Everful

Wholesale transparent gift boxes

Factory-direct selection, vetted for quality and ready to order.

Sign Up
Transparent Gift Boxes

Find the perfect pieces: party gift bags, party favors, gift wrapping supplies and more

Popular collections in transparent gift boxes

All products in transparent gift boxes

filterShow Filters
Price Drop
Free Shipping
Best Seller
New Arrivals
Elegant Collapsible Gift Box Cardboard Ribbon Bow Gold Edge Matte Finishing For Birthday Wedding Holiday Party Favors
Elegant Collapsible Gift Box Cardboard Ribbon Bow Gold Edge Matte Finishing For Birthday Wedding Holiday Party Favors
like
Find Similar
Elegant white foldable gift box with gold-edged ribbon bow for jewelry and apparel packaging - White / 22.5*16*8.5cm
Foldable black gift box with gold-stitched ribbon bow for high-end luxury packaging - Black / 29*21*10.5cm
Pink foldable rectangular gift box with gold-edged silk bow ribbon and textured finish - Pink / 22.5*16*8.5cm
Light blue rectangular gift box with matching blue ribbon bow for packaging - Light Blue / 29*21*10.5cm
+9
Elegant Collapsible Gift Box Cardboard Ribbon Bow Gold Edge Matte Finishing For Birthday Wedding Holiday Party Favors
$2.01-3.60
No MOQ
 · 
115 sold recently
Pillow Gift Boxes Kraft Paper Candy Box With Clear Window For Wedding Party Favor Packaging Jewelry Display
Pillow Gift Boxes Kraft Paper Candy Box With Clear Window For Wedding Party Favor Packaging Jewelry Display
like
Find Similar
Set of two white pillow-shaped kraft gift boxes with transparent window for candy packaging - White
Brown kraft paper pillow gift box with transparent PVC window for wedding candy display - Kraft Color
Elegant black kraft paper pillow gift boxes with transparent window for wedding favors - Black
Pillow Gift Boxes Kraft Paper Candy Box With Clear Window For Wedding Party Favor Packaging Jewelry Display
$0.06
No MOQ
 · 
42 sold recently
House Shaped Kraft Paper Gift Box With Handle Hollow Window For Candy Cookies Packaging Wedding Party Favors Box
House Shaped Kraft Paper Gift Box With Handle Hollow Window For Candy Cookies Packaging Wedding Party Favors Box
like
Find Similar
Eco-friendly house-shaped kraft paper gift box with hollow windows and twine handle - 7.5*7.5*18cm / Original Color
House Shaped Kraft Paper Gift Box With Handle Hollow Window For Candy Cookies Packaging Wedding Party Favors Box
-4%
$0.21
No MOQ
 · 
100 sold recently
European Laser Cut Pearlescent Paper Gift Box Floral Bear Pattern Candy Packing Box With Ribbon For Wedding Party Favor
European Laser Cut Pearlescent Paper Gift Box Floral Bear Pattern Candy Packing Box With Ribbon For Wedding Party Favor
like
Find Similar
Detailed laser-cut white favor box with bear pattern and elegant white organza ribbon - White
Pink hollow bear paper candy box with white ribbon for wedding party favors and gifts - Pink
Detail of laser-cut golden favor box featuring intricate floral patterns and yellow silk ribbon - Reflective Gold
Detail of silver mirror hollow bear gift box with laser cut floral patterns and ribbon - Reflective Silver
+5
European Laser Cut Pearlescent Paper Gift Box Floral Bear Pattern Candy Packing Box With Ribbon For Wedding Party Favor
$0.13
Mix MOQ : 50
Laser Cut Shell Shape Wedding Favor Candy Box With Ribbon Pearlescent Paper Hollow Out Gift Box For Party Decorations
Laser Cut Shell Shape Wedding Favor Candy Box With Ribbon Pearlescent Paper Hollow Out Gift Box For Party Decorations
like
Find Similar
White shell shaped laser cut wedding favor box with an elegant white ribbon bow - White
Light blue shell-shaped laser-cut wedding favor box with a white silk ribbon bow - Pearl Pale Blue
Red laser-cut seashell candy favor box with matching ribbon for wedding celebrations - Pearlescent Red
Silver shell-shaped candy box with white ribbon bow for wedding favor packaging - Reflective Silver
+7
Laser Cut Shell Shape Wedding Favor Candy Box With Ribbon Pearlescent Paper Hollow Out Gift Box For Party Decorations
$0.13
Mix MOQ : 50
 · 
100 sold recently
Wedding Favor Candy Gift Case Triangular Paper Ribbon Bow Wooden Ring Sweet Wishes Party Souvenir Engagement Packaging
Wedding Favor Candy Gift Case Triangular Paper Ribbon Bow Wooden Ring Sweet Wishes Party Souvenir Engagement Packaging
like
Find Similar
Triangle red wedding gift box with wooden ring handle and sweet wishes golden text - Large+Wood Ring / Burgundy English Box+Burgundy Ribbon
Red triangular wedding candy box with fishtail ribbon and white ring handle - Wine-red English Box + Wine-red Fishtail Tulle / Large Size + Wooden Ring 17x10x10
Elegant burgundy wedding candy box with white handle, bow, and pearl pendant - Large+Wood Ring / Burgundy English Box+Burgundy Chiffon+Pearl+Pin
Elegant red wedding candy box with golden ring handle and large mesh bow decoration - Burgundy English Box + Burgundy Fishtail Veil + Wedding Plaque + Brooch / Large Size + Wooden Ring 17x10x10
+172
Wedding Favor Candy Gift Case Triangular Paper Ribbon Bow Wooden Ring Sweet Wishes Party Souvenir Engagement Packaging
$0.14-0.42
Mix MOQ : 2
 · 
398 sold recently
Envelope Flower Box Cardboard Foldable Gift Wrapping Case For Wedding Party Floral Arrangement Waterproof Striped Pattern
Envelope Flower Box Cardboard Foldable Gift Wrapping Case For Wedding Party Floral Arrangement Waterproof Striped Pattern
like
Find Similar
