Everful

Wholesale wall clocks, wall clocks, wall sticker clocks

Factory-direct selection, vetted for quality and ready to order.

Sign Up
Wall Clocks, Wall Clocks, Wall Sticker Clocks

Find the perfect pieces: alarm clocks, wall clocks & wall sticker clocks

filterShow Filters
Best Seller
New Arrivals
Price Drop
Free Shipping
DIY Wall Clock Acrylic Frameless Luminous Silent Mirror 3D Surface Sticker Modern Home Decor For Living Room Office
DIY Wall Clock Acrylic Frameless Luminous Silent Mirror 3D Surface Sticker Modern Home Decor For Living Room Office
like
Find Similar
DIY black acrylic wall clock with 3D numbers and luminous silent movement for living room - Small 40cm / Black
Macro shot of DIY acrylic luminous wall clock numbers and hands on a clean white wall - Medium 50cm / Black
Minimalist DIY frameless wall clock with 3D black acrylic numbers and black hands set - Medium 3D 90cm / Black
Minimalist DIY frameless wall clock in black acrylic with luminous 3D large numbers - Large 3D 130cm / Black
+16
DIY Wall Clock Acrylic Frameless Luminous Silent Mirror 3D Surface Sticker Modern Home Decor For Living Room Office
-5%
$1.10-6.16
No MOQ
 · 
33 views
Black Line Art Feather Butterfly Clock Wall Sticker PVC Waterproof Self Adhesive Dreamcatcher Decal For Living Room Home Decor
Black Line Art Feather Butterfly Clock Wall Sticker PVC Waterproof Self Adhesive Dreamcatcher Decal For Living Room Home Decor
like
Find Similar
Black feather dreamcatcher wall sticker layout size 90x30cm and paste effect display - Black Line Feather Clock Style (SC372)
Black Line Art Feather Butterfly Clock Wall Sticker PVC Waterproof Self Adhesive Dreamcatcher Decal For Living Room Home Decor
$1.44
Mix MOQ : 4
Creative Cartoon Motivational Time Management Wall Sticker PVC Roman Numeral Clock Hourglass For Office Classroom Decor
Creative Cartoon Motivational Time Management Wall Sticker PVC Roman Numeral Clock Hourglass For Office Classroom Decor
like
Find Similar
1 option
Creative Cartoon Motivational Time Management Wall Sticker PVC Roman Numeral Clock Hourglass For Office Classroom Decor
$1.38
No MOQ
Watercolor Green Potted Plants Wall Stickers PVC Waterproof Clock Leaf Wall Decals For Living Room Bedroom Kids Room Home Decor
Watercolor Green Potted Plants Wall Stickers PVC Waterproof Clock Leaf Wall Decals For Living Room Bedroom Kids Room Home Decor
like
Find Similar
Layout details of hand-painted watercolor plant wall stickers with retro clock design - 30x90cm (2 Sheets)
Watercolor Green Potted Plants Wall Stickers PVC Waterproof Clock Leaf Wall Decals For Living Room Bedroom Kids Room Home Decor
-4%
$1.78
No MOQ
Christmas Countdown Wreath Clock Wall Sticker PVC Roman Numeral Gold Clock Face Garland Red Bow Festive Home Decoration
Christmas Countdown Wreath Clock Wall Sticker PVC Roman Numeral Gold Clock Face Garland Red Bow Festive Home Decoration
like
Find Similar
Christmas wreath wall sticker with vintage clock face design measuring 38x38cm - Christmas Clock Wreath (PH-QT9249)
NewChristmas Countdown Wreath Clock Wall Sticker PVC Roman Numeral Gold Clock Face Garland Red Bow Festive Home Decoration
-12%
$0.96
No MOQ
Motivational Wall Sticker Every Day Is A New Beginning Running Silhouette Clock PVC Removable Home Office Decal Black
Motivational Wall Sticker Every Day Is A New Beginning Running Silhouette Clock PVC Removable Home Office Decal Black
like
Find Similar
Detail view of PVC wall stickers with black clock patterns and motivational running silhouettes - 30*90CM*2PCS Layout
Motivational Wall Sticker Every Day Is A New Beginning Running Silhouette Clock PVC Removable Home Office Decal Black
$2.02
No MOQ
Vintage Retro Clock Book Floral Wall Stickers PVC Removable Self Adhesive Art Decal For Living Room Bedroom Home Decor
Vintage Retro Clock Book Floral Wall Stickers PVC Removable Self Adhesive Art Decal For Living Room Bedroom Home Decor
like
Find Similar
Vintage wall decals featuring clock, flowers and books with 37x37cm layout display - 40x40cm (13P0-D11) / Brown
Vintage Retro Clock Book Floral Wall Stickers PVC Removable Self Adhesive Art Decal For Living Room Bedroom Home Decor
$1.01
Mix MOQ : 3
Black Tree And Flying Birds Wall Sticker Modern PVC Silhouette Decal With Clock Decor For Living Room Bedroom Home Art
Black Tree And Flying Birds Wall Sticker Modern PVC Silhouette Decal With Clock Decor For Living Room Bedroom Home Art
like
Find Similar
Detail of tree and bird wall stickers showing sheet layout and final application size - 30*60cm
Black Tree And Flying Birds Wall Sticker Modern PVC Silhouette Decal With Clock Decor For Living Room Bedroom Home Art
$1.15
Mix MOQ : 2
Vintage Christmas Clock Pine Needle Toilet Sticker PVC Self Adhesive Wall Decal For Festive Bathroom Home Decor Supplies
Vintage Christmas Clock Pine Needle Toilet Sticker PVC Self Adhesive Wall Decal For Festive Bathroom Home Decor Supplies
