ : 2
Vintage Rustic Sunflower Glass Jar Tableware Wall Sticker PVC Self Adhesive Kitchen Dining Room Decor Wall Decal English Slogan
Vintage Rustic Sunflower Glass Jar Tableware Wall Sticker PVC Self Adhesive Kitchen Dining Room Decor Wall Decal English Slogan
like
Find Similar
Vintage sunflower mason jar wall sticker with English motto 38x28cm size - Sunflower English Glass Bottle (HY-F291)
Vintage Rustic Sunflower Glass Jar Tableware Wall Sticker PVC Self Adhesive Kitchen Dining Room Decor Wall Decal English Slogan
$1.01
No MOQ
Beer Theme Cartoon Embroidery Patches Polyester Iron On Patches For Clothing Bags DIY Decoration Accessories Applique
Beer Theme Cartoon Embroidery Patches Polyester Iron On Patches For Clothing Bags DIY Decoration Accessories Applique
like
Find Similar
Embroidered craft beer bottle patch for clothing with iron-on backing, 6.6cm x 5.3cm size - Beer Patch #1
Cartoon beer bottle and barrel embroidered patch with Beer lettering and dimensions - Beer Patch #2
Cartoon beer mug embroidery patch with yellow foam and size dimensions 6.7x5.5cm - Large Beer Mug Style (AZ2507A6-3)
Round craft beer bottle cap embroidery patch with original lettering on white background - Bottle Cap Badge Style (AZ2507A6-3)
+11
Beer Theme Cartoon Embroidery Patches Polyester Iron On Patches For Clothing Bags DIY Decoration Accessories Applique
$0.23-4.24
No MOQ
 · 
24 sold recently
Free Shipping
Double Sided Easter Garden Flag Linen Spring Bunny Flower Pattern Outdoor Yard Festive Hanging Decorative Sign No Flagpole
Double Sided Easter Garden Flag Linen Spring Bunny Flower Pattern Outdoor Yard Festive Hanging Decorative Sign No Flagpole
like
Find Similar
Double-sided linen Easter garden flag with grey rabbit and pink roses floral design - Grey Rabbit Flower Garden Flag
Hello Spring garden flag with flowers in mason jars on linen for outdoor patio decor - Colorful Bottles Spring Garden Flag
Easter bunny linen garden flag with pink rabbit and floral wreath welcome design - Bunny Ears Bouquet Garden Flag
Pink linen Easter garden flag featuring a rabbit with floral crown and Happy Easter text - Pink Background Cute Bunny Garden Flag
+2
Double Sided Easter Garden Flag Linen Spring Bunny Flower Pattern Outdoor Yard Festive Hanging Decorative Sign No Flagpole
-4%
$0.96
No MOQ
Halloween Hair Claw Clip UV Printed Plastic Pumpkin Ghost Bat Design Cartoon Festive Party Accessory For Women Jewelry
Halloween Hair Claw Clip UV Printed Plastic Pumpkin Ghost Bat Design Cartoon Festive Party Accessory For Women Jewelry
like
Find Similar
Detail of Halloween flower hair claw with pumpkin, ghost and bat patterns on orange surface - 8cm / Orange Flower Pumpkin Ghost Style
Close-up of flower-shaped Halloween claw clip with ghosts and pumpkin prints - 8cm / Red Flower Pumpkin Bat Style
Detail of Halloween hair claw clip with black cat and witch hat prints on orange flower base - 8cm / Bright Orange Flower Cat Wizard Hat Style
Detail view of flower-shaped Halloween hair claw with pumpkin and skull prints - 8cm / Black Pumpkin Skull Star Style
+40
Halloween Hair Claw Clip UV Printed Plastic Pumpkin Ghost Bat Design Cartoon Festive Party Accessory For Women Jewelry
-4%
$0.36-0.47
No MOQ
 · 
14 views
Cartoon Cartoon Embroidered Patches For Clothing DIY Heart Animal Flower Applique Polyester Embroidery Sewing Supplies Patch
Cartoon Cartoon Embroidered Patches For Clothing DIY Heart Animal Flower Applique Polyester Embroidery Sewing Supplies Patch
like
Find Similar
Self-adhesive rose red heart patch with HUGS embroidery and premium stitched borders - Rose Red Heart-HUGS
Round floral embroidery patch with pink flowers and silver thread on white felt - Round Flower
Creative milk carton embroidery patch with blue thread and cow motif on white background - Blue Milk Box