Pink and blue striped envelope flower box showing an open interior for gift packaging - Pink and Blue Stripes / 20x7x29.5CM
Pastel green vertical stripe envelope flower box with white polka dot interior lining - Beige Polka Dot / 20x7x29.5CM
Pink envelope floral paper gift box with interior stripe pattern for elegant bouquets - Pink Horizontal Stripes / 20x7x29.5CM
Pink and white striped envelope flower box for gift packaging with open interior structure - Pink Vertical Stripes / 20x7x29.5CM
+18
Envelope Flower Box Cardboard Foldable Gift Wrapping Case For Wedding Party Floral Arrangement Waterproof Striped Pattern
$0.72
Mix MOQ : 3
 · 
200 sold recently
Small European Style Heart Shaped Window Candy Boxes Paper Gift Packaging For Wedding Party Favors Foldable
Small European Style Heart Shaped Window Candy Boxes Paper Gift Packaging For Wedding Party Favors Foldable
like
Find Similar
Pink cube gift box with heart-shaped window for weddings and candy packaging - Pink
Silver gift box with heart-shaped PVC window for wedding favors and candy packing - Gray
White heart-shaped window favor box in high-quality paper for wedding candy - White
Small European Style Heart Shaped Window Candy Boxes Paper Gift Packaging For Wedding Party Favors Foldable
$0.06
Mix MOQ : 50
 · 
900 sold recently
European Hollow Laser Cut Flower Candy Gift Box With Ribbon Pearl Paper Wedding Party Favor Box For Chocolate Cookies
European Hollow Laser Cut Flower Candy Gift Box With Ribbon Pearl Paper Wedding Party Favor Box For Chocolate Cookies
like
Find Similar
Elegant white laser-cut gift box with floral patterns and satin ribbon for wedding favors - White
Hollow laser-cut light pink favor box with floral patterns and a white silk ribbon bow - Pink
Tiffany blue laser cut hollow gift candy box with delicate floral patterns and ribbon bow - Tiffany Blue
Purple laser-cut floral candy gift box with a matching sheer organza ribbon bow - Dark Purple
+4
European Hollow Laser Cut Flower Candy Gift Box With Ribbon Pearl Paper Wedding Party Favor Box For Chocolate Cookies
$0.13
Mix MOQ : 50
Free Shipping
Laser Cut Hollow Wedding Favor Candy Boxes Pearl Paper Heart Flower Gift Packaging Box With Ribbon For Anniversary Party
Laser Cut Hollow Wedding Favor Candy Boxes Pearl Paper Heart Flower Gift Packaging Box With Ribbon For Anniversary Party
like
Find Similar
Elegant red laser-cut candy gift box with floral patterns and a satin ribbon bow - Pearlescent Red
Close-up of laser-cut hollow floral candy box with light blue satin ribbon bow - Reflective Silver
Elegant white laser-cut hollow floral candy box with a white ribbon on wooden surface - White
Pink laser-cut wedding favor box with floral patterns and a matching organza ribbon bow - Pink
+6
Laser Cut Hollow Wedding Favor Candy Boxes Pearl Paper Heart Flower Gift Packaging Box With Ribbon For Anniversary Party
$0.13
Mix MOQ : 50
Laser Cut Star Pattern Wedding Favor Boxes With Ribbon Pearlescent Paper Candy Gift Box For Wedding Birthday Party Decoration
Laser Cut Star Pattern Wedding Favor Boxes With Ribbon Pearlescent Paper Candy Gift Box For Wedding Birthday Party Decoration
like
Find Similar
Red laser-cut gift box with hollow star design and ribbon for festive parties - Pearlescent Red
Detailed laser-cut silver star candy box with elegant white organza ribbon bow - Reflective Silver
Laser-cut white gift box with star patterns and a silk ribbon for wedding party favors - White
Pink laser-cut star gift box with pink organza ribbon for parties and celebrations - Pink
+3
Laser Cut Star Pattern Wedding Favor Boxes With Ribbon Pearlescent Paper Candy Gift Box For Wedding Birthday Party Decoration
$0.12
Mix MOQ : 50
Laser Cut Snowflake Candy Box With Ribbon Pearlescent Cardstock Wedding Party Favor Gift Box Christmas Treat Holder
Laser Cut Snowflake Candy Box With Ribbon Pearlescent Cardstock Wedding Party Favor Gift Box Christmas Treat Holder
like
Find Similar
White laser-cut snowflake Christmas paper gift box with a white organza ribbon bow - White
Pink snowflake laser cut candy box with white organza ribbon for Christmas parties - Pink
Light blue snowflake laser-cut gift box with ribbon for Christmas and parties - Tiffany Blue
Macro shot of gold laser-cut snowflake gift box with an elegant chiffon ribbon bow - Gold
+5
Laser Cut Snowflake Candy Box With Ribbon Pearlescent Cardstock Wedding Party Favor Gift Box Christmas Treat Holder
$0.13
Mix MOQ : 50
Elegant Laser Cut Hollow Heart Floral Candy Box With Ribbon Bow Pearlescent Paper Gift Box For Wedding Valentine Day Party Favor
Elegant Laser Cut Hollow Heart Floral Candy Box With Ribbon Bow Pearlescent Paper Gift Box For Wedding Valentine Day Party Favor
like
Find Similar
Macro view of red laser-cut candy box with floral patterns and a translucent ribbon bow - Pearlescent Red
Elegant silver laser-cut wedding favor box with a light blue silk ribbon and floral hollow design - Reflective Silver
White laser-cut floral wedding favor box with an elegant organza ribbon and bow - White
Macro detail of laser-cut floral pattern on pink wedding candy box with ribbon bow - Pink
+6
Elegant Laser Cut Hollow Heart Floral Candy Box With Ribbon Bow Pearlescent Paper Gift Box For Wedding Valentine Day Party Favor
$0.14
Mix MOQ : 50
European Laser Cut Pearlescent Paper Candy Box With Ribbon Bow Hollow Floral Favor Boxes For Wedding Party Gift Packaging
