Everful

Wholesale steel bottles

Factory-direct selection, vetted for quality and ready to order.

Sign Up
Steel Bottles

Find the perfect pieces: vacuum flasks & thermoses, tumblers, mugs and more

filterShow Filters
Best Seller
New Arrivals
Price Drop
Free Shipping
Vintage Relief 304 Stainless Steel Flatware Elegant Antique Style Dinnerware For Steak Table Service
Vintage Relief 304 Stainless Steel Flatware Elegant Antique Style Dinnerware For Steak Table Service
like
Find Similar
Embossed stainless steel dinner knife with vintage European pattern, length 24.2cm - Dinner Knife
Vintage embossed 304 stainless steel dinner fork with ornate handle pattern detail - Dinner Fork
Vintage dinner spoon with embossed pattern handle and distressed stainless steel finish - Dinner Spoon
Vintage 304 stainless steel tea spoon with embossed floral handle in matte silver - Tea Spoon
+3
Vintage Relief 304 Stainless Steel Flatware Elegant Antique Style Dinnerware For Steak Table Service
-5%
$1.31-6.08
No MOQ
 · 
52 views
Portable Fruit Knife Stainless Steel Blade With Protective Ventilated Sheath Plastic Handle Candy Color Paring Tool
Portable Fruit Knife Stainless Steel Blade With Protective Ventilated Sheath Plastic Handle Candy Color Paring Tool
like
Find Similar
Portable stainless steel fruit paring knife with protective blue handle and matching sheath - Blue
Portable green fruit knife with matching sheath and high quality stainless steel blade - Green
Close-up of a beige stainless steel paring knife with a matching protective sheath cover - Beige
Detail view of the green stainless steel fruit knife with protective vented sheath - Nordic Green
+3
Portable Fruit Knife Stainless Steel Blade With Protective Ventilated Sheath Plastic Handle Candy Color Paring Tool
$0.11
Mix MOQ : 4
 · 
36 sold recently
Stainless Steel Cake Server Pizza Spatula Serrated Edge Triangular Pie Divider Mirror Polished Baking Tool
Stainless Steel Cake Server Pizza Spatula Serrated Edge Triangular Pie Divider Mirror Polished Baking Tool
like
Find Similar
Polished stainless steel cake server with serrated edge 18cm length and 51g weight - Silver
Golden stainless steel cake server with serrated edge, 18x5cm kitchen baking tool - Gold
Rose gold stainless steel cake server with serrated edge 18cm long and 5cm wide - Rose Gold
Rainbow plated stainless steel cake server and pizza cutter with serrated edge, 18cm length - AB Color
+2
Stainless Steel Cake Server Pizza Spatula Serrated Edge Triangular Pie Divider Mirror Polished Baking Tool
-5%
$0.38-0.82
Mix MOQ : 2
 · 
38 sold recently
304 Stainless Steel Kitchen Utensils Walnut Wood Handle Turner Spatula Soup Spoon Colander Heat Resistant Japanese Style
304 Stainless Steel Kitchen Utensils Walnut Wood Handle Turner Spatula Soup Spoon Colander Heat Resistant Japanese Style
like
Find Similar
Japanese style 304 stainless steel long ladle with a 26cm walnut wood handle - Walnut Wood Handle Soup Spoon
304 stainless steel slotted spoon with walnut handle for ramen and hot pot, 26cm length - Walnut Wood Handle Slotted Spoon
304 stainless steel kitchen spatula with walnut wood handle, size 27x6.9cm and 41g - Walnut Wood Handle Square Spatula
Japanese style 304 stainless steel spatula with walnut handle, size 28.5cm x 6.2cm - Walnut Wood Handle Round Spatula
+5
304 Stainless Steel Kitchen Utensils Walnut Wood Handle Turner Spatula Soup Spoon Colander Heat Resistant Japanese Style
$1.79-3.03
No MOQ
 · 
23 views
Free Shipping
Mini Electric Milk Frother And Egg Beater 304 Stainless Steel Coffee Mixer Portable Battery Operated Kitchen Tool
Mini Electric Milk Frother And Egg Beater 304 Stainless Steel Coffee Mixer Portable Battery Operated Kitchen Tool
like
Find Similar
Handheld black electric milk frother and coffee stirrer with stainless steel whisk - Black
Pink handheld electric milk frother and coffee stirrer with durable metal whisk head - Pink
Tiffany blue handheld electric milk frother and coffee mixer for kitchen use - Sky Blue
White and bronze handheld electric milk frother with stainless steel whisk on white background - White
+2
Mini Electric Milk Frother And Egg Beater 304 Stainless Steel Coffee Mixer Portable Battery Operated Kitchen Tool
-4%
$0.70
Mix MOQ : 2
 · 
35 sold recently
Mini Deep Fryer Pot 304 Stainless Steel With Red Handle Filter Basket Small Frying Pan For Chicken Tempura Kitchen Tool
Mini Deep Fryer Pot 304 Stainless Steel With Red Handle Filter Basket Small Frying Pan For Chicken Tempura Kitchen Tool
like
Find Similar
Mini stainless steel deep fryer pot with red anti-scald handle and frying basket - Fryer Pot + Red Handle Basket / 304 Stainless Steel
4-piece 304 stainless steel deep fryer set with lid, oil strainer and food tongs - Fryer Pot + Basket + Tongs + Lid / 304 Stainless Steel
Stainless steel deep fryer set with 304 fry pot, red handle basket, and lid dimensions - Fryer Pot + Basket + Stove Rack + Lid / 304 Stainless Steel
304 stainless steel mini deep fryer with food clip and integrated pour spout - Fryer Pot + Tongs / 304 Stainless Steel
+26
Mini Deep Fryer Pot 304 Stainless Steel With Red Handle Filter Basket Small Frying Pan For Chicken Tempura Kitchen Tool
-5%
$1.49-4.91
No MOQ
 · 
96 views
304 Stainless Steel Chocolate Melting Pot With Dual Pour Spouts And Long Handle For Baking Butter Candle Wax
304 Stainless Steel Chocolate Melting Pot With Dual Pour Spouts And Long Handle For Baking Butter Candle Wax
like
Find Similar
Stainless steel chocolate melting pot with dual pour spouts and wire handle for baking - 400ml / 304 Stainless Steel / Silver
304 stainless steel chocolate melting pot with double pour spouts and retail box - 600ml/304 Steel/Brown Box / Silver
400ML stainless steel chocolate melting pot set with dual pour spouts and outer pan - 400ml Pot+14cm Outer Pot / Silver Jewelry Set
600ML stainless steel chocolate melting pot set with 16CM outer pan and handle - 600ml Pot+16cm Outer Pot / Silver Jewelry Set
+46
304 Stainless Steel Chocolate Melting Pot With Dual Pour Spouts And Long Handle For Baking Butter Candle Wax
$1.67-9.08
No MOQ
 · 
117 sold recently