like
Find Similar
Detailed size chart for Christmas bell wall sticker showing layout and finished dimensions - 24x24cm (HY-M478)
Vintage Christmas Clock Pine Needle Toilet Sticker PVC Self Adhesive Wall Decal For Festive Bathroom Home Decor Supplies
$0.58
No MOQ
Vintage Nautical Wood Wall Clock Silent Round Beach Sea Theme Decorative Timepiece For Living Room Home Office Decor
Vintage Nautical Wood Wall Clock Silent Round Beach Sea Theme Decorative Timepiece For Living Room Home Office Decor
like
Find Similar
Silent vintage nautical wall clock with anchor motif on ocean blue wood panels - Retro Blue Beige Anchor
12-inch vintage silent wall clock with multicolor distressed wood grain print design - Colored Wood Strips
Silent wooden wall clock featuring a vintage tropical beach ocean scenery design - Ocean Waves Beach
Silent wooden wall clock featuring a vintage tropical beach ocean scenery design - Tropical Palm Beach
+41
Vintage Nautical Wood Wall Clock Silent Round Beach Sea Theme Decorative Timepiece For Living Room Home Office Decor
-4%
$4.11
Mix MOQ : 2
 · 
52 sold recently
Creative Coffee Time Wall Sticker Spanish Hora del Café Clock Design PVC Removable Decal for Cafe Kitchen Home Decor
Creative Coffee Time Wall Sticker Spanish Hora del Café Clock Design PVC Removable Decal for Cafe Kitchen Home Decor
like
Find Similar
1 option
Creative Coffee Time Wall Sticker Spanish Hora del Café Clock Design PVC Removable Decal for Cafe Kitchen Home Decor
$1.44
Mix MOQ : 2
Vintage Clock Flower Butterfly Wall Sticker Retro Steampunk PVC Self Adhesive Decorative Decal For Living Room Home Decor
Vintage Clock Flower Butterfly Wall Sticker Retro Steampunk PVC Self Adhesive Decorative Decal For Living Room Home Decor
like
Find Similar
Vintage butterfly floral clock wall stickers for living room decor with retro rose elements - 40x40cm / Brown
Vintage Clock Flower Butterfly Wall Sticker Retro Steampunk PVC Self Adhesive Decorative Decal For Living Room Home Decor
$0.72
Mix MOQ : 3
Astronaut Space Exploration Theme Silent Wall Clock Modern Paper Cut Style Round Hanging Clock For Kids Room Bedroom Home Decor
Astronaut Space Exploration Theme Silent Wall Clock Modern Paper Cut Style Round Hanging Clock For Kids Room Bedroom Home Decor
like
Find Similar
8-inch astronaut and space shuttle wall clock with silent mechanism for kids' bedroom - Space Shuttle / S
Modern creative astronaut space-themed silent wall clock for kids room home decor - Space Exploration / S
Creative astronaut space themed wall clock for children's room silent decoration - Space Travel / S
Modern silent cartoon astronaut space themed wall clock for kids bedroom nursery - Rocket Exploration / S
+46
Astronaut Space Exploration Theme Silent Wall Clock Modern Paper Cut Style Round Hanging Clock For Kids Room Bedroom Home Decor
$3.31-12.10
No MOQ
 · 
45 sold recently
Children Educational Wall Clock Silent Metal Frame Colorful Numbers Teaching Time Learning Clock For Kids Bedroom School Decor
Children Educational Wall Clock Silent Metal Frame Colorful Numbers Teaching Time Learning Clock For Kids Bedroom School Decor
like
Find Similar
Educational colorful wall clock with 12 and 24 hour markers for kids learning time - Silent Blue Core - Rainbow Dots Black Frame (6362-W) / S
Colorful educational wall clock for kids learning time with hour and minute scales - Silent Blue Core - Rainbow Dots Gold Frame (6362-W) / S
Colorful cartoon animal educational wall clock for kids bedroom decor silent movement - Silent Blue Core - Cartoon Animal Black Frame (6363-W) / S
Vibrant orange cartoon wall clock for kids learning with silent quartz movement - Silent Blue Core - Cartoon Animal Gold Frame (6363-W) / S
+68
Children Educational Wall Clock Silent Metal Frame Colorful Numbers Teaching Time Learning Clock For Kids Bedroom School Decor
$4.32-6.97
No MOQ
 · 
52 sold recently
Retro Wall Clock Wooden Silent Round Non-Ticking Quartz Battery Operated Vintage Home Decor Floral Owl Style
Retro Wall Clock Wooden Silent Round Non-Ticking Quartz Battery Operated Vintage Home Decor Floral Owl Style
like
Find Similar
Vintage 12-inch wooden wall clock with floral rose design and silent movement - 30cm / Blue Butterfly
12 Inch vintage world map wall clock with rustic wood grain finish and Arabic numerals - 30cm / Blue Planet
Vintage round wooden wall clock with yellow sunflowers and white Arabic numerals - 30cm / Wood Grain Sunflower
Retro round wooden wall clock featuring patchwork owl design and floral patterns - 30cm / Cartoon Owl
+23
Retro Wall Clock Wooden Silent Round Non-Ticking Quartz Battery Operated Vintage Home Decor Floral Owl Style
-4%
$4.03
Mix MOQ : 2
 · 
12 sold recently
10 Inch Children Educational Wall Clock Silent Non-Ticking Colorful 12/24 Hour Time Teaching Clock For Kids Bedroom School Home Decor