European Laser Cut Pearlescent Paper Candy Box With Ribbon Bow Hollow Floral Favor Boxes For Wedding Party Gift Packaging
like
Find Similar
Elegant white laser cut wedding favor box with ornate floral patterns and ribbon - White
Pink laser-cut candy gift box with hollow floral patterns and silk ribbon bow - Pink
Detailed laser-cut pattern on light blue candy gift box with elegant organza ribbon - Turquoise Blue
Detail of red hollow gift box with laser-cut floral patterns and a red organza ribbon bow - Pearlescent Red
+5
NewEuropean Laser Cut Pearlescent Paper Candy Box With Ribbon Bow Hollow Floral Favor Boxes For Wedding Party Gift Packaging
$0.13
Mix MOQ : 50
Elegant Laser Cut Floral Heart Pearlescent Paper Wedding Favor Boxes Ribbon Bow Candy Gift Boxes For Party Celebration
Elegant Laser Cut Floral Heart Pearlescent Paper Wedding Favor Boxes Ribbon Bow Candy Gift Boxes For Party Celebration
like
Find Similar
Elegant white laser-cut favor box with heart patterns and silk ribbon for weddings - 6*6*8CM / White
Close-up of white laser-cut wedding candy box with intricate heart pattern and satin bow - 6*6*8CM / Ivory
Close-up of pink laser-cut favor box with floral patterns and a white organza ribbon bow - 6*6*8CM / Pink
Detailed laser-cut floral pattern on light blue gift box with a white organza ribbon bow - 6*6*8CM / Pearl Pale Blue
+6
Elegant Laser Cut Floral Heart Pearlescent Paper Wedding Favor Boxes Ribbon Bow Candy Gift Boxes For Party Celebration
$0.16
Mix MOQ : 50
 · 
50 sold recently
Laser Cut Eid Mubarak Candy Box Pearlescent Paper Wedding Party Favor Gift Box With Ribbon Rose Floral Pattern Hollow Decoration
Laser Cut Eid Mubarak Candy Box Pearlescent Paper Wedding Party Favor Gift Box With Ribbon Rose Floral Pattern Hollow Decoration
like
Find Similar
7 options
Laser Cut Eid Mubarak Candy Box Pearlescent Paper Wedding Party Favor Gift Box With Ribbon Rose Floral Pattern Hollow Decoration
$0.17
Mix MOQ : 50
Laser Cut Pearlescent Paper Wedding Candy Favor Boxes With Ribbons Floral Hollow Gift Box For Marriage Party Celebration
Laser Cut Pearlescent Paper Wedding Candy Favor Boxes With Ribbons Floral Hollow Gift Box For Marriage Party Celebration
like
Find Similar
Elegant red laser-cut candy box with floral patterns and a ribbon for wedding favors - Pearlescent Red
Detailed laser-cut silver wedding favor box with blue ribbon and elegant floral patterns - Reflective Silver
Elegant white laser-cut floral candy box with a sheer ribbon bow on a dark wood base - White
Pink laser-cut wedding favor box with elegant floral patterns and a white silk ribbon bow - Pink
+6
Laser Cut Pearlescent Paper Wedding Candy Favor Boxes With Ribbons Floral Hollow Gift Box For Marriage Party Celebration
$0.13
Mix MOQ : 50
European Laser Cut Love Heart Pearlescent Paper Candy Box Hollow Out Gift Box For Wedding Valentine's Day Party Favors Decorations
European Laser Cut Love Heart Pearlescent Paper Candy Box Hollow Out Gift Box For Wedding Valentine's Day Party Favors Decorations
like
Find Similar
Elegant white and gold LOVE heart laser cut candy boxes for romantic wedding parties - White / 5*5cm
Pink laser-cut gold foil gift box with floral patterns and Love inscription - Pink / 5*5cm
Detail of light blue triangular candy box featuring golden Love lettering and hollow pattern - Pearl Pale Blue / 5*5cm
Elegant light blue hollow-out LOVE candy box with gold mirror lining for party favors - Tiffany Blue / 5*5cm
+3
European Laser Cut Love Heart Pearlescent Paper Candy Box Hollow Out Gift Box For Wedding Valentine's Day Party Favors Decorations
$0.17
Mix MOQ : 50
European Laser Cut Snowflake Hollow Candy Box Pearlescent Paper Gift Packaging Box With Ribbon For Wedding Christmas Party Favors
European Laser Cut Snowflake Hollow Candy Box Pearlescent Paper Gift Packaging Box With Ribbon For Wedding Christmas Party Favors
like
Find Similar
Elegant white laser-cut snowflake candy gift box with white ribbon bow for Christmas - White
Detailed laser-cut red snowflake gift box with matching organza ribbon bow for Christmas - Pearlescent Red
Silver snowflake hollow candy gift box with light blue satin bow for winter wedding - Reflective Silver
Close-up of laser-cut snowflake patterns and ribbon on this pink wedding favor box - Pink
+4
European Laser Cut Snowflake Hollow Candy Box Pearlescent Paper Gift Packaging Box With Ribbon For Wedding Christmas Party Favors
$0.13
Mix MOQ : 50
Laser Cut Hollow Wedding Candy Boxes Pearlescent Paper Gift Box With Ribbon For Party Chocolate Favors Decorations
Laser Cut Hollow Wedding Candy Boxes Pearlescent Paper Gift Box With Ribbon For Party Chocolate Favors Decorations
like
Find Similar
Detailed laser-cut floral wedding favor box in red cardstock with organza ribbon bow - Pearlescent Red
Macro shot of silver laser-cut floral favor box with a light blue translucent ribbon bow - Reflective Silver
White laser cut floral paper favor box with white organza ribbon for wedding gifts - White
Macro detail of pink laser-cut wedding favor box with white ribbon bow and floral hollows - Pink
+6
NewLaser Cut Hollow Wedding Candy Boxes Pearlescent Paper Gift Box With Ribbon For Party Chocolate Favors Decorations
$0.13
Mix MOQ : 50
Laser Cut European Hollow Candy Box With Ribbon Letter E Pearlescent Paper Gift Wrapping Box For Wedding Birthday Party Favors