Vacuum Insulated Coffee Tumbler 316 Stainless Steel Leak Proof With Strap Floral Print Portable Travel Mug
Vacuum Insulated Coffee Tumbler 316 Stainless Steel Leak Proof With Strap Floral Print Portable Travel Mug
like
Find Similar
Twilight Black 316 stainless steel coffee tumbler with matte finish and black lanyard - Solid Night Black
Retro lily coffee travel mug in cream white with woven lanyard and floral design - Beige
Matte black 500ml coffee tumbler with SUS316 stainless steel liner and floral pattern - Lily Valley Night Black
Vintage red 500ML coffee tumbler with SUS316 stainless steel interior and carry strap - Lily Valley Retro Red
+11
Vacuum Insulated Coffee Tumbler 316 Stainless Steel Leak Proof With Strap Floral Print Portable Travel Mug
$3.60-3.72
No MOQ
 · 
53 views
Stainless Steel Rolling Grill Basket Cylindrical Mesh Round Outdoor BBQ Picnic Camping Portable Cooking Tool
Stainless Steel Rolling Grill Basket Cylindrical Mesh Round Outdoor BBQ Picnic Camping Portable Cooking Tool
like
Find Similar
Portable stainless steel rolling grill basket with wood handle and metal hook 45cm - Large with Wooden Handle (with Hook)
Portable stainless steel rolling BBQ grill cage with wooden handle and size dimensions - Small with Wooden Handle (with Hook)
Portable stainless steel rolling BBQ grill basket with fork and hook accessories - Small Single Pack with Fork + Hook
Stainless steel rolling barbecue cage set with two grill forks and a metal hook - Large Single Pack with Fork + Hook
+6
Stainless Steel Rolling Grill Basket Cylindrical Mesh Round Outdoor BBQ Picnic Camping Portable Cooking Tool
$1.82-4.90
No MOQ
 · 
50 sold recently
Matte Double Wall Plastic Tumbler With Straw And Lid Reusable Solid Color Modern Simple Water Bottle For Travel Office
Matte Double Wall Plastic Tumbler With Straw And Lid Reusable Solid Color Modern Simple Water Bottle For Travel Office
like
Find Similar
Matte double-walled 16oz plastic tumbler with straw in vibrant red color finish - 16oz / Orange
Matte black double-layered 16oz plastic tumbler with matching straw in a sleek design - 16oz / Black
Matte grey double-wall plastic 16oz tumbler with straw on a clean white background - 16oz / Gray
Detail of pink matte 16oz double-layer plastic tumbler with matching lid and straw - 16oz / Dragon Fruit
+1
Matte Double Wall Plastic Tumbler With Straw And Lid Reusable Solid Color Modern Simple Water Bottle For Travel Office
$2.88
Mix MOQ : 2
 · 
545 sold recently
Stainless Steel Stirring Spoons Long Handle Coffee Spoons Mirror Polished Round Dessert Spoons Modern Kitchen Tableware
Stainless Steel Stirring Spoons Long Handle Coffee Spoons Mirror Polished Round Dessert Spoons Modern Kitchen Tableware
like
Find Similar
Long handle stainless steel coffee spoon with mirror polish, 13.5cm length and 10g weight - 13.5cm / Silver
Golden long handle stainless steel coffee stirrer spoon, 13.5cm length with polished finish - 13.5cm / Gold
Long handle golden stainless steel mixing spoon for coffee and dessert 15.5cm - 15.5cm / Gold
Stainless Steel Stirring Spoons Long Handle Coffee Spoons Mirror Polished Round Dessert Spoons Modern Kitchen Tableware
-3%
$0.17-0.28
Mix MOQ : 2
 · 
89 sold recently
304 Stainless Steel Cartoon Animal Spoon And Fork Cute Baby Training Utensils For Kids Toddlers Mirror Polished
304 Stainless Steel Cartoon Animal Spoon And Fork Cute Baby Training Utensils For Kids Toddlers Mirror Polished
like
Find Similar
304 stainless steel baby spoon with purple pig cartoon pattern and dimension markings - Pig Spoon
304 stainless steel cartoon dog spoon for baby feeding measuring 15.5cm in length - Dog Spoon
304 stainless steel baby spoon with blue hamster cartoon and 15.5cm length - Cat Spoon
304 stainless steel baby spoon with frog pattern, measuring 15.5cm for infant feeding - Frog Spoon
+16
304 Stainless Steel Cartoon Animal Spoon And Fork Cute Baby Training Utensils For Kids Toddlers Mirror Polished
$0.74-0.97
No MOQ
 · 
37 sold recently
Frosted Water Bottle Plastic Gradient Portable Drinking Bottle With Strap Deer Moon Star Pattern For Students School
Frosted Water Bottle Plastic Gradient Portable Drinking Bottle With Strap Deer Moon Star Pattern For Students School
like
Find Similar
Gradient blue plastic water bottle with white lid and purple strap featuring deer patterns - Upgraded PC Plastic / 500ml / Frosted Blue
Frosted grey large plastic water bottle with deer and moon patterns and carry strap - Upgraded PC Plastic / 500ml / Matte Grey
Blue gradient frosted plastic water bottle with white cap and deer moon star print - AS Plastic / 500ml / Frosted Blue
Gradient orange frosted plastic water bottle with deer motif and carry strap - AS Plastic / 500ml / Matte Orange
+14
Frosted Water Bottle Plastic Gradient Portable Drinking Bottle With Strap Deer Moon Star Pattern For Students School
$0.66-1.84
Mix MOQ : 2
 · 
200 sold recently
Stainless Steel Hook Clips Non-Slip Dipped Plastic Coated Multi-Functional Hanging Pegs For Laundry Closet Kitchen Storage
Stainless Steel Hook Clips Non-Slip Dipped Plastic Coated Multi-Functional Hanging Pegs For Laundry Closet Kitchen Storage
like
Find Similar
Blue rubber coated stainless steel hook clip with 10.5cm height for scarf storage - 5 Pcs/Pack / Blue
White non-slip coated stainless steel hook clips for scarves and home laundry storage - 5 Pcs/Pack / Off White
Stainless steel laundry hook clip with non-slip green PVC coating for scarves - 5 Pcs/Pack / Green
Pink rubber coated stainless steel hook clips for non-slip scarf and clothes storage - 5 Pcs/Pack / Pink
+2
Stainless Steel Hook Clips Non-Slip Dipped Plastic Coated Multi-Functional Hanging Pegs For Laundry Closet Kitchen Storage
$0.07
Mix MOQ : 5
 · 
4K+ sold recently
Rotating Stainless Steel Kitchen Utensil Holder Organizer With Removable Dividers For Countertop Storage Crock
Rotating Stainless Steel Kitchen Utensil Holder Organizer With Removable Dividers For Countertop Storage Crock
like
Find Similar
Rotating stainless steel kitchen utensil holder in silver finish with black dividers - Box Packaging / Black
Rotating stainless steel kitchen utensil holder with gray trim and four compartments - Box Packaging / Gray