10 Inch Children Educational Wall Clock Silent Non-Ticking Colorful 12/24 Hour Time Teaching Clock For Kids Bedroom School Home Decor
like
Find Similar
Silent colorful cartoon wall clock for kids room featuring educational numbers and 24-hour display - Slide Style / Small (Silent)
Educational children's wall clock with cartoon space rocket and colorful numbers - Astronaut Style / Small (Silent)
Colorful cartoon kids wall clock with a silent learning dial for early education - Forest Fox Style / Small (Silent)
Colorful educational wall clock for children featuring cartoon rocket and large numbers - Space Rocket Style / Small (Silent)
+38
10 Inch Children Educational Wall Clock Silent Non-Ticking Colorful 12/24 Hour Time Teaching Clock For Kids Bedroom School Home Decor
$2.16-24.76
No MOQ
 · 
124 sold recently
Removable PVC Wall Sticker Family Quote DIY Art Decal Modern Casual Black Clock Layout Home Decor For Living Room Bedroom
Removable PVC Wall Sticker Family Quote DIY Art Decal Modern Casual Black Clock Layout Home Decor For Living Room Bedroom
like
Find Similar
Family Time inspirational wall sticker with clock hand design in black art font - Family Quote (30x120cm x 2 Sheets, Without Frame) / Black
Removable PVC Wall Sticker Family Quote DIY Art Decal Modern Casual Black Clock Layout Home Decor For Living Room Bedroom
$3.17
No MOQ
Creative Novelty Desktop Alarm Clock Plastic Quartz Movement Retro Vintage Shape Battery Operated Home Office Decor
Creative Novelty Desktop Alarm Clock Plastic Quartz Movement Retro Vintage Shape Battery Operated Home Office Decor
like
Find Similar
Retro steam train alarm clock in antique bronze finish with quartz movement detail - Bronze Train Alarm Clock
Creative bicycle shaped alarm clock in light green color for students bedside decor - Green Bicycle Alarm Clock
Light blue bicycle shaped alarm clock for students with clear analog numbers - Blue Bicycle Alarm Clock
Pink vintage bicycle shaped desk alarm clock for students bedside decor and timekeeping - Pink Bicycle Alarm Clock
+32
Creative Novelty Desktop Alarm Clock Plastic Quartz Movement Retro Vintage Shape Battery Operated Home Office Decor
$1.67-4.50
No MOQ
 · 
49 sold recently
Modern Silent Wall Clock Minimalist Round Non Ticking Quartz Battery Operated Plastic Home Office Kitchen Decor
Modern Silent Wall Clock Minimalist Round Non Ticking Quartz Battery Operated Plastic Home Office Kitchen Decor
like
Find Similar
30cm silent white wall clock with 3D rose gold numbers and quartz movement - White Frame White Dial Rose Gold
Minimalist 30cm coral pink wall clock with golden 3D numbers and white marble background - Light Pink Dial Gold Numbers Pink Frame
Modern 14-inch silent wall clock with matte dark grey dial and rose gold numerals - Grey Frame Grey Dial Rose Gold Numbers
Minimalist white 14-inch silent wall clock with 3D black numerals on marble surface - White Frame White Dial Black Numbers
+20
Modern Silent Wall Clock Minimalist Round Non Ticking Quartz Battery Operated Plastic Home Office Kitchen Decor
$3.60
Mix MOQ : 2
Retro Twin Bell Alarm Clock Silent Quartz Movement Bedside Desktop Timekeeper For Students Kids ABS
Retro Twin Bell Alarm Clock Silent Quartz Movement Bedside Desktop Timekeeper For Students Kids ABS
like
Find Similar
Classic white twin bell alarm clock with silent quartz movement and simple Arabic numerals - White
Pink round double bell alarm clock with clear Arabic numerals and quartz movement - Pink
Retro light blue silent alarm clock with dual bells and large numbers for kids - Blue
Classic twin bell silent quartz alarm clock in black finish for student bedside tables - Black
Retro Twin Bell Alarm Clock Silent Quartz Movement Bedside Desktop Timekeeper For Students Kids ABS
-19%
$1.08
Mix MOQ : 2
 · 
333 sold recently
Inspirational Time Quote Wall Sticker Removable PVC Art Decal Home Decor For Living Room Bedroom Office Artistic Decal
Inspirational Time Quote Wall Sticker Removable PVC Art Decal Home Decor For Living Room Bedroom Office Artistic Decal
like
Find Similar
1 option
Inspirational Time Quote Wall Sticker Removable PVC Art Decal Home Decor For Living Room Bedroom Office Artistic Decal
-4%
$0.96
No MOQ
Vintage Hand-drawn Flower Butterfly Clock Book Wall Sticker Removable PVC Self-adhesive Decal For Home Living Room Bedroom Decor
Vintage Hand-drawn Flower Butterfly Clock Book Wall Sticker Removable PVC Self-adhesive Decal For Home Living Room Bedroom Decor
like
Find Similar
Vintage flower and clock wall sticker with retro books and butterflies on white background - 13P0-D12 Style / Brown
Vintage Hand-drawn Flower Butterfly Clock Book Wall Sticker Removable PVC Self-adhesive Decal For Home Living Room Bedroom Decor
$0.72
Mix MOQ : 3
Creative DIY English Slogan Wall Stickers Dialogue Bubble Heart Pattern PVC Decals For Living Room Bedroom Home Decoration