Laser Cut European Hollow Candy Box With Ribbon Letter E Pearlescent Paper Gift Wrapping Box For Wedding Birthday Party Favors
like
Find Similar
8 options
Laser Cut European Hollow Candy Box With Ribbon Letter E Pearlescent Paper Gift Wrapping Box For Wedding Birthday Party Favors
$0.13
Mix MOQ : 50
Laser Cut Paper Candy Box Hollow Wedding Favor Gift Boxes With Ribbon European Style For Party Chocolate Packaging
Laser Cut Paper Candy Box Hollow Wedding Favor Gift Boxes With Ribbon European Style For Party Chocolate Packaging
like
Find Similar
Elegant laser-cut wedding favor box in white with scroll patterns and chiffon ribbon - White
Detail of red laser-cut wedding candy box with elegant scroll pattern and silk ribbon bow - Pearlescent Red
Elegant laser-cut pink wedding favor box with ribbon on decorative white tray - Pink
Detail of laser-cut wedding candy box with hollow floral pattern and yellow ribbon - Gold
+4
Laser Cut Paper Candy Box Hollow Wedding Favor Gift Boxes With Ribbon European Style For Party Chocolate Packaging
$0.13
Mix MOQ : 50
Laser Cut Princess Dress Candy Box Glitter Paper Floral Hollow Out Gift Box With Ribbon Bow For Wedding Party Favors
Laser Cut Princess Dress Candy Box Glitter Paper Floral Hollow Out Gift Box With Ribbon Bow For Wedding Party Favors
like
Find Similar
Laser-cut gold glitter paper candy box in elegant princess dress shape with pink ribbon - Thick Rich Gold 93#
Close-up of laser-cut glitter silver candy box with elegant floral hollow pattern - Thick Silver 91#
Detail of laser-cut gold glitter wedding candy box in princess dress shape with silk bow - Light Gold 42#
Detailed laser-cut rose gold glitter gift box in princess dress shape with organza bow - Thick Champagne 96#
+3
Laser Cut Princess Dress Candy Box Glitter Paper Floral Hollow Out Gift Box With Ribbon Bow For Wedding Party Favors
$0.14
Mix MOQ : 50
Laser Cut Star Hollow Pearlescent Paper Candy Box With Ribbon Bowknot For Wedding Birthday Party Gift Packaging Favor Case
Laser Cut Star Hollow Pearlescent Paper Candy Box With Ribbon Bowknot For Wedding Birthday Party Gift Packaging Favor Case
like
Find Similar
Golden hollow star candy gift box with elegant organza ribbon for festive celebrations - Reflective Gold
Silver hollow star candy gift box with white organza bow for wedding party favors - Reflective Silver
Laser Cut Star Hollow Pearlescent Paper Candy Box With Ribbon Bowknot For Wedding Birthday Party Gift Packaging Favor Case
$0.13
Mix MOQ : 50
Laser Cut Heart Love Pearl Paper Candy Favor Box For Wedding Party Valentine Gift Packaging Decoration Ribbon Folding Box
Laser Cut Heart Love Pearl Paper Candy Favor Box For Wedding Party Valentine Gift Packaging Decoration Ribbon Folding Box
like
Find Similar
Macro shot of silver pearl paper favor box with laser-cut Love motif and organza ribbon - Reflective Silver
Elegant white laser-cut LOVE candy box with ribbon for wedding party gift packaging - White
Pink laser cut wedding favor box with Love heart pattern and white organza ribbon - Pink
Detailed laser-cut pearl paper wedding candy box with Love heart design and white ribbon - Jewelry Cream Star
+5
Laser Cut Heart Love Pearl Paper Candy Favor Box For Wedding Party Valentine Gift Packaging Decoration Ribbon Folding Box
$0.13
Mix MOQ : 50
Laser Cut Wedding Favor Boxes Hollow Heart Design Pearlescent Paper Candy Box With Ribbon For Wedding Party Souvenirs Gift Wrap
Laser Cut Wedding Favor Boxes Hollow Heart Design Pearlescent Paper Candy Box With Ribbon For Wedding Party Souvenirs Gift Wrap
like
Find Similar
Elegant white laser-cut favor box with heart patterns and silk ribbon for weddings - White
Close-up of white laser-cut wedding candy box with intricate heart pattern and satin bow - Ivory
Close-up of pink laser-cut favor box with floral patterns and a white organza ribbon bow - Pink
Detailed laser-cut floral pattern on light blue gift box with a white organza ribbon bow - Pearl Pale Blue
+6
Laser Cut Wedding Favor Boxes Hollow Heart Design Pearlescent Paper Candy Box With Ribbon For Wedding Party Souvenirs Gift Wrap
$0.16
Mix MOQ : 50
Elegant Laser Cut Wedding Favor Boxes Heart Champagne Glass Paper Candy Gift Box With Ribbon For Bridal Shower Birthday Party
Elegant Laser Cut Wedding Favor Boxes Heart Champagne Glass Paper Candy Gift Box With Ribbon For Bridal Shower Birthday Party
like
Find Similar
Detail of red laser-cut favor box with vine hollow patterns and decorative silk ribbon - Pearlescent Red
Macro shot of silver hollow gift box with blue ribbon bow for wedding celebrations - Reflective Silver
Pink laser cut wedding favor box with champagne glass design and elegant silk ribbon bow - Pink
Golden laser-cut gift box featuring intricate vine patterns and a silk ribbon bow - Gold
+6
Elegant Laser Cut Wedding Favor Boxes Heart Champagne Glass Paper Candy Gift Box With Ribbon For Bridal Shower Birthday Party
$0.13
Mix MOQ : 50
Hollow Heart Laser Cut Wedding Candy Box Pearlescent Paper Chocolate Gift Packaging With Ribbon For Valentine Day Party
Hollow Heart Laser Cut Wedding Candy Box Pearlescent Paper Chocolate Gift Packaging With Ribbon For Valentine Day Party
like
Find Similar
Silver laser-cut heart favor box for weddings with a soft blue silk ribbon bow - Reflective Silver
White laser-cut wedding favor box with hollow heart patterns and white organza ribbon bow - White
Detailed laser-cut heart candy box in pink pearlescent paper with an organza ribbon bow - Pink
