Everful

Wholesale steel bottles

Factory-direct selection, vetted for quality and ready to order.

Sign Up
Steel Bottles

Find the perfect pieces: vacuum flasks & thermoses, tumblers, mugs and more

filterShow Filters
Best Seller
New Arrivals
Price Drop
Free Shipping
Summer Beverage Bottle 3D Embossed Nail Stickers Cute Cartoon Cola Soda Fruit Juice DIY Nail Art Decoration YT5988
Summer Beverage Bottle 3D Embossed Nail Stickers Cute Cartoon Cola Soda Fruit Juice DIY Nail Art Decoration YT5988
like
Find Similar
Cute cartoon summer soda and juice bottle embossed nail stickers with watermelon icons - Embossed Style (YT5988)
Summer Beverage Bottle 3D Embossed Nail Stickers Cute Cartoon Cola Soda Fruit Juice DIY Nail Art Decoration YT5988
$0.72
No MOQ
Free Shipping
Waterproof Pink Preppy Aesthetic Stickers PVC Decorative Decals For Laptop Water Bottle Phone Case Scrapbooking Stickers
Waterproof Pink Preppy Aesthetic Stickers PVC Decorative Decals For Laptop Water Bottle Phone Case Scrapbooking Stickers
like
Find Similar
Set of 50 pink cartoon stickers with hearts, rainbows and crowns for notebooks and bottles - Pink Series (DD163)
Waterproof Pink Preppy Aesthetic Stickers PVC Decorative Decals For Laptop Water Bottle Phone Case Scrapbooking Stickers
$0.96
No MOQ
Golden Retriever Cartoon Dog Stickers For Water Bottles Laptop Luggage Waterproof Vinyl Animal Decals For Kids Adults Pet Lovers Gift
Golden Retriever Cartoon Dog Stickers For Water Bottles Laptop Luggage Waterproof Vinyl Animal Decals For Kids Adults Pet Lovers Gift
like
Find Similar
50pcs cute golden retriever cartoon stickers showing precise size and vibrant colors - Cute Golden Retriever Pattern (T01042393)
Golden Retriever Cartoon Dog Stickers For Water Bottles Laptop Luggage Waterproof Vinyl Animal Decals For Kids Adults Pet Lovers Gift
$0.86
Mix MOQ : 2
Creative Surrealist Illustration Stickers Waterproof PVC Decals For Laptop Suitcase Water Bottle Helmet Decoration
Creative Surrealist Illustration Stickers Waterproof PVC Decals For Laptop Suitcase Water Bottle Helmet Decoration
like
Find Similar
Pack of 50 creative waterproof stickers with surreal food and lifestyle art illustrations - 50 Sheets Creative Illustration Pack (OPQ105)
Creative Surrealist Illustration Stickers Waterproof PVC Decals For Laptop Suitcase Water Bottle Helmet Decoration
$0.96
No MOQ
Cute Cartoon Enamel Pin Alloy Brooch Goldfish Bowl Star Bottle Lemon Wine Bottle Badge Jewelry Gift For Women Men Decoration
Cute Cartoon Enamel Pin Alloy Brooch Goldfish Bowl Star Bottle Lemon Wine Bottle Badge Jewelry Gift For Women Men Decoration
like
Find Similar
Blue enamel jar pin with gold stars and white lid, measuring 1.18 by 0.63 inches - Starry Bottle (A00734)
Cute lemon jar enamel pin featuring a yellow ghost inside, size 2.6cm by 1.7cm - Lemon Jar (A00735)
Cartoon enamel brooch featuring a fish tank with two clownfish and a small bed - Goldfish Bowl (A00736)
Cartoon wine bottle enamel pin in black and brown with precise product size and weight specs - Wine Bottle (A00737)
Cute Cartoon Enamel Pin Alloy Brooch Goldfish Bowl Star Bottle Lemon Wine Bottle Badge Jewelry Gift For Women Men Decoration
-9%
$0.34-0.42
Mix MOQ : 2
 · 
10 views
Christmas Gnome Wine Bottle Covers Knitted Reindeer Snowflake Rudolph Topper For Holiday Xmas Dinner Table Party Decorations
Christmas Gnome Wine Bottle Covers Knitted Reindeer Snowflake Rudolph Topper For Holiday Xmas Dinner Table Party Decorations
like
Find Similar
Rudolph faceless doll wine bottle cover with red knit hat and white faux beard - Belt Design
Christmas gnome wine bottle cover with red knitted snowflake hat and long white beard - Snowflake Design
Rudolph Christmas wine bottle cover with brown reindeer antlers and white faux fur beard - Reindeer Style
Christmas Gnome Wine Bottle Covers Knitted Reindeer Snowflake Rudolph Topper For Holiday Xmas Dinner Table Party Decorations
$1.15
No MOQ
Mini Christmas Hats Fabric Cutlery Holder Wine Bottle Topper Table Decorations Party Supplies Red White
Mini Christmas Hats Fabric Cutlery Holder Wine Bottle Topper Table Decorations Party Supplies Red White
like
Find Similar
Mini red Christmas hat for cutlery holder or bottle topper, 12x6cm brushed fabric decor - Medium (12x6cm) / Red
Mini red Christmas hat utensil holder, 18cm height by 8cm width festive cutlery cover - Large (18x8cm) / Red
Mini red felt Christmas hat 8x4cm for cutlery holder or wine bottle decoration - Small (8x4cm) / Red
Mini Christmas Hats Fabric Cutlery Holder Wine Bottle Topper Table Decorations Party Supplies Red White
$0.09-0.13
Mix MOQ : 2
 · 
204 sold recently
Cartoon Christmas Candy Jars With Santa Claus Snowman Reindeer Plush Heads Clear Plastic Storage Bottles Holiday Desk Decor
Cartoon Christmas Candy Jars With Santa Claus Snowman Reindeer Plush Heads Clear Plastic Storage Bottles Holiday Desk Decor