Creative DIY English Slogan Wall Stickers Dialogue Bubble Heart Pattern PVC Decals For Living Room Bedroom Home Decoration
like
Find Similar
DIY cartoon expression bubble wall stickers set featuring WOW and OMG signs in 60x40cm sheet - Creative Dialogue Bubble Style (FX-E196)
Creative DIY English Slogan Wall Stickers Dialogue Bubble Heart Pattern PVC Decals For Living Room Bedroom Home Decoration
$1.44
No MOQ
Artistic Round Wall Clock Silent Quartz Movement Decorative Plastic Glass Mirror For Living Room Kids Bedroom Office
Artistic Round Wall Clock Silent Quartz Movement Decorative Plastic Glass Mirror For Living Room Kids Bedroom Office
like
Find Similar
Round wall clock with champagne gold frame and dreamy whale illustration art - Dial A Rose Gold Frame
12-inch silent wall clock with rose gold frame and romantic cartoon cat illustration - Dial B Rose Gold Frame
Rose gold round wall clock featuring a cute fox illustration and Arabic numerals - Dial C Rose Gold Frame
12-inch silent wall clock with rose gold frame and cute brown bear dial design - Dial D Rose Gold Frame
+20
Artistic Round Wall Clock Silent Quartz Movement Decorative Plastic Glass Mirror For Living Room Kids Bedroom Office
$2.54
Mix MOQ : 2
Nordic Creative Acrylic Wall Clock Modern Minimalist Art Flower Eye Hand Shape Decorative Silent Clock For Home Living Room Office
Nordic Creative Acrylic Wall Clock Modern Minimalist Art Flower Eye Hand Shape Decorative Silent Clock For Home Living Room Office
like
Find Similar
Modern olive green floral acrylic wall clock with minimalist black hands and white markers - Flower Style
Modern translucent blue acrylic flower wall clock with minimalist white dial and hands - Blue 4-petal Clock
Modern Klein blue flower-shaped acrylic wall clock with white hands and minimal design - Blue 5-petal Clock
Nordic Creative Acrylic Wall Clock Modern Minimalist Art Flower Eye Hand Shape Decorative Silent Clock For Home Living Room Office
-5%
$14.24
No MOQ
3D Hollow Butterfly Wall Stickers Metallic Paper DIY Removable Wall Decals For Home Wedding Party Decor
3D Hollow Butterfly Wall Stickers Metallic Paper DIY Removable Wall Decals For Home Wedding Party Decor
like
Find Similar
3D hollow rose gold butterfly wall stickers set for home decor and wedding party - Style A / Rose Gold
Set of 11 silver hollow 3D butterfly wall stickers with elegant metallic texture - Style A / Silver
12-piece rose gold 3D hollow butterfly wall stickers for romantic wedding home decoration - Style B / Rose Gold
3D hollow butterfly wall stickers in silver metallic finish for home and wedding decor - Style B / Silver
+16
3D Hollow Butterfly Wall Stickers Metallic Paper DIY Removable Wall Decals For Home Wedding Party Decor
-4%
$0.44
Mix MOQ : 2
 · 
2K+ sold recently
French Quote Family Time Wall Sticker With Clock Roman Numerals Black PVC DIY Removable Home Living Room Wall Decor
French Quote Family Time Wall Sticker With Clock Roman Numerals Black PVC DIY Removable Home Living Room Wall Decor
like
Find Similar
French family quote wall sticker with clock design showing layout and finish sizes - French Quote Clock Style (HM-3393)
French Quote Family Time Wall Sticker With Clock Roman Numerals Black PVC DIY Removable Home Living Room Wall Decor
$1.38
Mix MOQ : 4
Vintage American Wooden Wall Clock Nautical Patriotic Home Decor Round Square Decorative 12 Inch Clock For Living Room Kitchen
Vintage American Wooden Wall Clock Nautical Patriotic Home Decor Round Square Decorative 12 Inch Clock For Living Room Kitchen
like
Find Similar
Retro round wall clock with multi-color wood grain panel and vintage French text - Round Style / Round Paris
Close-up of vintage round wall clock with lighthouse motif and black numerals - Round Style / Round Lighthouse
Retro nautical wood wall clock with lighthouse design and Welcome Aboard text - Round Style / Anchor Circle
Retro American landscape wooden wall clock featuring snow mountains and lake scenery - Round Style / Circular Mountain
+4
Vintage American Wooden Wall Clock Nautical Patriotic Home Decor Round Square Decorative 12 Inch Clock For Living Room Kitchen
$5.19
Mix MOQ : 2
Modern Round Wall Clock Silent Quartz Movement Artistic Geometric Cartoon Animal Design For Living Room Home Decor
Modern Round Wall Clock Silent Quartz Movement Artistic Geometric Cartoon Animal Design For Living Room Home Decor
like
Find Similar
Round wall clock with champagne gold frame and dreamy whale illustration art - 12 Inch Dial A (Rose Gold Frame)
12-inch silent wall clock with rose gold frame and romantic cartoon cat illustration - 12 Inch Dial B (Rose Gold Frame)
Rose gold round wall clock featuring a cute fox illustration and Arabic numerals - 12 Inch Dial C (Rose Gold Frame)
12-inch silent wall clock with rose gold frame and cute brown bear dial design - 12 Inch Dial D (Rose Gold Frame)
+20