Classic red heart embroidered patch with white LOVE text for clothing decoration - Red Heart-LOVE
+37
Cartoon Cartoon Embroidered Patches For Clothing DIY Heart Animal Flower Applique Polyester Embroidery Sewing Supplies Patch
-9%
$0.10-0.22
No MOQ
 · 
320 sold recently
Cartoon Animal Food Embroidered Patches For Clothing Decoration Polyester Iron On Sew On DIY Applique Patches For Bags Jackets
Cartoon Animal Food Embroidered Patches For Clothing Decoration Polyester Iron On Sew On DIY Applique Patches For Bags Jackets
like
Find Similar
Embroidered fish patch in light blue silk thread, measuring 2.2 cm by 1.0 cm for DIY crafts - Blue Fish Style (1*)
Embroidered yellow wine bottle patch variant measuring 4.4 cm by 1.8 cm on white background - Yellow Bottle Style (2*)
Cat head embroidery patch in yellow and blue colors with size 2.8x2.4 cm - Blue Yellow Cat Head Style (3*)
Cartoon black cat head embroidered self-adhesive patch, size 2.1x2.4 cm, for clothing repair - Black Cat Head Style (4*)
+11
Cartoon Animal Food Embroidered Patches For Clothing Decoration Polyester Iron On Sew On DIY Applique Patches For Bags Jackets
-6%
$0.15
No MOQ
 · 
453 sold recently
Cartoon Embroidery Patches For Clothing DIY Iron On Patch Cute Decorative Appliques Polyester Fabric For Shoes Hats Bags
Cartoon Embroidery Patches For Clothing DIY Iron On Patch Cute Decorative Appliques Polyester Fabric For Shoes Hats Bags
like
Find Similar
Pink flip-flop embroidery patch for shoes and hats with silver star detail, 4.5x4.0cm size - Pink Flip Flops (8)
Blue flip-flop cartoon embroidery patch with orange starfish, size 4.5x4.0cm, style 9 - Blue Starfish Flip Flops (9)
Pink flip-flop embroidery patch with yellow dots and daisy detail, size 6.0 x 2.5 cm - Pink Daisy Flip Flops (11)
Lollipop embroidered patch in red and purple with size dimensions 12.0cm x 6.7cm - Red Lollipop (6)
+15
Cartoon Embroidery Patches For Clothing DIY Iron On Patch Cute Decorative Appliques Polyester Fabric For Shoes Hats Bags
-6%
$0.14-0.19
No MOQ
 · 
82 sold recently
Vintage Transparent PET Mushroom Jar Stickers Waterproof Hand Drawn Botanical Aesthetic Decals For Scrapbooking DIY Diary Decor
Vintage Transparent PET Mushroom Jar Stickers Waterproof Hand Drawn Botanical Aesthetic Decals For Scrapbooking DIY Diary Decor
like
Find Similar
50pcs vintage mushroom bottle stickers, waterproof PET decals for scrapbooking and guitar - Transparent Mushroom Bottle Series
Vintage Transparent PET Mushroom Jar Stickers Waterproof Hand Drawn Botanical Aesthetic Decals For Scrapbooking DIY Diary Decor
$1.04
No MOQ
Creative Penguin Enamel Pin Alloy Cartoon Animal Brooch Laboratory Science Drink Theme For Backpack Jacket Hat Women Men Gift
Creative Penguin Enamel Pin Alloy Cartoon Animal Brooch Laboratory Science Drink Theme For Backpack Jacket Hat Women Men Gift
like
Find Similar
Creative enamel penguin brooch with telescope and stars on a white reflective base - Telescope Penguin Style (CC2066)
Enamel penguin brooch standing by a yellow bottle with a gold-plated metal finish - Yellow Bottle Penguin Style (CC2067)
Creative penguin and laboratory flask enamel brooch with gold-plated metal edges - Flask Penguin Style (CC2068)
Enamel penguin pin drinking from a glass goblet with gold metal lines and white background - Juice Penguin Style (CC2069)
Creative Penguin Enamel Pin Alloy Cartoon Animal Brooch Laboratory Science Drink Theme For Backpack Jacket Hat Women Men Gift
-9%
$0.60
No MOQ
Free Shipping
Cartoon Cat Anti Depressant Stickers Waterproof PVC DIY Healing Animal Decals For Water Cup Notebook Laptop Decor
Cartoon Cat Anti Depressant Stickers Waterproof PVC DIY Healing Animal Decals For Water Cup Notebook Laptop Decor
like
Find Similar