like
Find Similar
Christmas Santa Claus candy jar with red knit hat and transparent storage container - Santa Claus Style / Small
Christmas snowman candy jar with clear spherical bottle and striped knit scarf decor - Snowman Style / Small
Christmas reindeer transparent candy jar with plush brown antlers and a knit scarf - Reindeer Style / Small
Cartoon Christmas Candy Jars With Santa Claus Snowman Reindeer Plush Heads Clear Plastic Storage Bottles Holiday Desk Decor
$1.50
Mix MOQ : 2
Christmas Knitted Wine Bottle Covers Santa Claus Snowman Elk Design Festive Table Decor For Xmas Party Dining Atmosphere
Christmas Knitted Wine Bottle Covers Santa Claus Snowman Elk Design Festive Table Decor For Xmas Party Dining Atmosphere
like
Find Similar
Knitted Santa Claus wine bottle cover with red festive hat and white beard decoration - Santa Claus / 28cmx12cm
Festive knitted Christmas wine bottle cover featuring a cute white snowman design - Snowman / 28cmx12cm
Close-up of a brown knitted reindeer wine bottle cover with detailed 3D antlers and nose - Elk Style / 28cmx12cm
NewChristmas Knitted Wine Bottle Covers Santa Claus Snowman Elk Design Festive Table Decor For Xmas Party Dining Atmosphere
$1.87
No MOQ
Christmas Wine Bottle Cover Santa Claus Snowman Elf Plush Knitted Fabric Wine Bottle Hugger For Festive Dinner Table Decor
Christmas Wine Bottle Cover Santa Claus Snowman Elf Plush Knitted Fabric Wine Bottle Hugger For Festive Dinner Table Decor
like
Find Similar
Plush Santa Claus wine bottle cover decoration for festive Christmas home dining table decor - Santa Claus
Christmas snowman wine bottle cover with red knit hat and scarf for holiday table decor - Snowman
Christmas elf wine bottle hugger in green and red festive attire for table decor - Elf
Christmas Wine Bottle Cover Santa Claus Snowman Elf Plush Knitted Fabric Wine Bottle Hugger For Festive Dinner Table Decor
$1.96
Mix MOQ : 2
Mushroom In Glass Bottle PET Stickers Waterproof Transparent Decorative Decals For Scrapbooking Journal Laptop Phone Case DIY Art Craft
Mushroom In Glass Bottle PET Stickers Waterproof Transparent Decorative Decals For Scrapbooking Journal Laptop Phone Case DIY Art Craft
like
Find Similar
Pack of 50 vintage transparent mushroom bottle stickers for DIY journals and scrapbooking - Mushroom Bottle PET Sticker Bag / Colorful
Mushroom In Glass Bottle PET Stickers Waterproof Transparent Decorative Decals For Scrapbooking Journal Laptop Phone Case DIY Art Craft
$0.93
No MOQ
Knitted Christmas Wine Bottle Cover Thickened Faux Fur Collar Snowman Reindeer Pattern Xmas Dining Table Decor Gifts
Knitted Christmas Wine Bottle Cover Thickened Faux Fur Collar Snowman Reindeer Pattern Xmas Dining Table Decor Gifts
like
Find Similar
Green knitted Christmas wine bottle cover with snowman pattern and white pom-poms - Green
Knitted Christmas wine bottle cover with reindeer and snowflake pattern, 24x12 cm - Red
Grey and white knitted Christmas wine bottle cover with reindeer motif and white pom-poms - Gray
Knitted Christmas Wine Bottle Cover Thickened Faux Fur Collar Snowman Reindeer Pattern Xmas Dining Table Decor Gifts
-5%
$1.48
No MOQ
Christmas Wine Bottle Cover Knit Cloth Santa Claus Snowman Reindeer Decoration For Dining Table Party Decor Xmas Gift
Christmas Wine Bottle Cover Knit Cloth Santa Claus Snowman Reindeer Decoration For Dining Table Party Decor Xmas Gift
like
Find Similar
Knitted Santa Claus wine bottle cover for Christmas table decor and festive gift packaging - Santa Claus Wine Bottle Cover Style
Knitted Christmas snowman wine bottle cover with red scarf and green holly berries decor - Snowman Wine Bottle Cover Style
Knitted reindeer Christmas wine bottle cover featuring plush details and 3D antlers - Reindeer Wine Bottle Cover Style
Christmas Wine Bottle Cover Knit Cloth Santa Claus Snowman Reindeer Decoration For Dining Table Party Decor Xmas Gift
$1.30
Mix MOQ : 3
Christmas Wine Bottle Cover Knitted Reindeer Snowman Snowflake Pattern Wine Bag With Faux Fur Collar Holiday Table Decoration
Christmas Wine Bottle Cover Knitted Reindeer Snowman Snowflake Pattern Wine Bag With Faux Fur Collar Holiday Table Decoration
like
Find Similar
Christmas knitted wine bottle cover with white fur collar and snowflake pattern decor - Faux Fur Collar Knit Bottle Sleeve / Red
Green knitted Christmas wine bottle cover with snowman pattern and white faux fur collar - Faux Fur Collar Knit Bottle Sleeve / Green
Knitted Christmas wine bottle cover with elk and snowflake patterns and fur collar - Faux Fur Collar Knit Bottle Sleeve / Gray
Christmas Wine Bottle Cover Knitted Reindeer Snowman Snowflake Pattern Wine Bag With Faux Fur Collar Holiday Table Decoration
-5%
$1.70
Mix MOQ : 2
Happy Birthday Stickers PVC Waterproof Cartoon Graffiti Decals For Water Bottle Laptop Scrapbook Party Decoration Novelty