Modern Round Wall Clock Silent Quartz Movement Artistic Geometric Cartoon Animal Design For Living Room Home Decor
$3.60
Mix MOQ : 2
Modern Luxury Wall Clock Metal Frame Wood Dial Silent Movement Swinging Pendulum Decorative For Living Room Office Entryway
Modern Luxury Wall Clock Metal Frame Wood Dial Silent Movement Swinging Pendulum Decorative For Living Room Office Entryway
like
Find Similar
Modern grey and gold wall clock with pendulum, size 68x52cm, for minimalist living rooms - JT2232-52*68CM Small
Modern geometric wall clock with 21cm dial, 36x57cm navy blue and gold pendulum design - Jt23224-36 Small Single Wall Clock
Modern geometric wall clock with black metal frame and pendulum, size 42x65cm - Jt23224-42 Medium Single Wall Clock
Modern minimalist black and white wall clock with metal frame and pendulum, 50x79cm size - Jt23224-50 Large Single Wall Clock
+6
Modern Luxury Wall Clock Metal Frame Wood Dial Silent Movement Swinging Pendulum Decorative For Living Room Office Entryway
-5%
$21.08-36.14
No MOQ
 · 
46 views
Free Shipping
Stick Figure Heart Balloon Wall Sticker My Heart Belongs To You PVC Quote Decal For Bedroom Home Decor Decorative Sticker
Stick Figure Heart Balloon Wall Sticker My Heart Belongs To You PVC Quote Decal For Bedroom Home Decor Decorative Sticker
like
Find Similar
Wall sticker size guide showing 7x14cm sheet and 12x12cm finish size for wall decal - 7x14cm/Transparent
Stick Figure Heart Balloon Wall Sticker My Heart Belongs To You PVC Quote Decal For Bedroom Home Decor Decorative Sticker
$0.72
No MOQ
Free Shipping
Vintage Style Wall Sticker Removable PVC Decal Featuring Retro Clock Suitcase And Globe Pattern For Home Decor Office Bedroom
Vintage Style Wall Sticker Removable PVC Decal Featuring Retro Clock Suitcase And Globe Pattern For Home Decor Office Bedroom
like
Find Similar
Vintage clock and globe PVC wall decals with suitcase art and layout dimensions - 40x40cm / Brown
Vintage Style Wall Sticker Removable PVC Decal Featuring Retro Clock Suitcase And Globe Pattern For Home Decor Office Bedroom
$1.01
Mix MOQ : 3
Cartoon Metal Twin Bell Alarm Clock For Students Kids Silent Non-Ticking Loud Desktop Quartz Clock Capybara Desk Decor
Cartoon Metal Twin Bell Alarm Clock For Students Kids Silent Non-Ticking Loud Desktop Quartz Clock Capybara Desk Decor
like
Find Similar
Retro twin bell alarm clock with white metal case and pink dial for bedside decor - F18 Silent Alarm Clock (Pink)
Classic white and brown twin bell alarm clock with silent movement for bedside - F18 Silent Alarm Clock (Coffee)
Mechanical desk alarm clock with blue face and twin metal bells on a wooden table - F18 Silent Alarm Clock (Blue)
Blue retro twin bell alarm clock for students on a minimalist book in a home setting - A301 Silent Alarm Clock (Blue)
+9
Cartoon Metal Twin Bell Alarm Clock For Students Kids Silent Non-Ticking Loud Desktop Quartz Clock Capybara Desk Decor
$3.42-4.07
Mix MOQ : 2
Modern Minimalist Wall Clock Silent Quartz Movement Round Plastic With Glass Cover Home Office Decor Timepiece
Modern Minimalist Wall Clock Silent Quartz Movement Round Plastic With Glass Cover Home Office Decor Timepiece
like
Find Similar
Modern 30cm black quartz wall clock with minimalist white dial and Arabic numerals - White Black Frame
Modern white 30CM round silent wall clock with black Arabic numerals and quartz movement - White Dial White Frame
Modern 30cm minimalist round wall clock featuring black dial with white Arabic numerals - Black Dial White Frame
Modern minimalist black wall clock with white numerals and silent quartz movement - Black Dial Black Frame
+12
Modern Minimalist Wall Clock Silent Quartz Movement Round Plastic With Glass Cover Home Office Decor Timepiece
$3.60
Mix MOQ : 2
Live Your Dreams Inspirational Quotes Wall Sticker Butterfly Pattern PVC Waterproof Decal For Home Bedroom Living Room Office
Live Your Dreams Inspirational Quotes Wall Sticker Butterfly Pattern PVC Waterproof Decal For Home Bedroom Living Room Office
like
Find Similar
4 options
Live Your Dreams Inspirational Quotes Wall Sticker Butterfly Pattern PVC Waterproof Decal For Home Bedroom Living Room Office
-4%
$0.96
No MOQ
Minimalist Hand Drawn Heart Wall Stickers PVC Waterproof Decorative Decals For Living Room Bedroom Office Home Decor
Minimalist Hand Drawn Heart Wall Stickers PVC Waterproof Decorative Decals For Living Room Bedroom Office Home Decor
like
Find Similar
Detail view of heart wall decals showing sheet size and finish size dimensions - 20x29cm Transparent
Minimalist Hand Drawn Heart Wall Stickers PVC Waterproof Decorative Decals For Living Room Bedroom Office Home Decor
$0.81
No MOQ
Cartoon Owl Family Swing Wall Sticker PVC Self Adhesive Black Silhouette Moon Stars Decor For Kids Bedroom Reading Corner
Cartoon Owl Family Swing Wall Sticker PVC Self Adhesive Black Silhouette Moon Stars Decor For Kids Bedroom Reading Corner
like