Rotating stainless steel kitchen utensil holder in beige and brushed silver finish - Box Packaging / Khaki
Rotating Stainless Steel Kitchen Utensil Holder Organizer With Removable Dividers For Countertop Storage Crock
$2.88
Mix MOQ : 2
 · 
13 sold recently
Professional Stainless Steel Pizza Cutter Wheel Roller And Cake Server Spatula For Baking Kitchen Tools Ergonomic Handle
Professional Stainless Steel Pizza Cutter Wheel Roller And Cake Server Spatula For Baking Kitchen Tools Ergonomic Handle
like
Find Similar
Stainless steel pizza cutter wheel with round handle on a dark stone tabletop - Single Wheel Pizza Cutter
Stainless steel pastry cutter with wavy wheel blade and cylindrical handle - Wavy Edge Pizza Cutter
Dual stainless steel pizza cutter wheel with smooth and wavy blades on dark stone surface - Double Wheel Pizza Cutter
Silver stainless steel triangular pizza server with serrated edge on stone tabletop - Cake Server Shovel
+1
Professional Stainless Steel Pizza Cutter Wheel Roller And Cake Server Spatula For Baking Kitchen Tools Ergonomic Handle
-5%
$0.38
No MOQ
 · 
114 sold recently
Stainless Steel Fruit Slicer Corer Apple Mango Cutter With Ergonomic Anti Slip Handle Manual Kitchen Tool
Stainless Steel Fruit Slicer Corer Apple Mango Cutter With Ergonomic Anti Slip Handle Manual Kitchen Tool
like
Find Similar
Green stainless steel apple slicer with 8 blades and ergonomic plastic handles - Apple Slicer Style 1 Green
White stainless steel apple slicer with blue non-slip handles for 8-wedge coring - Apple Slicer Style 2 / Blue
Kitchen apple slicer with white plastic frame and pink silicone anti-slip handles - Apple Slicer Style 2 / Red
Green and white stainless steel apple slicer and corer with 8 sharp blades - Apple Slicer Style 2 / Green
Stainless Steel Fruit Slicer Corer Apple Mango Cutter With Ergonomic Anti Slip Handle Manual Kitchen Tool
$1.01-1.10
No MOQ
 · 
130 sold recently
Reindeer Antler Coffee Spoons And Dessert Forks 304 Stainless Steel Christmas Holiday Gift Mirror Polished Cutlery Tableware
Reindeer Antler Coffee Spoons And Dessert Forks 304 Stainless Steel Christmas Holiday Gift Mirror Polished Cutlery Tableware
like
Find Similar
Silver stainless steel coffee spoon with unique elk antler handle on white background - 410 Stainless Steel Elk Spoon / Silver
Golden stainless steel spoon with reindeer antler handle design for Christmas coffee - 410 Stainless Steel Elk Spoon / Gold
Golden reindeer stainless steel spoon and fork set in a festive blue gift box - 410 Stainless Steel Elk Spoon Fork 2PCS Set (Blue Box) / Gold
Golden 6-piece Christmas elk cutlery set with 410 stainless steel spoons and forks in green gift box - 410 Stainless Steel Elk Spoon Fork 6PCS Set (Green Box) / Gold
+26
Reindeer Antler Coffee Spoons And Dessert Forks 304 Stainless Steel Christmas Holiday Gift Mirror Polished Cutlery Tableware
-23%
$0.36-4.34
No MOQ
 · 
21 sold recently
Vintage European Embossed Spoon And Fork Stainless Steel Dessert Fruit Coffee Stirring Baroque Style Luxury Cutlery
Vintage European Embossed Spoon And Fork Stainless Steel Dessert Fruit Coffee Stirring Baroque Style Luxury Cutlery
like
Find Similar
Vintage Baroque style silver dessert spoon with embossed floral pattern on the handle - Single Dessert Spoon / Silver
European vintage stainless steel dessert fork with ornate relief carving in silver finish - Single Dessert Fork / Silver
Vintage European style titanium gold dessert spoon with intricate hollow relief handle - Single Dessert Spoon / Gold
Titanium gold dessert fork with vintage European embossed handle and three-pronged design - Single Dessert Fork / Gold
+6
Vintage European Embossed Spoon And Fork Stainless Steel Dessert Fruit Coffee Stirring Baroque Style Luxury Cutlery
-4%
$0.41-2.31
No MOQ
 · 
57 sold recently
304 Stainless Steel Cutlery With Pear Wood Handle Mirror Polished Nordic Style Dinner Knife Fork Spoon Western Dining Home
304 Stainless Steel Cutlery With Pear Wood Handle Mirror Polished Nordic Style Dinner Knife Fork Spoon Western Dining Home
like
Find Similar
304 stainless steel dinner knife with pear wood handle 21.2cm long and 13g lightweight - Dinner Knife
Polished stainless steel dinner fork with brown wood handle, length 20.8cm, weight 20g - Dinner Fork
304 stainless steel dinner spoon with brown handle, length 20.8cm, weighing 24g - Dinner Spoon
Nordic 2-piece set with pearwood handles featuring a stainless steel dinner knife and fork - Knife and Fork 2-Piece Set
+1
304 Stainless Steel Cutlery With Pear Wood Handle Mirror Polished Nordic Style Dinner Knife Fork Spoon Western Dining Home
-5%
$1.70-5.09
No MOQ
 · 
40 sold recently
Free Shipping
Kids Lunch Box Stainless Steel Portable Insulated Thermal Bento Box With Spoon For School Picnic Cute Cartoon Toddler
Kids Lunch Box Stainless Steel Portable Insulated Thermal Bento Box With Spoon For School Picnic Cute Cartoon Toddler
like
Find Similar
750ml Pink baby stainless steel lunch box set including bowl, spoon and scissors - New Insulated Model / 750ml / Pink
Blue 750ml 304 stainless steel baby food container set with scissors and spoon - New Insulated Model / 750ml / Blue
Portable pink stainless steel baby lunch box for food storage, 750ml capacity - New Standard Model / 750ml / Pink
Pea green 304 stainless steel portable children's lunch box, 750ml capacity, leak-proof design - New Standard Model / 750ml / Green
+3
Kids Lunch Box Stainless Steel Portable Insulated Thermal Bento Box With Spoon For School Picnic Cute Cartoon Toddler
$2.56-4.09
No MOQ
 · 
154 views
304 Stainless Steel Wine Chiller Stick With Acrylic Aerator Pourer Fast Cooling Red Wine Decanter Bar Accessory
304 Stainless Steel Wine Chiller Stick With Acrylic Aerator Pourer Fast Cooling Red Wine Decanter Bar Accessory
like
Find Similar
3-in-1 stainless steel wine chiller stick with aerator pourer on a white background - Wine Chiller Stick (OPP Bag)
3-in-1 stainless steel wine cooling stick with transparent pourer and rubber gasket - Wine Chiller Stick with Stopper (OPP Bag)
Stainless steel wine chiller stick set with acrylic pourer in professional retail box - Wine Chiller Stick (Color Box)