Happy Birthday Stickers PVC Waterproof Cartoon Graffiti Decals For Water Bottle Laptop Scrapbook Party Decoration Novelty
like
Find Similar
Set of 50 cartoon Happy Birthday graffiti stickers for laptops and water bottles - 50 Pieces Happy Birthday Stickers
Happy Birthday Stickers PVC Waterproof Cartoon Graffiti Decals For Water Bottle Laptop Scrapbook Party Decoration Novelty
$0.76
Mix MOQ : 2
Cartoon Unicorn Stickers Vinyl Holographic Flash Waterproof DIY Decorative For Scrapbooking Journal Water Bottle Laptop Kids Girls
Cartoon Unicorn Stickers Vinyl Holographic Flash Waterproof DIY Decorative For Scrapbooking Journal Water Bottle Laptop Kids Girls
like
Find Similar
Colorful unicorn stickers set for DIY crafts featuring rainbows and glittery laser effects - Flash Unicorn Style (G065)
Cartoon Unicorn Stickers Vinyl Holographic Flash Waterproof DIY Decorative For Scrapbooking Journal Water Bottle Laptop Kids Girls
$1.38
Mix MOQ : 2
Breast Cancer Awareness Month Water Bottle Labels Paper Stickers Pink Ribbon Charity Party Decorations Women Event Supplies
Breast Cancer Awareness Month Water Bottle Labels Paper Stickers Pink Ribbon Charity Party Decorations Women Event Supplies
like
Find Similar
Breast Cancer Awareness Month stickers featuring pink ribbons and floral watercolor designs - Pink Ribbon Theme Style (W-00069)
Breast Cancer Awareness Month Water Bottle Labels Paper Stickers Pink Ribbon Charity Party Decorations Women Event Supplies
-5%
$1.45
Mix MOQ : 5
Electric Hot Water Bottle Rechargeable Hand Warmer Cute Cartoon Plush Faux Rabbit Fur Cover Winter Portable Heating Pad
Electric Hot Water Bottle Rechargeable Hand Warmer Cute Cartoon Plush Faux Rabbit Fur Cover Winter Portable Heating Pad
like
Find Similar
Close-up of a light blue plush electric hot water bag featuring cute dog embroidery - Blue (Includes Liner)
Electric Hot Water Bottle Rechargeable Hand Warmer Cute Cartoon Plush Faux Rabbit Fur Cover Winter Portable Heating Pad
$6.92
No MOQ
Christmas Ribbon Bows With Gold Bell And Red Berries Red Green Striped Fabric Decorations For Tree Wine Bottle
Christmas Ribbon Bows With Gold Bell And Red Berries Red Green Striped Fabric Decorations For Tree Wine Bottle
like
Find Similar
Christmas striped bow with gold bell and red berries hanging ornament 8cm size - 8cm*8cm / Green Red Green
Christmas Ribbon Bows With Gold Bell And Red Berries Red Green Striped Fabric Decorations For Tree Wine Bottle
$0.11
No MOQ
 · 
500 sold recently
Vintage Christmas Decorative Throw Pillow Case Cotton Linen Mandala Leaves Wine Bottle Pattern Square Cushion Cover For Sofa Home Decor
Vintage Christmas Decorative Throw Pillow Case Cotton Linen Mandala Leaves Wine Bottle Pattern Square Cushion Cover For Sofa Home Decor
like
Find Similar
Bohemian square pillow case with yellow mandala pattern on beige cotton linen fabric - 60x60
Square pillow cover with blue and brown leaf geometric pattern on beige fabric - 60x60 / Curved Leaf Pattern
Vintage Christmas Decorative Throw Pillow Case Cotton Linen Mandala Leaves Wine Bottle Pattern Square Cushion Cover For Sofa Home Decor
-5%
$2.19-3.29
No MOQ
Christmas Gnome Wine Bottle Cover Nordic Forest Faceless Doll Set With Snowflake Hat Red Grey Festive Bottle Decor Xmas Party Dining Table Decoration
Christmas Gnome Wine Bottle Cover Nordic Forest Faceless Doll Set With Snowflake Hat Red Grey Festive Bottle Decor Xmas Party Dining Table Decoration
like
Find Similar
Detail of red Christmas gnome wine bottle cover with white snowflake pattern and beard - Red Forest Gnome Wine Cover
Detail of Christmas gnome wine bottle cover with grey felt hat and snowflake embroidery - Grey Forest Gnome Wine Cover
Close-up of Christmas gnome bottle cover with white snowflake hat and plush beard decor - Red Braided Forest Gnome Wine Cover
Gray Christmas gnome bottle cover with snowflake hat and white beard in festive setting - Grey Braided Forest Gnome Wine Cover
Christmas Gnome Wine Bottle Cover Nordic Forest Faceless Doll Set With Snowflake Hat Red Grey Festive Bottle Decor Xmas Party Dining Table Decoration
-5%
$1.51
Mix MOQ : 2
Christmas Knitted Faceless Gnome Wine Bottle Cover Long Beard Forest Old Man Bottle Sleeve Xmas Party Table Decoration
Christmas Knitted Faceless Gnome Wine Bottle Cover Long Beard Forest Old Man Bottle Sleeve Xmas Party Table Decoration
like
Find Similar
Christmas gnome plush decoration with knitted hat and long beard for holiday home decor - Knitted Gnome With Hands (Style A)
Christmas gnome doll with red grey striped hat and brown faux fur beard for holiday decor - Knitted Gnome With Hands (Style B)
Knitted Christmas gnome decoration with long white beard and festive snowflake pattern hat - Knitted Gnome With Hands (Style C)
Detail of a Christmas gnome decoration with a long knit red hat and white beard - Knitted Gnome With Hands (Style D)