50 pieces of waterproof cartoon cat stickers in pill bottle designs for DIY crafts - Cat Anti Depressant Bottle Series (PMS224)
Cartoon Cat Anti Depressant Stickers Waterproof PVC DIY Healing Animal Decals For Water Cup Notebook Laptop Decor
$0.96
No MOQ
Gothic Vintage Specimen Decorative Stickers Waterproof PVC Dark Style Scrapbooking Decals For Laptop Luggage Guitar Skateboard
Gothic Vintage Specimen Decorative Stickers Waterproof PVC Dark Style Scrapbooking Decals For Laptop Luggage Guitar Skateboard
like
Find Similar
50 Gothic dark style glass jar graffiti stickers for luggage and guitar decoration - Dark World in Bottle
Gothic Vintage Specimen Decorative Stickers Waterproof PVC Dark Style Scrapbooking Decals For Laptop Luggage Guitar Skateboard
$0.95
No MOQ
Clear Plastic Nail Art Storage Box Set Multi-Grid Transparent Jewelry Organizer For Rhinestones Beads Accessory Storage
Clear Plastic Nail Art Storage Box Set Multi-Grid Transparent Jewelry Organizer For Rhinestones Beads Accessory Storage
like
Find Similar
White triangle nail art sorting tray for rhinestones and beads size 72x62mm - Triangle Tray (72*62mm)
Pink nail art display frame set with numbered card and clear acrylic panels - Photo Frame Display Assembly / Rose Red
Pink 48-grid nail polish color display book with embossed frame and stand support - European Style Rose Red Display Board
White nail art display frame set with round base and clear acrylic plates on black - Photo Frame Display Assembly / White
+23
Clear Plastic Nail Art Storage Box Set Multi-Grid Transparent Jewelry Organizer For Rhinestones Beads Accessory Storage
$0.05-1.38
No MOQ
 · 
99 views
Museum of Utensils Series PET Stickers Retro Transparent Decorative Labels For Scrapbooking DIY Crafts 20PCS
Museum of Utensils Series PET Stickers Retro Transparent Decorative Labels For Scrapbooking DIY Crafts 20PCS
like
Find Similar
Set of 20 transparent PET storage jar stickers with white line art for scrapbooking - Storage Tank
Minimalist vintage bottle PET stickers set with 20 pieces in white ink on orange background - Time Bottle
Wish Bottle series transparent PET stickers set with 20 pieces of various vessel designs - Wish Bottle
Museum of Utensils Series PET Stickers Retro Transparent Decorative Labels For Scrapbooking DIY Crafts 20PCS
$0.81
No MOQ
Vintage White Lace PET Decorative Stickers Set Retro Butterfly Flower White Ink Waterproof Journaling Scrapbooking DIY Stationery Stickers
Vintage White Lace PET Decorative Stickers Set Retro Butterfly Flower White Ink Waterproof Journaling Scrapbooking DIY Stationery Stickers
like
Find Similar
Set of 30 white lace PET stickers featuring 15 delicate vintage patterns for journaling - Milk Flavor Au Lait
Vintage white lace frame stickers set for journaling, 30 pieces of PET decorative borders - Lace European Frame
Petal and moon art stickers in white line drawing style, 30pcs transparent PET pack - Pure White Territory
Artistic PET sticker set featuring 15 hand-drawn white ink glass bottle designs 30 pieces - Bottle Story
+2
Vintage White Lace PET Decorative Stickers Set Retro Butterfly Flower White Ink Waterproof Journaling Scrapbooking DIY Stationery Stickers
-10%
$0.70
No MOQ
Vintage Japanese Paper Sticker Book Art Poster Series Retro DIY Scrapbooking Material For Journaling Decoration Base
Vintage Japanese Paper Sticker Book Art Poster Series Retro DIY Scrapbooking Material For Journaling Decoration Base
like
Find Similar
Retro typewriter and script alphabet washi stickers for vintage scrapbooking and journals - Past Memories
Plant Notes vintage washi sticker set with botanical illustrations for DIY scrapbooking - Botanical Notes
Vintage sewing theme washi sticker set with mannequin and machine for DIY journaling - Sewing Academy