Stainless steel wine chiller stick set with acrylic pourer in retail gift packaging - Wine Chiller Stick with Stopper (Color Box)
+1
304 Stainless Steel Wine Chiller Stick With Acrylic Aerator Pourer Fast Cooling Red Wine Decanter Bar Accessory
$2.02-4.32
No MOQ
 · 
89 sold recently
Bear Shaped Water Bottle Plastic Large Capacity With Straw And Adjustable Strap For Kids Students Portable
Bear Shaped Water Bottle Plastic Large Capacity With Straw And Adjustable Strap For Kids Students Portable
like
Find Similar
Cute white bear shaped water bottle for students with straw and portable handle - 1000ml / White
Brown bear shaped water bottle with shoulder strap and straw for children and students - 1000ml / Brown
Pink bear-shaped plastic water bottle with straw and shoulder strap for kids - 1000ml / Pink
Bear Shaped Water Bottle Plastic Large Capacity With Straw And Adjustable Strap For Kids Students Portable
-4%
$2.68
No MOQ
 · 
533 sold recently
Top 10% Best Sellers
in Kitchen & Dining
Shimmer Glitter Vacuum Insulated Tumbler Stainless Steel Travel Coffee Mug With Straw And Three Way Lid Portable Car Cup
Shimmer Glitter Vacuum Insulated Tumbler Stainless Steel Travel Coffee Mug With Straw And Three Way Lid Portable Car Cup
like
Find Similar
Detail of 30oz pink glitter vacuum insulated tumbler with straw and packaging specs - 30oz/890ml / Gradient Pink
Close-up of 30oz light blue glitter vacuum insulated stainless steel tumbler with straw - 30oz/890ml / Gradient Blue
Close-up of 30oz blue glitter stainless steel vacuum tumbler on a display stand - 30oz/890ml / Gradient Green
Close-up of a 30oz purple glitter vacuum insulated tumbler with lid and straw on a display - 30oz/890ml / Gradient Purple
Shimmer Glitter Vacuum Insulated Tumbler Stainless Steel Travel Coffee Mug With Straw And Three Way Lid Portable Car Cup
$6.34
Mix MOQ : 2
 · 
14 sold recently
Manual Pepper Grinder Stainless Steel Salt Mill Portable One Hand Operation Spice Grinding Tool Adjustable Kitchen Gadget
Manual Pepper Grinder Stainless Steel Salt Mill Portable One Hand Operation Spice Grinding Tool Adjustable Kitchen Gadget
like
Find Similar
Portable silver stainless steel manual pepper grinder with clear view window on wood - Steel Color
Manual Pepper Grinder Stainless Steel Salt Mill Portable One Hand Operation Spice Grinding Tool Adjustable Kitchen Gadget
$2.41
No MOQ
 · 
256 sold recently
Square Spice Jar Glass Seasoning Bottle With Acacia Wood Lid Airtight Clear Kitchen Organization Refillable Storage
Square Spice Jar Glass Seasoning Bottle With Acacia Wood Lid Airtight Clear Kitchen Organization Refillable Storage
like
Find Similar
Square glass spice jars set with black, gold, and silver metal lids on white background - 120ml Silver Aluminum Lid Glass Bottle
Square glass spice jar 120ml with an acacia wood lid shown on white background - 120ml Bamboo Lid Glass Bottle
Square 120ml glass spice jar with acacia wood lid filled with red pepper flakes - 120ml Acacia Wood Lid Glass Bottle
+5
Square Spice Jar Glass Seasoning Bottle With Acacia Wood Lid Airtight Clear Kitchen Organization Refillable Storage
-5%
$0.41-11.08
Mix MOQ : 2
 · 
368 sold recently
Sports Water Bottle Frosted Plastic Gradient Color One-Click Flip Top Leak-Proof For Outdoor Fitness Gym Travel
Sports Water Bottle Frosted Plastic Gradient Color One-Click Flip Top Leak-Proof For Outdoor Fitness Gym Travel
like
Find Similar
32oz and 1L black white gradient matte sports water bottles with flip top lids - 600ml / Black and White Gradient
32oz and 1L pink and blue gradient sports water bottles with matte finish and locking lid - 600ml / Pink Blue Gradient
Set of 32oz frosted gradient sports water bottles in blue, purple, and red with lock lids - 600ml / Purple Red Gradient
32oz and 1L gradient sports water bottle set in matte blue and green finish - 600ml / Blue Green Gradient
+11
Sports Water Bottle Frosted Plastic Gradient Color One-Click Flip Top Leak-Proof For Outdoor Fitness Gym Travel
-5%
$1.45-2.43
Mix MOQ : 2
 · 
46 sold recently
Insulated 304 Stainless Steel Tumbler Vacuum Cup With Handle Lid And Straw Floral Print Car Travel Mug Portable
Insulated 304 Stainless Steel Tumbler Vacuum Cup With Handle Lid And Straw Floral Print Car Travel Mug Portable
like
Find Similar
304 stainless steel tumbler with purple handle and pink floral 3D print pattern - 14oz / Purple - Floral Pattern 2
304 Stainless steel floral insulated mug with handle and blue rose pattern - 14oz / Light Blue - Floral Pattern 3
Insulated 304 stainless steel tumbler with pink floral pattern and portable handle - 14oz / Pink - Floral Pattern 1
30oz stainless steel insulated tumbler with pink rose floral pattern and handle - 14oz / White - Floral Pattern 4
Insulated 304 Stainless Steel Tumbler Vacuum Cup With Handle Lid And Straw Floral Print Car Travel Mug Portable
$7.20
Mix MOQ : 2
 · 
99 views
Christmas Stainless Steel Spoon And Fork With Silicone Cartoon Topper Golden Dessert Stirrer Gift Box
Christmas Stainless Steel Spoon And Fork With Silicone Cartoon Topper Golden Dessert Stirrer Gift Box
like
Find Similar
Golden stainless steel coffee spoon with a green Christmas tree topper charm, 150mm - Gold Spoon - Christmas Tree 1
Golden stainless steel Christmas tree coffee spoon with green festive ornament detail - Gold Spoon - Christmas Tree 2
Golden stainless steel coffee spoon with a bright yellow star ornament 150mm length - Gold Spoon - Star
Golden stainless steel coffee spoon with a festive red Christmas hat handle decoration - Gold Spoon - Christmas Hat
+107
Christmas Stainless Steel Spoon And Fork With Silicone Cartoon Topper Golden Dessert Stirrer Gift Box
-5%
$0.36-3.03
Mix MOQ : 2
 · 
28 views
304 Stainless Steel Smart Temperature Display Coffee Mug Vacuum Insulated Portable Travel Thermal Cup Leak Proof Business Gift
304 Stainless Steel Smart Temperature Display Coffee Mug Vacuum Insulated Portable Travel Thermal Cup Leak Proof Business Gift
like
Find Similar
Insulated 304 stainless steel coffee mug featuring a smart LED temperature display lid - 510ml / Gen 2 Digital Display Style / White