Christmas Knitted Faceless Gnome Wine Bottle Cover Long Beard Forest Old Man Bottle Sleeve Xmas Party Table Decoration
$1.73
Mix MOQ : 2
Christmas Wine Bottle Cover Brushed Cloth Red Bottle Bag With Santa Snowman Elk Bear 3D Doll Decorative Sleeve For Holiday Party Xmas Table Decor
Christmas Wine Bottle Cover Brushed Cloth Red Bottle Bag With Santa Snowman Elk Bear 3D Doll Decorative Sleeve For Holiday Party Xmas Table Decor
like
Find Similar
Christmas wine bottle cover featuring a 3D Santa Claus and gold Merry Christmas ribbon - Santa Style With Letters
Red Christmas wine bottle cover with 3D snowman and Merry Christmas gold embroidery - Snowman Style With Letters
Christmas wine bottle cover with red fleece and white reindeer doll with gold bow - Elk Style With Letters
Christmas wine bottle cover with red fleece and white polar bear decor for holiday tables - Bear Style With Letters
Christmas Wine Bottle Cover Brushed Cloth Red Bottle Bag With Santa Snowman Elk Bear 3D Doll Decorative Sleeve For Holiday Party Xmas Table Decor
-4%
$0.82
No MOQ
Aesthetic Silver Y2K Lucky Girl Waterproof Stickers For Laptop Water Bottle Helmet Scrapbooking Journal Decorative Decals
Aesthetic Silver Y2K Lucky Girl Waterproof Stickers For Laptop Water Bottle Helmet Scrapbooking Journal Decorative Decals
like
Find Similar
Detailed collection of Y2K style silver and pink decorative stickers for journals - Silver Lucky Girl
Aesthetic Silver Y2K Lucky Girl Waterproof Stickers For Laptop Water Bottle Helmet Scrapbooking Journal Decorative Decals
$0.86
No MOQ
Purple Gothic Stickers Cartoon Halloween Decals For Journal Laptop Water Bottle Fridge Waterproof Vinyl Graffiti Stickers
Purple Gothic Stickers Cartoon Halloween Decals For Journal Laptop Water Bottle Fridge Waterproof Vinyl Graffiti Stickers
like
Find Similar
50pcs purple gothic creepy-cute stickers for laptops and water bottles with waterproof finish - Purple Gothic Style (50 Sheets)
Purple Gothic Stickers Cartoon Halloween Decals For Journal Laptop Water Bottle Fridge Waterproof Vinyl Graffiti Stickers
$0.95
No MOQ
Cartoon Doodle Stickers PVC Waterproof Cute Hand Drawn Animals Decals For Water Bottle Laptop Scrapbook Journal Decor Kids Gift
Cartoon Doodle Stickers PVC Waterproof Cute Hand Drawn Animals Decals For Water Bottle Laptop Scrapbook Journal Decor Kids Gift
like
Find Similar
Vibrant 54pcs set of cartoon doodle stickers with animals and vehicles for kid's notebooks - 54 Sheets Cartoon Doodle Stickers
Cartoon Doodle Stickers PVC Waterproof Cute Hand Drawn Animals Decals For Water Bottle Laptop Scrapbook Journal Decor Kids Gift
$0.96
No MOQ
Christmas Wine Bottle Cover Mini Knitted Hat And Decorative Scarf Santa Reindeer Pattern For Holiday Table Decoration
Christmas Wine Bottle Cover Mini Knitted Hat And Decorative Scarf Santa Reindeer Pattern For Holiday Table Decoration
like
Find Similar
Mini Christmas knitted hat and scarf set with stripes and tree patterns for wine bottles - Christmas Tree Style
Christmas striped knit hat with pom-pom and deer pattern scarf set for wine bottles - Reindeer Style
Christmas knitted Santa hat and scarf set for wine bottles in festive red and green - Santa Claus Style
Christmas Wine Bottle Cover Mini Knitted Hat And Decorative Scarf Santa Reindeer Pattern For Holiday Table Decoration
$1.24
No MOQ
Christmas Wine Bottle Cover Faux Linen Buffalo Plaid Drawstring Gift Bag Festive Party Decor Gnomes Tree Truck Flower
Christmas Wine Bottle Cover Faux Linen Buffalo Plaid Drawstring Gift Bag Festive Party Decor Gnomes Tree Truck Flower
like
Find Similar
Merry Christmas wine bottle bag with red buffalo plaid trim and festive tree design - Christmas Tree / Beige
Christmas burlap wine bag with red truck gnome design and red black plaid collar - Truck and Gnomes Style / Beige
Detail of burlap Christmas wine bag with poinsettia flower and Merry Christmas text - Stereo Flower Style / Beige
Christmas Wine Bottle Cover Faux Linen Buffalo Plaid Drawstring Gift Bag Festive Party Decor Gnomes Tree Truck Flower
-5%
$1.64
Mix MOQ : 2
Christmas Burlap Wine Bottle Cover Drawstring Gift Bag Santa Claus Snowman Applique Xmas Party Table Decor Champagne Bag
Christmas Burlap Wine Bottle Cover Drawstring Gift Bag Santa Claus Snowman Applique Xmas Party Table Decor Champagne Bag
like
Find Similar
Linen Christmas wine bottle bag with 3d snowman and tree for festive table decor - Beige Snowman Style
Linen Christmas wine bottle cover with 3D snowman and festive tree on a red sack - Red Snowman Style
Linen Christmas wine bottle cover with Santa Claus and sequined tree decorations - Green Santa Claus
Christmas Burlap Wine Bottle Cover Drawstring Gift Bag Santa Claus Snowman Applique Xmas Party Table Decor Champagne Bag
-16%
$1.18
No MOQ
Christmas Wine Bottle Cover Embroidered Knitted Sweater Bottle Bag With Hat Santa Claus Reindeer Snowman Xmas Party Table Decor