Macro view of gold laser-cut heart pattern gift box with elegant yellow organza ribbon - Gold Yellow
+18
Hollow Heart Laser Cut Wedding Candy Box Pearlescent Paper Chocolate Gift Packaging With Ribbon For Valentine Day Party
$0.13
Mix MOQ : 50
European Style Laser Cut Hollow Out Paper Gift Box With Ribbon And Thank You Tag For Wedding Party Candy Packaging Favor Box
European Style Laser Cut Hollow Out Paper Gift Box With Ribbon And Thank You Tag For Wedding Party Candy Packaging Favor Box
like
Find Similar
Close-up of white laser-cut candy box with elegant ribbon and thank you tag - White
Detail of pink laser-cut gift box with floral pattern, pink ribbon and thank you card - Pink
Laser-cut light blue candy box with floral patterns and a Thank You gift tag - Pearl Pale Blue
Golden laser-cut hollow gift box with Thank You tag and organza ribbon for party favors - Beige Gold
European Style Laser Cut Hollow Out Paper Gift Box With Ribbon And Thank You Tag For Wedding Party Candy Packaging Favor Box
$0.14
Mix MOQ : 50
Laser Cut Hollow Candy Box Pearlescent Paper European Style Wedding Gift Box With Ribbon Bow For Party Chocolate Packaging
Laser Cut Hollow Candy Box Pearlescent Paper European Style Wedding Gift Box With Ribbon Bow For Party Chocolate Packaging
like
Find Similar
White laser cut wedding candy box with geometric pattern and white organza ribbon bow - White
Macro view of ivory laser-cut candy box with geometric patterns and sheer organza ribbon - Ivory
Pink laser cut hollow candy gift box with elegant ribbon bow for wedding party favors - Pink
Close-up of laser-cut window pattern on Tiffany blue gift box with ribbon bow - Tiffany Blue
+6
Laser Cut Hollow Candy Box Pearlescent Paper European Style Wedding Gift Box With Ribbon Bow For Party Chocolate Packaging
$0.13
Mix MOQ : 50
Laser Cut Heart Candy Box Pearlescent Paper Favor Box With Ribbon Hollow Gift Boxes For Wedding Party Baptism Packaging
Laser Cut Heart Candy Box Pearlescent Paper Favor Box With Ribbon Hollow Gift Boxes For Wedding Party Baptism Packaging
like
Find Similar
11 options
Laser Cut Heart Candy Box Pearlescent Paper Favor Box With Ribbon Hollow Gift Boxes For Wedding Party Baptism Packaging
$0.13
Mix MOQ : 50
Laser Cut Wedding Favor Box Bride And Groom Silhouette Candy Box With Ribbon Hollow Gift Boxes For Marriage Celebration
Laser Cut Wedding Favor Box Bride And Groom Silhouette Candy Box With Ribbon Hollow Gift Boxes For Marriage Celebration
like
Find Similar
Elegant laser-cut white wedding favor box with romantic silhouette and organza ribbon - White
Detailed laser-cut heart candy box with white ribbon for wedding favors - Ivory
Detail of light blue laser-cut wedding candy box with heart pattern and white ribbon - Pearl Pale Blue
Detailed laser cut light blue favor box with bride and groom silhouette and white ribbon - Tiffany Blue
+5
Laser Cut Wedding Favor Box Bride And Groom Silhouette Candy Box With Ribbon Hollow Gift Boxes For Marriage Celebration
$0.13
Mix MOQ : 50
Elegant Laser Cut Floral Wedding Favor Boxes With Ribbon Bow Pearlescent Paper Candy Gift Box For Reception Party Decoration
Elegant Laser Cut Floral Wedding Favor Boxes With Ribbon Bow Pearlescent Paper Candy Gift Box For Reception Party Decoration
like
Find Similar
Elegant white laser-cut floral favor box with a delicate white ribbon for weddings - White
Elegant purple laser-cut floral gift box with matching silk ribbon for weddings - Dark Purple
Pink laser cut floral wedding favor box with a white ribbon bow for candies - Pink
Red laser-cut hollow floral wedding favor box with a delicate silk ribbon bow - Pearlescent Red
+5
Elegant Laser Cut Floral Wedding Favor Boxes With Ribbon Bow Pearlescent Paper Candy Gift Box For Reception Party Decoration
$0.15
Mix MOQ : 50
Laser Cut Butterfly Wedding Favor Candy Box Romantic Hollow Out Paper Gift Packaging With Ribbon For Birthday Party Decor
Laser Cut Butterfly Wedding Favor Candy Box Romantic Hollow Out Paper Gift Packaging With Ribbon For Birthday Party Decor
like
Find Similar
Elegant red laser-cut butterfly gift box with matching red chiffon ribbon bow - Red
Silver laser-cut butterfly favor box with white satin ribbon and metallic finish - Reflective Silver
Elegant white laser-cut butterfly candy box with a decorative translucent silk ribbon - White
Pink laser-cut butterfly gift box for weddings with matching translucent ribbon bow - Pink
+15
Laser Cut Butterfly Wedding Favor Candy Box Romantic Hollow Out Paper Gift Packaging With Ribbon For Birthday Party Decor
$0.14
Mix MOQ : 50
Laser Cut Hollow Heart Candy Box Pearlescent Paper Gift Box For Wedding Party Favor Chocolate Treat Packaging Box Holder
Laser Cut Hollow Heart Candy Box Pearlescent Paper Gift Box For Wedding Party Favor Chocolate Treat Packaging Box Holder
like
Find Similar
13 options
Laser Cut Hollow Heart Candy Box Pearlescent Paper Gift Box For Wedding Party Favor Chocolate Treat Packaging Box Holder
-5%
$0.16
Mix MOQ : 50
Laser Cut Heart Hollow Candy Box Pearlescent Paper Wedding Party Favor Gift Box With Ribbon Bow Packaging
Laser Cut Heart Hollow Candy Box Pearlescent Paper Wedding Party Favor Gift Box With Ribbon Bow Packaging
like
Find Similar
Macro detail of laser-cut heart pattern on silver favor box with blue satin ribbon - Reflective Silver
White hollow heart candy box with pearl paper texture and white organza ribbon - White