Detail view of a navy blue insulated coffee tumbler lid showing digital temperature display - 510ml / Gen 2 Digital Display Style / Blue
Insulated stainless steel coffee cup with smart lid showing real-time temperature - 510ml / Gen 2 Digital Display Style / Green
Detail of matte black vacuum insulated coffee cup with digital temperature display lid - 510ml / Gen 2 Digital Display Style / Black
+62
304 Stainless Steel Smart Temperature Display Coffee Mug Vacuum Insulated Portable Travel Thermal Cup Leak Proof Business Gift
$2.25-3.17
No MOQ
 · 
85 sold recently
Stainless Steel Cutlery Mirror Polished 304 Flatware Thickened Western Dinnerware Knife Fork Spoon Steak Dessert Modern
Stainless Steel Cutlery Mirror Polished 304 Flatware Thickened Western Dinnerware Knife Fork Spoon Steak Dessert Modern
like
Find Similar
Thickened 304 stainless steel steak knife with serrated blade, length 22.8cm, weight 76.5g - 304 Stainless Steel Steak Knife
Polished 304 stainless steel steak knife, length 23.1cm, width 2cm, weight 78.6g - 304 Stainless Steel Dinner Knife
Mirror polished stainless steel round spoon, dimensions 20.5cm long and 4.5cm wide - 304 Stainless Steel Large Pointed Spoon
Polished silver stainless steel spoon 18.6cm length with 42.6g weight for dining - 304 Stainless Steel Medium Pointed Spoon
+40
Stainless Steel Cutlery Mirror Polished 304 Flatware Thickened Western Dinnerware Knife Fork Spoon Steak Dessert Modern
-6%
$0.26-1.23
No MOQ
 · 
10 sold recently
304 Stainless Steel Mixing Bowl With Handle Internal Scale Markings Deep Whisking Basin For Baking Salad Japanese Style
304 Stainless Steel Mixing Bowl With Handle Internal Scale Markings Deep Whisking Basin For Baking Salad Japanese Style
like
Find Similar
Professional 304 stainless steel mixing bowl with ergonomic handle in silver finish - Small Whisking Bowl with Handle
Silver 304 stainless steel mixing bowl with ergonomic side handle for baking - Medium Whisking Bowl with Handle
304 stainless steel mixing bowl with ergonomic handle for kitchen baking and prep - Large Whisking Bowl with Handle
Fine mesh stainless steel strainer with handle and hook for professional baking - Small Mesh Basket with Handle
+2
304 Stainless Steel Mixing Bowl With Handle Internal Scale Markings Deep Whisking Basin For Baking Salad Japanese Style
-5%
$2.46-4.65
No MOQ
 · 
28 views
Gradient Sports Water Bottle Motivational Time Marker Leakproof Frosted Plastic Jug Portable Strap Fitness Gym Travel
Gradient Sports Water Bottle Motivational Time Marker Leakproof Frosted Plastic Jug Portable Strap Fitness Gym Travel
like
Find Similar
Close-up of 1000ml gradient sports water bottle with pink strap and time scale reminders - 1000ml / Pink Gradient
Detail of 1000ml frosted gradient water bottle with time markers and portable strap - 1000ml / Black Gradient
Close-up of 1000ml gradient water bottle with time markers and portable fabric strap - 1000ml / Green Gradient
Detail of 1000ml purple gradient water bottle with time markers and carry strap - 1000ml / Purple Gradient
Gradient Sports Water Bottle Motivational Time Marker Leakproof Frosted Plastic Jug Portable Strap Fitness Gym Travel
-4%
$2.44
Mix MOQ : 2
 · 
264 sold recently
Stainless Steel Russian Piping Tips For Cake Decoration Flower Pattern One-Piece Molding Professional Baking Tools Kitchen
Stainless Steel Russian Piping Tips For Cake Decoration Flower Pattern One-Piece Molding Professional Baking Tools Kitchen
like
Find Similar
32 options
Stainless Steel Russian Piping Tips For Cake Decoration Flower Pattern One-Piece Molding Professional Baking Tools Kitchen
-4%
$0.24
No MOQ
 · 
16 sold recently
Motivational Sports Water Bottle Gradient Frosted Plastic Leakproof One Click Open Carry Strap Straw Time Marker Outdoor
Motivational Sports Water Bottle Gradient Frosted Plastic Leakproof One Click Open Carry Strap Straw Time Marker Outdoor
like
Find Similar
32oz gradient sports water bottle with straw and time marker in yellow blue purple - 1000ml / Yellow Blue Purple
32oz green and pink gradient sports water bottle with time markers and carry strap - 1000ml / Green Red
32oz large capacity gradient frosted water bottle with time markers and strap - 1000ml / Black and White
32oz orange and blue gradient sports bottle with time markers and carry strap - 1000ml / Orange Blue
+11
Motivational Sports Water Bottle Gradient Frosted Plastic Leakproof One Click Open Carry Strap Straw Time Marker Outdoor
-4%
$2.49
No MOQ
 · 
91 sold recently
Stainless Steel Cheese Knife Fork Set Multicolor Gold Silver Butter Spatula Cheese Tools For Party Wedding Home Kitchen
Stainless Steel Cheese Knife Fork Set Multicolor Gold Silver Butter Spatula Cheese Tools For Party Wedding Home Kitchen
like
Find Similar
4-piece rainbow gradient stainless steel cheese knife and fork set with ergonomic handles - Four-Piece Set / Magic Red
4-piece stainless steel cheese knife set with distinctive metallic purple finish - Four-Piece Set / Purple
Polished stainless steel 4-piece cheese knife set with ergonomic rounded handles - Four-Piece Set / Natural
Set of four matte black stainless steel cheese knives with ergonomic handles - Four-Piece Set / Black
+4
Stainless Steel Cheese Knife Fork Set Multicolor Gold Silver Butter Spatula Cheese Tools For Party Wedding Home Kitchen
$6.19-8.01
Mix MOQ : 2
 · 
13 views
Telescopic Sink Drain Rack Stainless Steel And PP Expandable Dish Drying Basket For Kitchen Fruits Vegetables Storage
Telescopic Sink Drain Rack Stainless Steel And PP Expandable Dish Drying Basket For Kitchen Fruits Vegetables Storage
like
Find Similar
Expandable gray stainless steel sink drainer rack with durable plastic handles - Small
Expandable stainless steel sink drying rack in gray for kitchen organization and drainage - Large
Telescopic Sink Drain Rack Stainless Steel And PP Expandable Dish Drying Basket For Kitchen Fruits Vegetables Storage
$1.50-2.06
No MOQ
 · 
35 views
Insulated Tumbler Stainless Steel Egg Shaped Double Wall Vacuum Wine Cup Portable Travel Drinkware With Lid
Insulated Tumbler Stainless Steel Egg Shaped Double Wall Vacuum Wine Cup Portable Travel Drinkware With Lid
like
Find Similar