Find Similar
Black silhouette cartoon owl swing wall sticker with moon and stars layout size specs - Owl Family (KS462) / 42*57cm
NewCartoon Owl Family Swing Wall Sticker PVC Self Adhesive Black Silhouette Moon Stars Decor For Kids Bedroom Reading Corner
$1.30
Mix MOQ : 3
Double Bell Alarm Clock Metal Silent Quartz Movement Retro Bedside Night Light Bedroom Minimalist Home Decor
Double Bell Alarm Clock Metal Silent Quartz Movement Retro Bedside Night Light Bedroom Minimalist Home Decor
like
Find Similar
Retro white twin bell alarm clock with cartoon strawberry bear design for students - White
Classic yellow metal twin bell alarm clock with silent quartz movement for students - Yellow
Retro 3-inch red metal twin bell alarm clock with quartz movement and silent ticking - Red
Classic green metal twin bell alarm clock with quartz movement and clear dial - Green
+5
Double Bell Alarm Clock Metal Silent Quartz Movement Retro Bedside Night Light Bedroom Minimalist Home Decor
$3.17
Mix MOQ : 2
 · 
46 sold recently
Retro Round Wall Clock Silent Quartz Movement Plastic Frame Glass Mirror European Vintage Style Living Room Home Decor
Retro Round Wall Clock Silent Quartz Movement Plastic Frame Glass Mirror European Vintage Style Living Room Home Decor
like
Find Similar
Industrial vintage wall clock with black frame and golden inner ring featuring Roman numerals - Gold Border Black Roman Dial
Retro Nordic silent wall clock with black round frame and vintage beige dial, 30cm quartz - Silver Border Black Arabic Dial
30cm vintage wall clock with black frame and roman numerals in industrial style - Silver Border Black Roman Dial
Vintage Nordic 30cm silent wall clock in bronze finish with retro numeral dial - Brushed Bronze Arabic Dial
+4
Retro Round Wall Clock Silent Quartz Movement Plastic Frame Glass Mirror European Vintage Style Living Room Home Decor
$4.84
Mix MOQ : 2
Coffee Time Wall Sticker Artistic Coffee Cup Heart Pattern Waterproof Removable PVC Decal For Kitchen Cafe Home Wall Art
Coffee Time Wall Sticker Artistic Coffee Cup Heart Pattern Waterproof Removable PVC Decal For Kitchen Cafe Home Wall Art
like
Find Similar
Detail of coffee time wall sticker showing hand-drawn cup, beans and heart-shaped patterns - 24*24cm (HY-F741)
Coffee Time Wall Sticker Artistic Coffee Cup Heart Pattern Waterproof Removable PVC Decal For Kitchen Cafe Home Wall Art
$0.86
No MOQ
Romantic Watercolor Purple Moon Flower Stars Wall Sticker Creative Pendant Lamp Decal For Bedroom Living Room Home Background Decor
Romantic Watercolor Purple Moon Flower Stars Wall Sticker Creative Pendant Lamp Decal For Bedroom Living Room Home Background Decor
like
Find Similar
Detail showing purple floral moon and retro lantern wall decal dimensions and application - 40*60cm/fun-e238
Romantic Watercolor Purple Moon Flower Stars Wall Sticker Creative Pendant Lamp Decal For Bedroom Living Room Home Background Decor
$1.44
No MOQ
Black Queen Butterfly Heart Wall Decal PVC Female Portrait Word Cloud Wall Sticker For Living Room Bedroom Home Decor
Black Queen Butterfly Heart Wall Decal PVC Female Portrait Word Cloud Wall Sticker For Living Room Bedroom Home Decor
like
Find Similar
Detail showing Melanin African woman wall sticker dimensions with butterflies and text - 14Z44-D152/40*40*1(No Bag) / Brown
Black Queen Butterfly Heart Wall Decal PVC Female Portrait Word Cloud Wall Sticker For Living Room Bedroom Home Decor
$1.07
Mix MOQ : 3
LED Digital Wall Clock With Temperature Date Display Electronic Alarm Clock Desktop Hanging Dual Use Minimalist Home Decor
LED Digital Wall Clock With Temperature Date Display Electronic Alarm Clock Desktop Hanging Dual Use Minimalist Home Decor
like
Find Similar
Modern black square LED digital clock showing time, date, temperature and weekday - Multicolor LED
Black square LED digital clock with blue and white display showing time and temperature - Blue
Modern black LED digital clock showing pink and white time on a white background - Magenta
Black digital alarm clock with green LED display showing time, date and temperature - Green
+1
LED Digital Wall Clock With Temperature Date Display Electronic Alarm Clock Desktop Hanging Dual Use Minimalist Home Decor
$11.21
No MOQ
 · 
20 views
Modern Silent Wall Clock Large Stereoscopic Numbers Quartz Battery Operated Round Plastic Glass Home Office Decor Minimalist
Modern Silent Wall Clock Large Stereoscopic Numbers Quartz Battery Operated Round Plastic Glass Home Office Decor Minimalist
like
Find Similar
Modern 30cm blue wall clock with 3D white numerals and silent quartz movement - Light Blue Face White Numerals White Case
30cm silent quartz wall clock with dark grey dial and white 3D numbers for home decor - Gray Dial White Text White Frame
Modern 30cm round silent wall clock with vibrant red dial and 3D white embossed numbers - Red Face White Numerals White Case