Detail of gold laser-cut heart candy box with glossy finish and matching silk ribbon - Reflective Gold
Macro shot of off-white laser-cut heart favor box with a translucent white silk ribbon - Ivory
+12
Laser Cut Heart Hollow Candy Box Pearlescent Paper Wedding Party Favor Gift Box With Ribbon Bow Packaging
$0.13
Mix MOQ : 50
European Laser Cut Hollow Wedding Favor Box Heart Shape Couple Silhouette Pearlescent Paper Candy Box With Ribbon For Party
European Laser Cut Hollow Wedding Favor Box Heart Shape Couple Silhouette Pearlescent Paper Candy Box With Ribbon For Party
like
Find Similar
Elegant white laser-cut wedding favor box with bride groom silhouette and ribbon - White
Close-up of white laser-cut wedding favor box with organza ribbon and couple silhouette - Ivory
Pink heart laser cut wedding favor box with silhouette design and white ribbon bow - Pink
Hollow laser cut wedding candy box in gold mirror finish with bride and groom silhouette - Reflective Gold
+6
European Laser Cut Hollow Wedding Favor Box Heart Shape Couple Silhouette Pearlescent Paper Candy Box With Ribbon For Party
$0.13
Mix MOQ : 50
Laser Cut Teddy Bear Hollow Candy Box With Ribbon Bow For Wedding Party Birthday Baby Shower Gift Paper Packaging Box
Laser Cut Teddy Bear Hollow Candy Box With Ribbon Bow For Wedding Party Birthday Baby Shower Gift Paper Packaging Box
like
Find Similar
Elegant white laser-cut teddy bear paper candy box with silver ribbon for party favors - White
Pink laser-cut bear candy box made of thick cardstock with a white organza ribbon bow - Pink
Elegant purple hollow bear favor box with matching silk ribbon bow for party treats - Dark Purple
Cute light blue hollow bear candy box with ribbon for party favors and baby showers - Tiffany Blue
+7
Laser Cut Teddy Bear Hollow Candy Box With Ribbon Bow For Wedding Party Birthday Baby Shower Gift Paper Packaging Box
$0.13
Mix MOQ : 50
Snowflake Laser Cut Candy Box Wedding Christmas Party Gift Box For Chocolate Candy Pearl Paper Hollow Out Decorative Gift Packaging
Snowflake Laser Cut Candy Box Wedding Christmas Party Gift Box For Chocolate Candy Pearl Paper Hollow Out Decorative Gift Packaging
like
Find Similar
Golden laser-cut snowflake candy box with metallic finish for Christmas party favors - Reflective Gold
Silver rectangular gift box featuring a laser-cut snowflake design on a white plate - Reflective Silver
White laser-cut snowflake gift box with gold interior and luxury party favors - White
Detail of pink laser-cut snowflake gift box with window and gold metallic side - Pink
+3
Snowflake Laser Cut Candy Box Wedding Christmas Party Gift Box For Chocolate Candy Pearl Paper Hollow Out Decorative Gift Packaging
$0.18
Mix MOQ : 50
Glitter Hollow Out Princess Silhouette Wedding Candy Boxes With Ribbon Elegant Party Favor Gift Boxes For Birthday Celebration
Glitter Hollow Out Princess Silhouette Wedding Candy Boxes With Ribbon Elegant Party Favor Gift Boxes For Birthday Celebration
like
Find Similar
Golden glitter party favor box in elegant princess dress shape with satin bow decoration - Thick Rich Gold 93#
Silver glitter hollow lace favor box in dress shape with light blue ribbon for wedding party - Thick Silver 91#
Close-up of golden laser-cut gown candy box with glitter finish and chiffon bow - Light Gold 42#
Rose gold laser-cut favor box in ball gown shape with glitter finish and ribbon - Thick Champagne 96#
+3
Glitter Hollow Out Princess Silhouette Wedding Candy Boxes With Ribbon Elegant Party Favor Gift Boxes For Birthday Celebration
$0.14
Mix MOQ : 50
Laser Cut It's A Girl Baby Shower Candy Box Stroller Heart Design Pearlescent Paper Gift Box For Newborn Birthday Party Favors
Laser Cut It's A Girl Baby Shower Candy Box Stroller Heart Design Pearlescent Paper Gift Box For Newborn Birthday Party Favors
like
Find Similar
White laser cut baby carriage favor box with It's A Girl text and organza ribbon bow - White
Detailed laser-cut pink gift box with It's A Girl text and ribbon for baby shower party - Pink
Detailed laser cut gold candy box featuring It's A Girl text and organza ribbon bow - Gold
Laser cut yellow It's A Girl baby shower gift box with stroller design and organza bow - Lemon Yellow
+6
Laser Cut It's A Girl Baby Shower Candy Box Stroller Heart Design Pearlescent Paper Gift Box For Newborn Birthday Party Favors
$0.13
Mix MOQ : 50
Elegant Laser Cut Flower Hollow Candy Box For Wedding Party Favor Gift Packaging Paper Box With Ribbon Bowknot
Elegant Laser Cut Flower Hollow Candy Box For Wedding Party Favor Gift Packaging Paper Box With Ribbon Bowknot
like
Find Similar
Elegant white laser-cut wedding favor box with floral patterns and a silk ribbon bow - White
Laser-cut white wedding favor box with floral hollow patterns and white chiffon ribbon bow - Ivory
Pink laser-cut candy box with elegant floral hollow patterns and white ribbon bow - Pink
Detail of light blue laser-cut favor box with intricate floral patterns and ribbon bow - Pearl Pale Blue
+4
Elegant Laser Cut Flower Hollow Candy Box For Wedding Party Favor Gift Packaging Paper Box With Ribbon Bowknot
$0.16
Mix MOQ : 50
Laser Cut Leaf Design Pearlescent Paper Wedding Candy Box With Ribbon Bow Hollow Out Gift Favor Packaging Case Party Decor
Laser Cut Leaf Design Pearlescent Paper Wedding Candy Box With Ribbon Bow Hollow Out Gift Favor Packaging Case Party Decor