Christmas Wine Bottle Cover Embroidered Knitted Sweater Bottle Bag With Hat Santa Claus Reindeer Snowman Xmas Party Table Decor
like
Find Similar
Christmas wine bottle cover with Santa embroidery and red knit mini sweater set - Santa Claus Style
Christmas snowman knitted wine bottle sweater and mini hat for festive holiday table decor - Snowman Style
Christmas wine bottle cover with reindeer sweater and polka dot hat decoration - Reindeer Style
Christmas Wine Bottle Cover Embroidered Knitted Sweater Bottle Bag With Hat Santa Claus Reindeer Snowman Xmas Party Table Decor
$1.59
Mix MOQ : 2
Christmas Knitted Wine Bottle Covers Mini Sweater Hat Reindeer Snowflake Santa Belt Style Holiday Party Table Decoration
Christmas Knitted Wine Bottle Covers Mini Sweater Hat Reindeer Snowflake Santa Belt Style Holiday Party Table Decoration
like
Find Similar
Christmas Santa knit bottle cover set with red sweater and mini hat for holiday decor - Belt Style
Christmas wine bottle cover with red deer and snowflake knit pattern and mini hat - Reindeer Style Wine Cover
Red and green snowflake knit sweater and hat cover for wine bottles Christmas decoration - Snowflake Style
Christmas Knitted Wine Bottle Covers Mini Sweater Hat Reindeer Snowflake Santa Belt Style Holiday Party Table Decoration
-5%
$2.24
Mix MOQ : 2
Christmas Wine Bottle Decoration Knitted Hat And Mini Scarf Festive Santa Reindeer Patterns For Holiday Party Table Decor
Christmas Wine Bottle Decoration Knitted Hat And Mini Scarf Festive Santa Reindeer Patterns For Holiday Party Table Decor
like
Find Similar
Mini Christmas knitted hat and scarf set with stripes and tree patterns for wine bottles - Knitted Scarf Bottle Cover Christmas Tree
Christmas striped knit hat with pom-pom and deer pattern scarf set for wine bottles - Knitted Scarf Bottle Cover Reindeer
Christmas knitted Santa hat and scarf set for wine bottles in festive red and green - Knitted Scarf Bottle Cover Santa Claus
Christmas Wine Bottle Decoration Knitted Hat And Mini Scarf Festive Santa Reindeer Patterns For Holiday Party Table Decor
$1.24
Mix MOQ : 2
Mini Santa Hats Christmas Cutlery Holders Silverware Pockets Flannel Bottle Toppers Festive Dinner Table Decoration
Mini Santa Hats Christmas Cutlery Holders Silverware Pockets Flannel Bottle Toppers Festive Dinner Table Decoration
like
Find Similar
Red Christmas mini hat decoration with white pompom for wine bottles and cutlery - Mini Christmas Hat with Pompom
Mini Santa Hats Christmas Cutlery Holders Silverware Pockets Flannel Bottle Toppers Festive Dinner Table Decoration
$0.09
No MOQ
Mini Christmas Hats Felt Fabric Wine Bottle Cover Cutlery Holder Holiday Dinner Party Table Decoration Festive Red White
Mini Christmas Hats Felt Fabric Wine Bottle Cover Cutlery Holder Holiday Dinner Party Table Decoration Festive Red White
like
Find Similar
Mini Christmas hat cutlery holder in red and white fabric, dimensions 4.7 by 2.2 inches - 6x12cm Mini Christmas Hat Wine Bottle Cap
Mini Christmas Hats Felt Fabric Wine Bottle Cover Cutlery Holder Holiday Dinner Party Table Decoration Festive Red White
$0.09
Mix MOQ : 10
Bohemian Aesthetic Waterproof Vinyl Decals For Water Bottle Laptop Phone Case Handbook Decor Abstract Art Illustrations Morandi Color Tones
Bohemian Aesthetic Waterproof Vinyl Decals For Water Bottle Laptop Phone Case Handbook Decor Abstract Art Illustrations Morandi Color Tones
like
Find Similar
50 pieces of Bohemian style waterproof PVC stickers with floral and aesthetic motifs - Bohemian Abstract Style (T01040742)
Bohemian Aesthetic Waterproof Vinyl Decals For Water Bottle Laptop Phone Case Handbook Decor Abstract Art Illustrations Morandi Color Tones
$0.86
Mix MOQ : 5
50Pcs Cartoon UFO Alien Abduction Animal Stickers Waterproof PVC Matte Decals For Suitcase Water Bottle Laptop Scrapbooking
50Pcs Cartoon UFO Alien Abduction Animal Stickers Waterproof PVC Matte Decals For Suitcase Water Bottle Laptop Scrapbooking
like
Find Similar
Set of 50 waterproof cartoon UFO animal stickers for luggage and laptop decoration - UFO Abduction Animals (50 Sheets)
New50Pcs Cartoon UFO Alien Abduction Animal Stickers Waterproof PVC Matte Decals For Suitcase Water Bottle Laptop Scrapbooking
$0.96
No MOQ
Christmas Gingerbread Man Wine Bottle Cover Hugger Plush Fabric Knitted Cloth Chef Hat Holiday Party Table Decor
Christmas Gingerbread Man Wine Bottle Cover Hugger Plush Fabric Knitted Cloth Chef Hat Holiday Party Table Decor
like
Find Similar
Gingerbread chef wine bottle cover with red vest and white hat for Christmas decor - Male Gingerbread Man Wine Bottle Hugger
Christmas gingerbread man chef wine bottle cover made of soft brown plush fabric - Female Gingerbread Man Wine Bottle Hugger
Christmas Gingerbread Man Wine Bottle Cover Hugger Plush Fabric Knitted Cloth Chef Hat Holiday Party Table Decor
-4%
$3.83
No MOQ