Double-walled 12oz stainless steel wine tumbler in matte black with a transparent lid - Cool Black (Silver Rim)
Insulated 12oz stainless steel egg shaped cup in charcoal grey with clear lid - Charcoal Grey (Silver Rim)
Lemon Yellow 12oz 360ml insulated egg-shaped wine tumbler with transparent lid - Lemon Yellow (Silver Rim)
Insulated milk tea color 12oz stainless steel egg cup with clear lid and matte finish - Milk Tea Color (Silver Rim)
+24
Insulated Tumbler Stainless Steel Egg Shaped Double Wall Vacuum Wine Cup Portable Travel Drinkware With Lid
$3.31-3.75
Mix MOQ : 2
 · 
30 sold recently
Silicone Wine Bottle Stopper Molds DIY Crystal Epoxy Resin Casting Molds For Home Bar Bottle Decoration Crafting Animals Shapes
Silicone Wine Bottle Stopper Molds DIY Crystal Epoxy Resin Casting Molds For Home Bar Bottle Decoration Crafting Animals Shapes
like
Find Similar
Silicone crown wine bottle stopper mold with detailed 80mm height and weight dimensions - Crown Wine Stopper Mold
Cat paw wine bottle stopper silicone mold with dimensions 85mm height and 17g weight - Cat Claw Wine Stopper Mold
Cat shaped silicone resin mold for wine stoppers with detailed size and weight specs - Cat Wine Stopper Mold
Dog shaped silicone resin mold for wine bottle stoppers with dimension markers - Dog Wine Stopper Mold
+4
Silicone Wine Bottle Stopper Molds DIY Crystal Epoxy Resin Casting Molds For Home Bar Bottle Decoration Crafting Animals Shapes
$0.86-2.31
Mix MOQ : 2
 · 
43 sold recently
Free Shipping
Manual Handheld Cheese Grater And Lemon Zester Stainless Steel Blade With Protective Cover Anti Slip Handle For Kitchen
Manual Handheld Cheese Grater And Lemon Zester Stainless Steel Blade With Protective Cover Anti Slip Handle For Kitchen
like
Find Similar
Multifunction 18/8 stainless steel cheese grater with red handle and cleaning brush - Color Box / Red
Green stainless steel cheese grater set with protective cover and cleaning brush - Color Box / Green
Yellow handled 18/8 stainless steel cheese grater with protective cover and brush - Color Box / Yellow
Multifunction 18/8 stainless steel cheese grater set with black handle and protective cover - Color Box / Black
+4
Manual Handheld Cheese Grater And Lemon Zester Stainless Steel Blade With Protective Cover Anti Slip Handle For Kitchen
-4%
$1.62-1.92
Mix MOQ : 2
 · 
21 views
Round Dessert Spoon 304 Stainless Steel Short Handle Ice Cream Coffee Spoon Mirror Polished Colorful Tea Mini Spoon
Round Dessert Spoon 304 Stainless Steel Short Handle Ice Cream Coffee Spoon Mirror Polished Colorful Tea Mini Spoon
like
Find Similar
Polished silver stainless steel short handle dessert spoon, 9.5cm mini ice cream scoop - Silver
Golden short handle 304 stainless steel dessert spoon with 9.5cm length measurements - Gold
Rose gold 304 stainless steel short handle round dessert spoon 9.5cm length 21g - Rose Gold
Rainbow finish 304 stainless steel short handle spoon with 9.5cm length measurements - AB Color
+1
Round Dessert Spoon 304 Stainless Steel Short Handle Ice Cream Coffee Spoon Mirror Polished Colorful Tea Mini Spoon
-5%
$0.41-0.71
No MOQ
 · 
44 views
Star Shaped Tea Infuser 304 Stainless Steel Smiley Face Fine Mesh Tea Strainer With Hook And Chain For Loose Leaf Tea
Star Shaped Tea Infuser 304 Stainless Steel Smiley Face Fine Mesh Tea Strainer With Hook And Chain For Loose Leaf Tea
like
Find Similar
Star shaped golden stainless steel tea infuser with mesh holes and a smiley face design - Titanium Gold
Star-shaped stainless steel tea infuser in silver finish with metal hanging chain - Original Color
Star-shaped golden stainless steel tea infuser with chain and hook for loose leaf tea - Light Gold
Star-shaped stainless steel tea infuser with fine mesh in elegant rose gold finish - Rose Gold
Star Shaped Tea Infuser 304 Stainless Steel Smiley Face Fine Mesh Tea Strainer With Hook And Chain For Loose Leaf Tea
$0.72-1.35
Mix MOQ : 10
 · 
110 sold recently
Free Shipping
Stainless Steel Flower Coffee Spoons Rose Cherry Blossom Shape Long Handle Mirror Polished Dessert Tea Stirring Scoop
Stainless Steel Flower Coffee Spoons Rose Cherry Blossom Shape Long Handle Mirror Polished Dessert Tea Stirring Scoop
like
Find Similar
Golden stainless steel spoon with rose flower shaped head and dimensions weight details - Long Rose Ice Spoon / Gold
Golden cherry blossom stainless steel spoon with fine floral texture, 12.7cm length - Cherry Blossom Coffee Spoon / Gold
Creative golden stainless steel rose flower coffee spoon for wedding party favors - Rose Coffee Spoon / Gold
Golden cherry blossom stainless steel spoon with long handle and petal-shaped head - Long Cherry Blossom Ice Spoon / Gold
+36
Stainless Steel Flower Coffee Spoons Rose Cherry Blossom Shape Long Handle Mirror Polished Dessert Tea Stirring Scoop
-9%
$0.16-0.30
Mix MOQ : 2
 · 
99 sold recently
Skinny Tumbler Reusable Water Bottle With Straw Double Wall Plastic Matte Rubber Paint Finish Sealing Lid Minimalist
Skinny Tumbler Reusable Water Bottle With Straw Double Wall Plastic Matte Rubber Paint Finish Sealing Lid Minimalist
like
Find Similar
Slim 16oz double-layer plastic tumbler in lavender matte finish with matching straw - Pink
Pink matte skinny 16oz tumbler with matching straw and lid on white background - Hot Pink
Matte lavender 16oz skinny double-walled plastic tumbler with matching lid and straw - Lavender
Matte dusty pink 16oz double-walled skinny plastic tumbler with matching straw and lid - Orange Yellow
+33
Skinny Tumbler Reusable Water Bottle With Straw Double Wall Plastic Matte Rubber Paint Finish Sealing Lid Minimalist
$4.03
Mix MOQ : 2
 · 
104 sold recently
Soap Dispensing Kitchen Brush ABS PC Stainless Steel Silicone Press Liquid Scrubber With Storage Base For Dish Pot Pan
Soap Dispensing Kitchen Brush ABS PC Stainless Steel Silicone Press Liquid Scrubber With Storage Base For Dish Pot Pan
like
Find Similar
Kitchen dish brush in white and green with built-in soap dispenser and drainage base - Green Hard Box
Gray and transparent dish brush with soap dispenser and drip base for kitchen - Gray Hard Box
Gray soap dispensing kitchen brush with transparent reservoir and matching stand - Gray Soft Box + 1 Brush Head
+7