like
Find Similar
Elegant white laser-cut leaf pattern candy box with a delicate organza ribbon bow - White
White laser-cut leaf gift box with pearl paper finish and silk ribbon for wedding candy - Ivory
Pink laser-cut wedding candy box with leaf pattern and elegant ribbon bow detail - Pink
Detailed laser-cut leaf pattern on yellow pearlescent gift box with organza ribbon - Gold
+4
Laser Cut Leaf Design Pearlescent Paper Wedding Candy Box With Ribbon Bow Hollow Out Gift Favor Packaging Case Party Decor
-7%
$0.12
Mix MOQ : 50
Laser Cut Star Hollow Wedding Candy Box Gold Silver Pearlescent Paper Gift Box With Ribbon For Birthday Party Favor Decoration
Laser Cut Star Hollow Wedding Candy Box Gold Silver Pearlescent Paper Gift Box With Ribbon For Birthday Party Favor Decoration
like
Find Similar
Golden laser-cut star favor box with orange ribbon bow for holiday celebrations - Gold
Silver laser-cut star pattern gift box with a light blue ribbon bow for celebrations - Silver
Laser Cut Star Hollow Wedding Candy Box Gold Silver Pearlescent Paper Gift Box With Ribbon For Birthday Party Favor Decoration
$0.13
Mix MOQ : 50
Elegant Laser Cut Butterfly Pearlescent Paper Candy Box For Wedding Party Favor Chocolate Gift Box Packaging With Ribbon
Elegant Laser Cut Butterfly Pearlescent Paper Candy Box For Wedding Party Favor Chocolate Gift Box Packaging With Ribbon
like
Find Similar
Elegant white laser-cut butterfly favor box with a pearl finish and white satin ribbon bow - White
Pink laser cut butterfly gift box with white organza ribbon for weddings and parties - Pink
Elegant light blue laser-cut butterfly candy gift box with a silk ribbon bow and pearl paper - Tiffany Blue
Elegant red laser-cut butterfly favor box with ribbon bow for weddings and parties - Pearlescent Red
+3
NewElegant Laser Cut Butterfly Pearlescent Paper Candy Box For Wedding Party Favor Chocolate Gift Box Packaging With Ribbon
$0.13
Mix MOQ : 50
Laser Cut Tropical Leaf Favor Box Hollow Paper Candy Box With Ribbon Bow For Wedding Party Thanksgiving Gift Packaging
Laser Cut Tropical Leaf Favor Box Hollow Paper Candy Box With Ribbon Bow For Wedding Party Thanksgiving Gift Packaging
like
Find Similar
Macro detail of laser-cut tropical leaf patterns on a white wedding favor gift box - White
Macro shot of ivory laser-cut gift box with tropical leaf patterns and white organza ribbon - Ivory
Close-up of pink laser-cut candy box with tropical leaf pattern and white organza ribbon - Pink
Close-up of laser-cut tropical leaf patterns on a mint green party favor gift box - Tiffany Blue
+7
Laser Cut Tropical Leaf Favor Box Hollow Paper Candy Box With Ribbon Bow For Wedding Party Thanksgiving Gift Packaging
$0.13
Mix MOQ : 50
European Laser Cut Hollow Floral Candy Box With Ribbon Bow Elegant Wedding Favor Gift Boxes For Party Celebration
European Laser Cut Hollow Floral Candy Box With Ribbon Bow Elegant Wedding Favor Gift Boxes For Party Celebration
like
Find Similar
Elegant white laser-cut wedding favor box with floral patterns and a satin ribbon bow - White
Detail view of light blue laser-cut wedding candy box with elegant floral hollow pattern - Pearl Pale Blue
Laser-cut light blue wedding favor box with floral patterns and matching ribbon bow - Pearl Turquoise Blue
Macro view of laser-cut floral patterns on pink pearlescent wedding favor box with ribbon - Pink
+4
European Laser Cut Hollow Floral Candy Box With Ribbon Bow Elegant Wedding Favor Gift Boxes For Party Celebration
$0.13
Mix MOQ : 50
Laser Cut Pearlescent Paper Favor Box With Ribbon European Hollow Flower Candy Gift Box For Wedding Party Celebration
Laser Cut Pearlescent Paper Favor Box With Ribbon European Hollow Flower Candy Gift Box For Wedding Party Celebration
like
Find Similar
White laser cut lace wedding favor box with ribbon on wooden surface for party candy - White
Elegant cream laser-cut wedding favor box with lace patterns and silk ribbon bow - Ivory
Golden laser-cut wedding favor box with floral patterns and a matching silk ribbon bow - Gold
Elegant purple laser-cut lace candy box with ribbon for wedding and party favors - Dark Purple
+6
NewLaser Cut Pearlescent Paper Favor Box With Ribbon European Hollow Flower Candy Gift Box For Wedding Party Celebration
-7%
$0.12
Mix MOQ : 50
Butterfly Laser Cut Candy Box Pearl Paper Hollow Favor Gift Box With Ribbon For Wedding Party Celebration Decorations
Butterfly Laser Cut Candy Box Pearl Paper Hollow Favor Gift Box With Ribbon For Wedding Party Celebration Decorations
like
Find Similar
Elegant white laser-cut butterfly wedding favor box with silk ribbon decoration - White
Elegant pink laser cut butterfly candy box with white ribbon bow for wedding gifts - Pink
Elegant gold butterfly laser cut gift box with floral pattern and golden organza ribbon - Gold Yellow
Elegant light blue laser-cut butterfly wedding favor box with a delicate ribbon bow - Tiffany Blue
+5
NewButterfly Laser Cut Candy Box Pearl Paper Hollow Favor Gift Box With Ribbon For Wedding Party Celebration Decorations
-7%
$0.13
Mix MOQ : 50
Laser Cut Hollow Wedding Favor Boxes With Ribbon Pearlescent Paper Floral Candy Gift Box For Engagement Party Decorations
Laser Cut Hollow Wedding Favor Boxes With Ribbon Pearlescent Paper Floral Candy Gift Box For Engagement Party Decorations
like
Find Similar