Knitted Christmas Wine Bottle Cover Xmas Beer Bottle Sweater Decor Reindeer Tree Snowflake Gingerbread Man Festive Table Decoration
Knitted Christmas Wine Bottle Cover Xmas Beer Bottle Sweater Decor Reindeer Tree Snowflake Gingerbread Man Festive Table Decoration
like
Find Similar
Knitted red and white striped Christmas beer bottle cover with gingerbread man design - Gingerbread Man
Blue knitted Christmas beer bottle cover with a cartoon reindeer and snowflake pattern - Blue Reindeer
Green knit beer bottle sleeve with snowflake patterns for Christmas table decor - Green Snowflake
Knitted Christmas Wine Bottle Cover Xmas Beer Bottle Sweater Decor Reindeer Tree Snowflake Gingerbread Man Festive Table Decoration
$1.21
No MOQ
Knitted Christmas Wine Bottle Covers Santa Claus Snowman Reindeer Festive Holiday Party Dining Table Decor Wine Sleeve Gift
Knitted Christmas Wine Bottle Covers Santa Claus Snowman Reindeer Festive Holiday Party Dining Table Decor Wine Sleeve Gift
like
Find Similar
Detail of Santa Claus wine bottle cover with red knit hat and white fuzzy beard decoration - Santa Claus Style
Detail of Christmas snowman wine bottle cover with green knit hat and striped scarf - Snowman Style
Detail of Christmas reindeer wine bottle cover with red knit fabric and striped scarf - Reindeer Style
NewKnitted Christmas Wine Bottle Covers Santa Claus Snowman Reindeer Festive Holiday Party Dining Table Decor Wine Sleeve Gift
$3.00
No MOQ
Santa Claus Wine Bottle Cover Polyester Fabric Christmas Decoration Table Ornament Xmas Tree Topper Hanging Gift For Holiday Party Home Decor
Santa Claus Wine Bottle Cover Polyester Fabric Christmas Decoration Table Ornament Xmas Tree Topper Hanging Gift For Holiday Party Home Decor
like
Find Similar
3 options
Santa Claus Wine Bottle Cover Polyester Fabric Christmas Decoration Table Ornament Xmas Tree Topper Hanging Gift For Holiday Party Home Decor
$4.29
Mix MOQ : 10
Christmas Wine Bottle Cover Knitted Gnome Rudolph Wine Bottle Decor For Xmas Party Dining Table Home Holiday Decorations
Christmas Wine Bottle Cover Knitted Gnome Rudolph Wine Bottle Decor For Xmas Party Dining Table Home Holiday Decorations
like
Find Similar
3 options
Christmas Wine Bottle Cover Knitted Gnome Rudolph Wine Bottle Decor For Xmas Party Dining Table Home Holiday Decorations
-4%
$1.07
No MOQ
Christmas Wine Bottle Covers Fabric Faux Linen Knitted Santa Claus Snowman Reindeer Bottle Bags For Holiday Table Decor
Christmas Wine Bottle Covers Fabric Faux Linen Knitted Santa Claus Snowman Reindeer Bottle Bags For Holiday Table Decor
like
Find Similar
Christmas Santa Claus wine bottle cover in red and green plaid fabric for table decor - Santa Claus
Festive snowman wine bottle cover with plaid pattern and black hat for Christmas decor - Snowman
Christmas reindeer wine bottle cover in red knit fabric for festive dining table decor - Elk Style
Christmas Wine Bottle Covers Fabric Faux Linen Knitted Santa Claus Snowman Reindeer Bottle Bags For Holiday Table Decor
-5%
$1.64
Mix MOQ : 2
Christmas Gnome Wine Bottle Cover Decorative Cloth Wine Sleeve With Long Beard Faceless Doll For Holiday Table Party Decor
Christmas Gnome Wine Bottle Cover Decorative Cloth Wine Sleeve With Long Beard Faceless Doll For Holiday Table Party Decor
like
Find Similar
3 options
Christmas Gnome Wine Bottle Cover Decorative Cloth Wine Sleeve With Long Beard Faceless Doll For Holiday Table Party Decor
-5%
$1.14
Mix MOQ : 2
Artistic World Famous Oil Paintings Waterproof PVC Vinyl Stickers For Laptop Luggage Phone Case Water Bottle Skateboard Guitar Stationery Decor
Artistic World Famous Oil Paintings Waterproof PVC Vinyl Stickers For Laptop Luggage Phone Case Water Bottle Skateboard Guitar Stationery Decor
like
Find Similar
50pcs Aesthetic World Famous Oil Painting Art Stickers for Laptop and Luggage - World Famous Painting Series Stickers
Artistic World Famous Oil Paintings Waterproof PVC Vinyl Stickers For Laptop Luggage Phone Case Water Bottle Skateboard Guitar Stationery Decor
$0.96
No MOQ
Watercolor Sea Turtle Stickers Waterproof Decorative Decals For Laptop Scrapbook Notebook Water Bottle Artistic DIY Crafts
Watercolor Sea Turtle Stickers Waterproof Decorative Decals For Laptop Scrapbook Notebook Water Bottle Artistic DIY Crafts
like
Find Similar
56 pieces watercolor sea turtle stickers set with colorful hand-painted art designs - Sea Turtle Sticker Set (T01043082)
Watercolor Sea Turtle Stickers Waterproof Decorative Decals For Laptop Scrapbook Notebook Water Bottle Artistic DIY Crafts
$0.86
Mix MOQ : 2
50Pcs Cartoon Brain Stickers Waterproof Vinyl Doodle Decals For Laptop Luggage Guitar Water Bottle Mental Health Slogan Stickers
50Pcs Cartoon Brain Stickers Waterproof Vinyl Doodle Decals For Laptop Luggage Guitar Water Bottle Mental Health Slogan Stickers
like
Find Similar