Soap Dispensing Kitchen Brush ABS PC Stainless Steel Silicone Press Liquid Scrubber With Storage Base For Dish Pot Pan
$0.55-2.82
No MOQ
 · 
10 sold recently
Piping Nozzle Tips 304 Stainless Steel Cake Decorating Cream Squeezing Cookie Baking Tool Cupcake Decorator
Piping Nozzle Tips 304 Stainless Steel Cake Decorating Cream Squeezing Cookie Baking Tool Cupcake Decorator
like
Find Similar
Detailed size specifications for a set of 4 large stainless steel piping nozzles for baking - 4Pcs Set Round Square 18-Teeth Piping Nozzles
Piping Nozzle Tips 304 Stainless Steel Cake Decorating Cream Squeezing Cookie Baking Tool Cupcake Decorator
$1.70
Mix MOQ : 2
 · 
21 sold recently
Portuguese Style Cutlery Dinnerware 304 Stainless Steel Knife Fork Spoon Mirror Polished With Matte Handle Multi Color
Portuguese Style Cutlery Dinnerware 304 Stainless Steel Knife Fork Spoon Mirror Polished With Matte Handle Multi Color
like
Find Similar
Modern black and gold stainless steel dinner spoon with matte finish long handle - Black Gold Dinner Spoon (Large)
Modern red and gold dinner knife made of 304 stainless steel with 21cm length - Red Gold Dinner Knife
Large black and gold stainless steel dinner fork measuring 22.3 cm in modern minimalist style - Black Gold Dinner Fork (Large)
Gold and blue 304 stainless steel small spoon with 13cm length dimensions - Blue Gold Tea Spoon (Small)
+28
Portuguese Style Cutlery Dinnerware 304 Stainless Steel Knife Fork Spoon Mirror Polished With Matte Handle Multi Color
-5%
$1.01-1.65
No MOQ
 · 
76 sold recently
Semi Automatic Handheld Flour Sifter Cup Sieve Stainless Steel Fine Mesh With Scale Baking Powder Sugar Sifting Tool
Semi Automatic Handheld Flour Sifter Cup Sieve Stainless Steel Fine Mesh With Scale Baking Powder Sugar Sifting Tool
like
Find Similar
Dual-layer semi-automatic flour sifter in grey, 250ml capacity baking tool - Semi-automatic Flour Sifter (Double Layer) - Box Packed / Transparent Gray
Translucent grey semi-automatic flour sifter with measurement markings on wooden board - Semi-automatic Flour Sifter (Single Layer) - PP Bag / Transparent Gray
Pink semi-automatic stainless steel flour sifter with black interior and foldable handle - Stainless Steel Single Layer Flour Sifter - Pink - PP Bag / Pink
Blue semi-automatic stainless steel flour sifter with squeeze handle and measurements - Stainless Steel Single Layer Flour Sifter - Blue - PP Bag / Blue
+5
Semi Automatic Handheld Flour Sifter Cup Sieve Stainless Steel Fine Mesh With Scale Baking Powder Sugar Sifting Tool
-5%
$1.26-2.41
No MOQ
 · 
48 views
Strawberry Huller Stainless Steel Fruit Stem Remover Tomato Corer Creative Kitchen Gadget For Berry And Tomato
Strawberry Huller Stainless Steel Fruit Stem Remover Tomato Corer Creative Kitchen Gadget For Berry And Tomato
like
Find Similar
Stem Gem strawberry huller in red and green finish with stainless steel claw tool - Single Piece / Red
Strawberry Huller Stainless Steel Fruit Stem Remover Tomato Corer Creative Kitchen Gadget For Berry And Tomato
$0.60
Mix MOQ : 2
 · 
153 sold recently
Modern Stainless Steel Kitchen Fruit Vegetable Peeler With Ergonomic Plastic Handle Multi Functional Potato Carrot Scraper Tool
Modern Stainless Steel Kitchen Fruit Vegetable Peeler With Ergonomic Plastic Handle Multi Functional Potato Carrot Scraper Tool
like
Find Similar
Set of four stainless steel peelers in white, green, and pink with plastic handles - Hollow Style / Army Green
Ergonomic light green stainless steel vegetable peeler with a non-slip handle for kitchen - Solid Style / Light Blue
Green stainless steel vegetable peeler with ergonomic handle on a white background - Solid Style / Army Green
Ergonomic stainless steel fruit peeler with a beige matte nonslip handle - Solid Style / Off White
+4
Modern Stainless Steel Kitchen Fruit Vegetable Peeler With Ergonomic Plastic Handle Multi Functional Potato Carrot Scraper Tool
$0.09
No MOQ
 · 
164 sold recently
Stainless Steel Cutlery Mirror Polished Modern Minimalist Dinner Knife Fork Spoon Home Western Dining Silver
Stainless Steel Cutlery Mirror Polished Modern Minimalist Dinner Knife Fork Spoon Home Western Dining Silver
like
Find Similar
Sleek mirror-polished 304 stainless steel dinner knife with a 22.7cm minimalist handle - Dinner Knife
Polished silver 304 stainless steel dinner fork with slim handle 21.5cm length - Dinner Fork
Mirror polished 304 stainless steel dinner spoon 20.9cm length for daily dining - Dinner Spoon
20cm silver 304 stainless steel dessert knife with serrated blade and slim handle - Dessert Knife
+10
Stainless Steel Cutlery Mirror Polished Modern Minimalist Dinner Knife Fork Spoon Home Western Dining Silver
-4%
$0.69-7.41
No MOQ
 · 
35 views
Free Shipping
304 Stainless Steel Coffee Measuring Spoon With Sealing Bag Clip Two In One Multifunctional Scoop For Coffee Beans Tea
304 Stainless Steel Coffee Measuring Spoon With Sealing Bag Clip Two In One Multifunctional Scoop For Coffee Beans Tea
like
Find Similar
Polished stainless steel 2-in-1 coffee measuring spoon with integrated bag sealing clip - 430 / Silver
Golden 304 stainless steel coffee measuring spoon with integrated sealing bag clip - 430 / Gold
304 Stainless Steel Coffee Measuring Spoon With Sealing Bag Clip Two In One Multifunctional Scoop For Coffee Beans Tea
-5%
$0.51-0.67
No MOQ
 · 
206 sold recently
Fried Egg Mold Rings Stainless Steel Poached Egg Maker With Green Handle Heart Star Round Flower Bear Shapes Kitchen Tool
Fried Egg Mold Rings Stainless Steel Poached Egg Maker With Green Handle Heart Star Round Flower Bear Shapes Kitchen Tool
like
Find Similar
Bear-shaped stainless steel egg ring mold with a green handle for creative breakfast - Bear Style
Heart-shaped stainless steel egg mold with a green handle for creative cooking - Heart Shape
Circular stainless steel egg mold with green handle knob and foldable metal grip - Round
Cloud shaped stainless steel fried egg mold with a green handle for creative cooking - Flower
+1
Fried Egg Mold Rings Stainless Steel Poached Egg Maker With Green Handle Heart Star Round Flower Bear Shapes Kitchen Tool
-90%
$0.01
Mix MOQ : 4
 · 
14 sold recently