Modern Tiffany blue wall clock with 3D white numerals and silent quartz movement - Tiffany Blue Face White Numerals White Case
+34
Modern Silent Wall Clock Large Stereoscopic Numbers Quartz Battery Operated Round Plastic Glass Home Office Decor Minimalist
$3.60
Mix MOQ : 2
Creative Motorcycle Alarm Clock Retro Racing Bike Shape Quartz Desk Clock For Home Office Decor Kids Student Gift
Creative Motorcycle Alarm Clock Retro Racing Bike Shape Quartz Desk Clock For Home Office Decor Kids Student Gift
like
Find Similar
Creative motorcycle-shaped alarm clock in electroplated gold finish for home decor - Gold Single Color Motorcycle (PF168D)
Creative motorcycle desk clock in golden and red finish with integrated quartz dial - Gold Dual Color Motorcycle (PF168C)
Creative gunmetal retro motorcycle desk alarm clock with golden details and clear dial - Gunmetal Dual Color Motorcycle (PF168A)
Vintage motorcycle desk clock in gunmetal finish with detailed wheel dial and retro aesthetic - Gunmetal Single Color Motorcycle (PF168B)
+3
Creative Motorcycle Alarm Clock Retro Racing Bike Shape Quartz Desk Clock For Home Office Decor Kids Student Gift
$1.99-3.17
Mix MOQ : 2
Vintage Rose Flower And Bird Wall Sticker PVC Printed Watercolor Floral Wall Decal For Bedroom Living Room Decor
Vintage Rose Flower And Bird Wall Sticker PVC Printed Watercolor Floral Wall Decal For Bedroom Living Room Decor
like
Find Similar
Detailed dimensions of the floral wall sticker with roses and bird for home decoration - 40x60cm (fun-e178)
Vintage Rose Flower And Bird Wall Sticker PVC Printed Watercolor Floral Wall Decal For Bedroom Living Room Decor
$1.44
No MOQ
Morandi Red Pink Heart Wall Stickers Removable PVC Self Adhesive Heart Decals For Valentine's Day Bedroom Home Decor Accessory
Morandi Red Pink Heart Wall Stickers Removable PVC Self Adhesive Heart Decals For Valentine's Day Bedroom Home Decor Accessory
like
Find Similar
Detailed size specification for Morandi heart wall stickers with precise dimensions - Heart Combination (DC32013) / 30x20cm (2 Sheets)
Morandi Red Pink Heart Wall Stickers Removable PVC Self Adhesive Heart Decals For Valentine's Day Bedroom Home Decor Accessory
$0.62
No MOQ
Vintage Floral Bird Wall Stickers Removable PVC Decals For Bedroom Bathroom Kitchen Cabinet Door Naturalist Home Decor
Vintage Floral Bird Wall Stickers Removable PVC Decals For Bedroom Bathroom Kitchen Cabinet Door Naturalist Home Decor
like
Find Similar
1 option
Vintage Floral Bird Wall Stickers Removable PVC Decals For Bedroom Bathroom Kitchen Cabinet Door Naturalist Home Decor
$1.21
No MOQ
Modern Silent Wall Clock Large 3D Stereo Arabic Numerals Quartz Movement Plastic Round Decorative Home Office
Modern Silent Wall Clock Large 3D Stereo Arabic Numerals Quartz Movement Plastic Round Decorative Home Office
like
Find Similar
White 12-inch wall clock with 3D black numerals and silent quartz movement - White
+5
Modern Silent Wall Clock Large 3D Stereo Arabic Numerals Quartz Movement Plastic Round Decorative Home Office
$5.42
Mix MOQ : 2
Watercolor Rainbow Inspirational Quotes Wall Stickers For Kids Room Classroom PVC Cartoon Positive Motto Wall Decals Home Decor
Watercolor Rainbow Inspirational Quotes Wall Stickers For Kids Room Classroom PVC Cartoon Positive Motto Wall Decals Home Decor
like
Find Similar
Detailed dimension chart showing 6 pieces of inspirational wall stickers in 20x30cm size - 20x30cm*6pcs / Colorful
Watercolor Rainbow Inspirational Quotes Wall Stickers For Kids Room Classroom PVC Cartoon Positive Motto Wall Decals Home Decor
$2.07
Mix MOQ : 2
Hello Lettering Wall Sticker PVC Modern Minimalist English Alphabet Quote Wall Decal For Living Room Bedroom Home Wall Art
Hello Lettering Wall Sticker PVC Modern Minimalist English Alphabet Quote Wall Decal For Living Room Bedroom Home Wall Art
like
Find Similar
Detailed size specification for Hello wall sticker measuring 60cm by 40cm for home decor - Black
Detailed 60x40cm layout plan for pink HELLO wall stickers in high-quality PVC material - Pink
Hello Lettering Wall Sticker PVC Modern Minimalist English Alphabet Quote Wall Decal For Living Room Bedroom Home Wall Art
-4%
$1.37
No MOQ
Modern Minimalist Black PVC Coffee Cup And Heart Wall Sticker Self Adhesive Removable Home Decor For Kitchen Coffee Shop
Modern Minimalist Black PVC Coffee Cup And Heart Wall Sticker Self Adhesive Removable Home Decor For Kitchen Coffee Shop
like
Find Similar
Detailed 27x60cm coffee cup and heart pattern vinyl wall sticker layout with text - 27*60cm
Modern Minimalist Black PVC Coffee Cup And Heart Wall Sticker Self Adhesive Removable Home Decor For Kitchen Coffee Shop
$0.72
No MOQ
Watercolor Floral Wall Stickers PVC Self Adhesive Flower Birds Butterflies Mural For Living Room Bedroom Bathroom Home Decoration
Watercolor Floral Wall Stickers PVC Self Adhesive Flower Birds Butterflies Mural For Living Room Bedroom Bathroom Home Decoration