50 pieces of cartoon brain graffiti stickers for decorating laptops, guitars, and luggage - Brain Doodle (50 Sheets)
50Pcs Cartoon Brain Stickers Waterproof Vinyl Doodle Decals For Laptop Luggage Guitar Water Bottle Mental Health Slogan Stickers
$0.98
No MOQ
Christmas Gnome Wine Bottle Cover Handmade Swedish Tomte Gonk Bottle Topper For Holiday Dining Table Party Decoration
Christmas Gnome Wine Bottle Cover Handmade Swedish Tomte Gonk Bottle Topper For Holiday Dining Table Party Decoration
like
Find Similar
Festive Christmas gnome wine bottle cover with red buffalo plaid hat and white beard decoration - Plaid Gnome Bottle Cover
Christmas gnome wine bottle cover with brown reindeer antlers and white plush beard decor - Reindeer Antler Gnome Cover
Christmas gnome wine bottle cover with buffalo plaid hat and festive greenery decor - Black Hat Gnome Cover
Christmas Gnome Wine Bottle Cover Handmade Swedish Tomte Gonk Bottle Topper For Holiday Dining Table Party Decoration
$1.76
Mix MOQ : 2
Christmas Wine Bottle Covers Knitted Gnome Faceless Doll Wine Bottle Bag Reindeer Rudolph Decoration For Xmas Party Dining Table Decor
Christmas Wine Bottle Covers Knitted Gnome Faceless Doll Wine Bottle Bag Reindeer Rudolph Decoration For Xmas Party Dining Table Decor
like
Find Similar
Christmas gnome wine bottle cover with red knit hat and white beard decoration - Red Wine Bottle Cover
Knitted green Christmas gnome wine bottle cover with white beard and festive berries - Green Wine Bottle Cover
Grey knitted gnome wine bottle cover with a white beard and purple pom-pom for Christmas - Gray Style
Christmas Wine Bottle Covers Knitted Gnome Faceless Doll Wine Bottle Bag Reindeer Rudolph Decoration For Xmas Party Dining Table Decor
$1.12
Mix MOQ : 2
Christmas Knitted Wine Bottle Cover Santa Clause Elf Design With Belt Buckle Bells For Holiday Dinner Table Decor Gift
Christmas Knitted Wine Bottle Cover Santa Clause Elf Design With Belt Buckle Bells For Holiday Dinner Table Decor Gift
like
Find Similar
Knitted Christmas wine bottle cover with Santa belt design and festive decorations - Santa Claus Style (Belt Style)
Knitted Christmas elf wine bottle cover with red stripes and golden bells decoration - Christmas Elf Style (Striped Style)
Christmas Knitted Wine Bottle Cover Santa Clause Elf Design With Belt Buckle Bells For Holiday Dinner Table Decor Gift
-5%
$1.86
Mix MOQ : 2
Free Shipping
Christmas Candy Jars Transparent Plastic Storage Bottles Knitted Plush Reindeer Snowman Santa Decor Table Ornament Gift
Christmas Candy Jars Transparent Plastic Storage Bottles Knitted Plush Reindeer Snowman Santa Decor Table Ornament Gift
like
Find Similar
Christmas glass candy jar with plush Santa Claus wearing elk antlers on a wooden background - Large Santa Claus
Christmas reindeer Santa and snowman plush candy jars with transparent storage spheres - Small Santa Claus Balloon
Christmas Candy Jars Transparent Plastic Storage Bottles Knitted Plush Reindeer Snowman Santa Decor Table Ornament Gift
$1.50-3.03
Mix MOQ : 2
Christmas Wine Bottle Decor Mini Hat And Scarf Buffalo Plaid Fabric Holiday Table Ornament Party Dining Accessory
Christmas Wine Bottle Decor Mini Hat And Scarf Buffalo Plaid Fabric Holiday Table Ornament Party Dining Accessory
like
Find Similar
Christmas wine bottle cover set with red and black plaid scarf and holly berry hat ornament - Red and Black Plaid
Christmas wine bottle decor set with black and white plaid mini hat and matching scarf - Black and White Plaid
Christmas Wine Bottle Decor Mini Hat And Scarf Buffalo Plaid Fabric Holiday Table Ornament Party Dining Accessory
-4%
$0.88
No MOQ
Retro Gold Stamping PET Stickers Architecture Floral Waterproof Transparent Decorative Decals For Journal Guitar Water Bottle
Retro Gold Stamping PET Stickers Architecture Floral Waterproof Transparent Decorative Decals For Journal Guitar Water Bottle
like
Find Similar
50 pieces of waterproof PET gold-stamped stickers with world landmarks and floral patterns - Between Fragrance Architecture Floral Style (TJ017)
Retro Gold Stamping PET Stickers Architecture Floral Waterproof Transparent Decorative Decals For Journal Guitar Water Bottle
$1.04
No MOQ
Watercolor Starry Sky Stick Figure Stickers For Couple Waterproof PVC Romantic Decorative DIY Decals For Bottle Laptop Journaling
Watercolor Starry Sky Stick Figure Stickers For Couple Waterproof PVC Romantic Decorative DIY Decals For Bottle Laptop Journaling
like
Find Similar
Set of 49 watercolor star stickers with romantic matchstick couples and galaxy themes - Starry Sky Stick Figure Couple Style (RXHA5013)
NewWatercolor Starry Sky Stick Figure Stickers For Couple Waterproof PVC Romantic Decorative DIY Decals For Bottle Laptop Journaling
$0.86
Mix MOQ : 5
Cute Rainbow Cow Cartoon Stickers Waterproof PVC Graffiti Decals For Laptop Water Bottle Scrapbook Journal Kids Gift