Vintage bottle-themed washi sticker book with retro poster designs for DIY journaling - Message in a Bottle
+2
Vintage Japanese Paper Sticker Book Art Poster Series Retro DIY Scrapbooking Material For Journaling Decoration Base
-10%
$0.96
No MOQ
 · 
12 views
Vintage Rose Laser Gold PET Decorative Stickers Scrapbooking Journaling Aesthetic Retro Floral Butterfly Window Decoration
Vintage Rose Laser Gold PET Decorative Stickers Scrapbooking Journaling Aesthetic Retro Floral Butterfly Window Decoration
like
Find Similar
Rose Window PET stickers with laser gold finish for DIY scrapbooking decoration - Rose Window
Moonlight Rose decorative PET stickers with laser gold finish, 20 pieces pack - Moonlight Rose
Holographic gold butterfly stickers made of PET for DIY scrapbooking decoration - Butterfly Dance
Golden laser PET rose stickers set with 10 vintage floral designs in 20 pieces pack - Flower in Bottle
+2
Vintage Rose Laser Gold PET Decorative Stickers Scrapbooking Journaling Aesthetic Retro Floral Butterfly Window Decoration
-9%
$1.01
No MOQ
Free Shipping
Vintage Lace Yarn Series Hollow Material Paper For Scrapbooking Journaling DIY Decor Butterfly Floral Theme Scrapbook Paper Set
Vintage Lace Yarn Series Hollow Material Paper For Scrapbooking Journaling DIY Decor Butterfly Floral Theme Scrapbook Paper Set
like
Find Similar
Set of 33pcs vintage butterfly lace stickers for DIY journaling with hollow textures - Butterfly Garden
33 pieces of vintage lace butterfly stickers for DIY scrapbooking and journal decoration - Thousands Knot
Lace floral scrapbooking stickers set with 30 pieces of translucent DIY material papers - Glazed Bottle
Vintage lace scrapbook paper set with 33 pieces of colorful hollow design for DIY journals - Stained Window
+1
Vintage Lace Yarn Series Hollow Material Paper For Scrapbooking Journaling DIY Decor Butterfly Floral Theme Scrapbook Paper Set
$1.07
No MOQ
Free Shipping
Vintage Magic Secrets PET Sticker Pack Witch Potion Animal Castle Decorative Decals For Scrapbooking DIY Journaling Art Craft
Vintage Magic Secrets PET Sticker Pack Witch Potion Animal Castle Decorative Decals For Scrapbooking DIY Journaling Art Craft
like
Find Similar
Magic Potion theme PET sticker set with 15 vintage watercolor designs for journaling - Magic Bottle Potions
Vintage Magic Secrets PET Sticker Pack Witch Potion Animal Castle Decorative Decals For Scrapbooking DIY Journaling Art Craft
$0.85
No MOQ
Vintage Steampunk Gear Rhapsody PET Decorative Tape Iridescent Holographic Mechanical Pattern Scrapbooking DIY Craft Sticker
Vintage Steampunk Gear Rhapsody PET Decorative Tape Iridescent Holographic Mechanical Pattern Scrapbooking DIY Craft Sticker
like
Find Similar
Steampunk gear rhapsody PET washi tape with iridescent finish and vintage rusty machine patterns - Rusty Mechanical City
Mechanical galaxy themed PET tape with colorful gears and iridescent rainbow finish - Mechanical Galaxy
Retro steampunk PET tape with colorful gears and mechanical patterns in iris finish - Steel Gear Maze
Gear Rhapsody decorative PET tape with iridescent pulse pattern for journaling - Iron Gear Pulse
+2
NewVintage Steampunk Gear Rhapsody PET Decorative Tape Iridescent Holographic Mechanical Pattern Scrapbooking DIY Craft Sticker
$1.39
No MOQ
 · 
13 sold recently
Go to

More in home & kitchen

Explore more in steel bottles

steeldoubledisplaymagnetickidsstrapdiywidetitaniumgirls
304 stainless steel316 stainless steelnaturalstylebarplasticmetalpolishedshapenecklace stainless steel

Ready to source like an insider

Get a direct line to the factory floor — no minimums, no middlemen, no guesswork.
iconReal factory pricing, no markup in betweeniconEvery order hand-inspected before it shipsicon5,000+ new products added daily
Get Inside Access