like
Find Similar
Self-adhesive floral wall sticker with orange flowers and navy leaves, 40x30cm sheet size - 30*40cm
Detail view of bird and leaf wall sticker with 30x60cm dimensions and self-adhesive PVC - Bird and Hanging Branch Style (M20601) / 30*60cm
Detailed dimension guide for watercolor floral PVC wall decals measuring 40x30cm - 30*40cm
Detail showing dimensions of watercolor red rose wall stickers with colorful butterflies - Red Rose and Butterfly Style (M20614) / 30*40cm
+5
Watercolor Floral Wall Stickers PVC Self Adhesive Flower Birds Butterflies Mural For Living Room Bedroom Bathroom Home Decoration
$0.95-1.18
Mix MOQ : 2
Modern Minimalist Wall Clock Silent Quartz Non-Ticking Round Plastic Glass For Living Room Bedroom Office Home Decor
Modern Minimalist Wall Clock Silent Quartz Non-Ticking Round Plastic Glass For Living Room Bedroom Office Home Decor
like
Find Similar
Minimalist 12-inch wall clock with dark grey dial and white numbers for home decor - Gray
Minimalist 12-inch round wall clock featuring a bright blue dial and white frame - Blue
Modern 12-inch round wall clock with rose gold frame and 3D Arabic numerals - White Dial Rose Gold Digits
Minimalist 12-inch white wall clock with 3D silver numerals for home and living room decor - White Dial Plated Silver
+12
Modern Minimalist Wall Clock Silent Quartz Non-Ticking Round Plastic Glass For Living Room Bedroom Office Home Decor
$3.60
Mix MOQ : 2
Vintage Wooden Frame Glass Hourglass Sand Timer Retro Desktop Ornament Creative Handcrafted Quicksand Decor For Home Office Gift
Vintage Wooden Frame Glass Hourglass Sand Timer Retro Desktop Ornament Creative Handcrafted Quicksand Decor For Home Office Gift
like
Find Similar
Set of three vintage wooden sand timers with bronze, silver, and colored beads for desk decor - Multicolor Vintage Style / 70*70*120mm
Vintage Wooden Frame Glass Hourglass Sand Timer Retro Desktop Ornament Creative Handcrafted Quicksand Decor For Home Office Gift
$1.73
Mix MOQ : 2
 · 
11 sold recently
Hello Good Morning English Quote Wall Sticker Removable PVC Artistic Lettering Decal For Bedroom Living Room Home Decor
Hello Good Morning English Quote Wall Sticker Removable PVC Artistic Lettering Decal For Bedroom Living Room Home Decor
like
Find Similar
Detailed size specifications for Hello Good Morning adhesive bedroom wall decal stickers - 5.5*40CM
Hello Good Morning English Quote Wall Sticker Removable PVC Artistic Lettering Decal For Bedroom Living Room Home Decor
$0.40
No MOQ
Green Leaves Eucalyptus Wall Sticker With Inspirational Quotes Removable Waterproof PVC Decal For Living Room Home Decor
Green Leaves Eucalyptus Wall Sticker With Inspirational Quotes Removable Waterproof PVC Decal For Living Room Home Decor
like
Find Similar
1 option
Green Leaves Eucalyptus Wall Sticker With Inspirational Quotes Removable Waterproof PVC Decal For Living Room Home Decor
$1.73
No MOQ
Vintage Retro Globe Desk Clock Resin Earth Figurine Ornament With Roman Numerals Money Box Function For Home Office Decor
Vintage Retro Globe Desk Clock Resin Earth Figurine Ornament With Roman Numerals Money Box Function For Home Office Decor
like
Find Similar
Vintage globe desk clock with resin book base in blue and bronze finish - Sky Blue
Retro globe clock statue on book base in bronze finish for desk decor - Earthy Yellow
NewVintage Retro Globe Desk Clock Resin Earth Figurine Ornament With Roman Numerals Money Box Function For Home Office Decor
$5.48
Mix MOQ : 2
Round Wall Clock Silent Quartz Cartoon Animal Plastic Decorative Home Kids Room Nursery
Round Wall Clock Silent Quartz Cartoon Animal Plastic Decorative Home Kids Room Nursery
like
Find Similar
24 options
Round Wall Clock Silent Quartz Cartoon Animal Plastic Decorative Home Kids Room Nursery
$2.54
Mix MOQ : 2
Watercolor Flower Wall Sticker Bohemian Floral PVC Self Adhesive Vintage Home Decor For Kids Room Bedroom Living Room
Watercolor Flower Wall Sticker Bohemian Floral PVC Self Adhesive Vintage Home Decor For Kids Room Bedroom Living Room
like
Find Similar
Bohemian pink floral wall stickers set with dimensions 124x124cm for home decor - YD261 Floral Style / Large Layout
Watercolor Flower Wall Sticker Bohemian Floral PVC Self Adhesive Vintage Home Decor For Kids Room Bedroom Living Room
$1.87
Mix MOQ : 4
Go to

More in home & kitchen

Explore more in wall clocks, wall clocks, wall sticker clocks

wallplasticmetalkidsdesigndisplayhandsgoldtreehand accessory
roundliving room bedroomframe glasscoverglass mirrorsimplesteelsquarepvc wall stickermetal stainless steel

Ready to source like an insider

Get a direct line to the factory floor — no minimums, no middlemen, no guesswork.
iconReal factory pricing, no markup in betweeniconEvery order hand-inspected before it shipsicon5,000+ new products added daily
Get Inside Access