Cute Rainbow Cow Cartoon Stickers Waterproof PVC Graffiti Decals For Laptop Water Bottle Scrapbook Journal Kids Gift
like
Find Similar
50 pieces of colorful cartoon rainbow cow stickers set with cute aesthetic designs - Rainbow Cow Style (T01041330)
NewCute Rainbow Cow Cartoon Stickers Waterproof PVC Graffiti Decals For Laptop Water Bottle Scrapbook Journal Kids Gift
$0.95
Mix MOQ : 2
Cartoon Funny Animal Meme Stickers Waterproof PVC Vinyl Graffiti Decals For Laptop Luggage Guitar Water Bottle DIY Decor
Cartoon Funny Animal Meme Stickers Waterproof PVC Vinyl Graffiti Decals For Laptop Luggage Guitar Water Bottle DIY Decor
like
Find Similar
50pcs waterproof cartoon animal meme stickers for laptops and luggage DIY decoration - Funny Animal Meme Style (YCK053)
NewCartoon Funny Animal Meme Stickers Waterproof PVC Vinyl Graffiti Decals For Laptop Luggage Guitar Water Bottle DIY Decor
$0.98
No MOQ
Vintage Masterpiece Oil Painting Waterproof PVC Stickers For Laptop Luggage Guitar Water Bottle Artistic Decor Decals
Vintage Masterpiece Oil Painting Waterproof PVC Stickers For Laptop Luggage Guitar Water Bottle Artistic Decor Decals
like
Find Similar
50pcs waterproof art museum oil painting stickers for laptop and luggage decor - Art Gallery Literary Oil Painting Ticket Series
Vintage Masterpiece Oil Painting Waterproof PVC Stickers For Laptop Luggage Guitar Water Bottle Artistic Decor Decals
$1.30
No MOQ
Funny Humorous Birthday Wine Bottle Labels PVC Self Adhesive Waterproof Sticker For Party Celebration Sisters Gifting Decor
Funny Humorous Birthday Wine Bottle Labels PVC Self Adhesive Waterproof Sticker For Party Celebration Sisters Gifting Decor
like
Find Similar
Black and gold 3-piece set of Happy Birthday wine labels with elegant dot patterns - Qt1355-1
Set of three black square wine bottle labels with humorous white birthday typography - Its Your Birthday-You Can Wine(QT1355-2)
Set of 4 funny self-adhesive wine bottle labels with black text for sisters and friends - Qt1355-3
Funny Humorous Birthday Wine Bottle Labels PVC Self Adhesive Waterproof Sticker For Party Celebration Sisters Gifting Decor
$0.72
Mix MOQ : 2
Free Shipping
Christmas Knitted Wine Bottle Covers Red Green Wine Bottle Sweater With Pom Poms For Christmas Dining Table Decoration
Christmas Knitted Wine Bottle Covers Red Green Wine Bottle Sweater With Pom Poms For Christmas Dining Table Decoration
like
Find Similar
Knitted Christmas wine bottle cover with snowman patterns and festive red bow decoration - Snowman Style / Red
Knitted snowman wine bottle cover with green and white snowflake patterns for Christmas decor - Christmas Tree Style / Green
Knitted red and white wine bottle cover with snowflake pattern and fluffy white pom-poms - Snowflake Style / Burgundy
NewChristmas Knitted Wine Bottle Covers Red Green Wine Bottle Sweater With Pom Poms For Christmas Dining Table Decoration
$2.05
Mix MOQ : 2
3D Acrylic Mirror Wall Sticker Wine Bottle And Glass Silhouette Removable Art Decal For Kitchen Dining Room Bar Decor Modern Self Adhesive Waterproof Mural
3D Acrylic Mirror Wall Sticker Wine Bottle And Glass Silhouette Removable Art Decal For Kitchen Dining Room Bar Decor Modern Self Adhesive Waterproof Mural
like
Find Similar
Macro detail of acrylic mirror wall decal showing 3D wine bottle and glass with Wine text - Silver
Macro detail of glossy black acrylic mirror wall sticker with wine bottle and glass design - Black
Detail of golden mirror acrylic wine bottle and glass wall sticker with Wine cutout - Gold
3D Acrylic Mirror Wall Sticker Wine Bottle And Glass Silhouette Removable Art Decal For Kitchen Dining Room Bar Decor Modern Self Adhesive Waterproof Mural
-5%
$1.45
No MOQ
Christmas Wine Bottle Cover Knit Velvet Santa Claus Snowman Reindeer Wine Bottle Bag For Holiday Dining Table Party Decor
Christmas Wine Bottle Cover Knit Velvet Santa Claus Snowman Reindeer Wine Bottle Bag For Holiday Dining Table Party Decor
like
Find Similar
Close-up of Santa Claus knitted wine bottle cover with soft white beard and red hat decor - Santa Claus
Close-up of a festive knitted snowman wine bottle cover with a striped scarf and belt - Snowman
Detail of knitted Christmas elk wine bottle cover with plush texture in festive home setting - Elk
Christmas Wine Bottle Cover Knit Velvet Santa Claus Snowman Reindeer Wine Bottle Bag For Holiday Dining Table Party Decor
-4%
$1.53
No MOQ
Go to

More in home & kitchen

Explore more in steel bottles

steeldoubledisplaymagnetickidsstrapdiywidetitaniumgirls
304 stainless steel316 stainless steelnaturalstylebarplasticmetalpolishedshapenecklace stainless steel

Ready to source like an insider

Get a direct line to the factory floor — no minimums, no middlemen, no guesswork.
iconReal factory pricing, no markup in betweeniconEvery order hand-inspected before it shipsicon5,000+ new products added daily
Get Inside Access