Double Walled Plastic Straw Cup Matte Finish Large Capacity Tumbler With Lid And Straw Leakproof Modern Simple Water Bottle
Double Walled Plastic Straw Cup Matte Finish Large Capacity Tumbler With Lid And Straw Leakproof Modern Simple Water Bottle
like
Find Similar
Matte light blue 24oz double-layer plastic tumbler with matching lid and straw - Light Blue
24oz double-layer matte plastic tumbler with lid and straw in deep purple finish - Fuschia
Matte pink 24oz double-layer plastic tumbler with matching lid and reusable straw - Hot Pink
Pink matte double-layer plastic tumbler with straw and lid in a sleek minimalist design - Smoky Pink
+35
Double Walled Plastic Straw Cup Matte Finish Large Capacity Tumbler With Lid And Straw Leakproof Modern Simple Water Bottle
$4.47
Mix MOQ : 2
 · 
91 sold recently
Oval Serving Tray Stainless Steel Organizer For Jewelry Cosmetics Nordic Minimalist Home Desktop Storage Metal Plate
Oval Serving Tray Stainless Steel Organizer For Jewelry Cosmetics Nordic Minimalist Home Desktop Storage Metal Plate
like
Find Similar
Medium size oval metal storage tray in bright golden finish with mirror polish - Large / Gold
Medium oval stainless steel metal tray with brushed texture and minimalist silver finish - Small / Silver
+4
Oval Serving Tray Stainless Steel Organizer For Jewelry Cosmetics Nordic Minimalist Home Desktop Storage Metal Plate
$0.63-1.47
Mix MOQ : 10
 · 
305 sold recently
304 Stainless Steel Funnel Wine Oil Dipper Long Handle With Filter Mesh Food Grade Kitchen Tool
304 Stainless Steel Funnel Wine Oil Dipper Long Handle With Filter Mesh Food Grade Kitchen Tool
like
Find Similar
Polished 304 stainless steel mini kitchen funnel with handle 5.6cm diameter size - 5.5cm Mini Funnel (No Filter/Mirror Polished)
Small 304 stainless steel funnel with brushed finish and ergonomic handle design - 11cm Funnel + Strainer (Brushed Finish)
Brushed 304 stainless steel medium funnel with side handle and hanging loop for liquids - 13cm Funnel + Strainer (Brushed Finish)
SUS304 stainless steel measuring scoop with 50ml capacity and long handle - Wine Dipper 50ml (Small Size)
+4
304 Stainless Steel Funnel Wine Oil Dipper Long Handle With Filter Mesh Food Grade Kitchen Tool
-5%
$0.88-3.61
Mix MOQ : 5
 · 
10 sold recently
Dough Scraper Bench Scraper Stainless Steel Pastry Cutter With Wood Handle Measuring Scale Multipurpose Baking Tool
Dough Scraper Bench Scraper Stainless Steel Pastry Cutter With Wood Handle Measuring Scale Multipurpose Baking Tool
like
Find Similar
Stainless steel dough scraper with wooden handle and rivet fixation on white background - Mixed Wood Handle Dough Scraper
Stainless steel dough scraper with wooden handle and laser-engraved measurement scale - Beech Wood Handle Dough Scraper
Stainless steel pastry scraper with a light wooden handle and a wavy-edged metal blade - Wood Handle Potato Crinkle Cutter
Stainless steel dough scraper with measurement scales and rolled handle on white base - Stainless Steel Rolled Handle Dough Scraper
+1
Dough Scraper Bench Scraper Stainless Steel Pastry Cutter With Wood Handle Measuring Scale Multipurpose Baking Tool
-6%
$0.41-1.32
No MOQ
 · 
80 views
Cute Cat Paw Shaped Silicone Food Tongs Stainless Steel Kitchen Cooking Tongs For BBQ Salad Bread Non-Slip Heat Resistant
Cute Cat Paw Shaped Silicone Food Tongs Stainless Steel Kitchen Cooking Tongs For BBQ Salad Bread Non-Slip Heat Resistant
like
Find Similar
White cat paw food tongs in small size with stainless steel handle and silicone tip - Small / White
Medium 180mm cat paw food tongs in black with stainless steel handle and silicone tip - Medium / Black
Pink cat paw food tongs in small size made of stainless steel and silicone - Small / Pink
Black cat paw silicone food tong in large size, 246mm length, stainless steel handle - Large / Black
+20
Cute Cat Paw Shaped Silicone Food Tongs Stainless Steel Kitchen Cooking Tongs For BBQ Salad Bread Non-Slip Heat Resistant
$1.96-4.61
No MOQ
 · 
10 sold recently
Free Shipping
Stainless Steel Meatball Maker Clip Plastic DIY Fish Ball Mold Kitchen Food Tongs Cooking Tool
Stainless Steel Meatball Maker Clip Plastic DIY Fish Ball Mold Kitchen Food Tongs Cooking Tool
like
Find Similar
White plastic spherical meatball maker tool shown on beige geometric prop background - Plastic / Plastic Small
Single off-white plastic meatball and snowball maker tool with long handle for DIY - Plastic / Plastic Large
Small 3.5cm diameter 304 stainless steel meatball maker tool with hollow ball design - Stainless Steel / Small (3.5cm)
Large stainless steel meatball maker tool with 4.8cm diameter scoop and scissor handle - Stainless Steel / Large (4.8cm)
+1
Stainless Steel Meatball Maker Clip Plastic DIY Fish Ball Mold Kitchen Food Tongs Cooking Tool
-6%
$0.26-0.69
Mix MOQ : 2
 · 
91 sold recently
Wing Corkscrew Wine Bottle Opener Zinc Alloy Manual Lever Heavy Duty Labor Saving Wine Accessory For Kitchen Bar
Wing Corkscrew Wine Bottle Opener Zinc Alloy Manual Lever Heavy Duty Labor Saving Wine Accessory For Kitchen Bar
like
Find Similar
Silver winged wine opener on a wooden surface with a red wine bottle and dark berries - Fashion Economic Style (Silver Bubble Bag Packaging)
Detailed size chart for red winged corkscrew with dimensions in centimeters and inches - Red Hot Sale
Manual zinc alloy butterfly wine opener with dimensions 16.5x5.2cm in retail packaging - Black Hot Sale
Silver wing corkscrew wine opener in protective clear blister packaging for home use - Fashion Economic Style (Silver Card Packaging)
+4
Wing Corkscrew Wine Bottle Opener Zinc Alloy Manual Lever Heavy Duty Labor Saving Wine Accessory For Kitchen Bar
$1.03-3.31
No MOQ
 · 
286 sold recently
Go to

More in home & kitchen

Explore more in steel bottles

steeldoubledisplaymagnetickidsstrapdiywidetitaniumgirls
304 stainless steel316 stainless steelnaturalstylebarplasticmetalpolishedshapenecklace stainless steel

Ready to source like an insider

Get a direct line to the factory floor — no minimums, no middlemen, no guesswork.
iconReal factory pricing, no markup in betweeniconEvery order hand-inspected before it shipsicon5,000+ new products added daily
Get Inside Access