Elegant red laser-cut lace candy box with silk ribbon for wedding party favors - Pearlescent Red
Close-up of silver laser-cut lace candy box with light blue silk ribbon and bow - Reflective Silver
Elegant white laser-cut wedding favor box with floral patterns and a white organza ribbon - White
Detail of pink laser-cut lace candy box featuring a delicate ribbon bow and floral pattern - Pink
+6
Laser Cut Hollow Wedding Favor Boxes With Ribbon Pearlescent Paper Floral Candy Gift Box For Engagement Party Decorations
$0.13
Mix MOQ : 50
European Laser Cut Heart Love Wedding Candy Box With Ribbon And Thank You Tag Pearlescent Paper Party Favor Gift Box
European Laser Cut Heart Love Wedding Candy Box With Ribbon And Thank You Tag Pearlescent Paper Party Favor Gift Box
like
Find Similar
White laser-cut heart favor box with LOVE engraving, ribbon and Thank You tag - White
Detail of white laser-cut LOVE candy box with ribbon and gold Thank You tag - Ivory
Pink laser-cut candy gift box with hollow LOVE letters, white ribbon and thank you tag - Pink
Close-up of golden hollow candy box with laser-cut LOVE heart design and thank you tag - Reflective Gold
+6
European Laser Cut Heart Love Wedding Candy Box With Ribbon And Thank You Tag Pearlescent Paper Party Favor Gift Box
-7%
$0.13
Mix MOQ : 50
Laser Cut Princess Dress Favor Boxes Hollow Paper Candy Gift Bags With Ribbon For Wedding Birthday Party Table Decorations
Laser Cut Princess Dress Favor Boxes Hollow Paper Candy Gift Bags With Ribbon For Wedding Birthday Party Table Decorations
like
Find Similar
Elegant white laser-cut wedding favor box with gown design and silver organza ribbon bow - White
Close-up of laser-cut wedding favor box in bridal dress shape with white ribbon - Ivory
Detail of pink princess-shaped laser-cut gift box with a white organza ribbon bow - Pink
Detailed laser-cut Tiffany blue princess dress gift box with white ribbon bow - Tiffany Blue
+7
Laser Cut Princess Dress Favor Boxes Hollow Paper Candy Gift Bags With Ribbon For Wedding Birthday Party Table Decorations
$0.14
Mix MOQ : 50
Laser Cut Butterfly Candy Boxes Pearlescent Paper Hollowed Favor Box With Ribbon For Wedding Party Birthday Gift Packaging
Laser Cut Butterfly Candy Boxes Pearlescent Paper Hollowed Favor Box With Ribbon For Wedding Party Birthday Gift Packaging
like
Find Similar
Elegant white laser-cut butterfly gift box with organza ribbon on dark wood surface - White
Pink laser cut butterfly candy box with ribbon for wedding and party favors - Pink
Golden laser-cut butterfly favor box with elegant silk ribbon for weddings and parties - Gold
Laser-cut butterfly candy box in vibrant tiffany blue with elegant silk ribbon bow - Tiffany Blue
+14
Laser Cut Butterfly Candy Boxes Pearlescent Paper Hollowed Favor Box With Ribbon For Wedding Party Birthday Gift Packaging
$0.13
Mix MOQ : 50
Elegant Laser Cut Pearlescent Paper Wedding Favor Boxes Filigree Hollow Candy Gift Boxes With Ribbons For Party Decoration
Elegant Laser Cut Pearlescent Paper Wedding Favor Boxes Filigree Hollow Candy Gift Boxes With Ribbons For Party Decoration
like
Find Similar
Elegant white laser-cut wedding candy box with a decorative ribbon bow and hollow patterns - White
Elegant off-white laser cut wedding candy box with intricate floral pattern and ribbon bow - Ivory
Pink laser-cut hollow candy gift box with elegant organza ribbon for wedding favors - Pink
Elegant gold laser-cut wedding favor box with floral patterns and a matching ribbon bow - Beige Gold
+5
Elegant Laser Cut Pearlescent Paper Wedding Favor Boxes Filigree Hollow Candy Gift Boxes With Ribbons For Party Decoration
-7%
$0.12
Mix MOQ : 50
Christmas Laser Cut Hollow Out Candy Gift Box Pearlescent Paper Snowflake Christmas Tree Pattern Gift Box With Ribbon For Party Wedding Favor
Christmas Laser Cut Hollow Out Candy Gift Box Pearlescent Paper Snowflake Christmas Tree Pattern Gift Box With Ribbon For Party Wedding Favor
like
Find Similar
White laser-cut Christmas candy box with tree and snowflake patterns and ribbon - White
Dark blue laser-cut Christmas candy box with snowflake tree patterns and white ribbon - Royal Blue
Detail of purple laser-cut Christmas tree gift box with ribbon and snowflake patterns - Dark Purple
Detail of laser-cut orange Christmas candy box with snowflake patterns and white ribbon - Orange Red
+10
Christmas Laser Cut Hollow Out Candy Gift Box Pearlescent Paper Snowflake Christmas Tree Pattern Gift Box With Ribbon For Party Wedding Favor
-7%
$0.12
Mix MOQ : 50
European Laser Cut Wedding Candy Box Pearlescent Paper Hollow Floral Chocolate Gift Box With Ribbon For Party Favor Supplies
European Laser Cut Wedding Candy Box Pearlescent Paper Hollow Floral Chocolate Gift Box With Ribbon For Party Favor Supplies
like
Find Similar
Elegant white laser-cut floral wedding favor box with a delicate white organza ribbon bow - White
Elegant white laser-cut wedding candy box with floral lace pattern and ribbon bow - Ivory
Pink laser cut wedding favor box with floral patterns and a soft organza ribbon bow - Pink
Elegant laser-cut hollow candy box in light blue with floral patterns and ribbon - Turquoise Blue
+2
NewEuropean Laser Cut Wedding Candy Box Pearlescent Paper Hollow Floral Chocolate Gift Box With Ribbon For Party Favor Supplies
-7%
$0.13
Mix MOQ : 50
Laser Cut Swan Heart Candy Box With Ribbon Bow Pearlescent Paper Wedding Party Favor Gift Box Hollow Chocolate Treat Boxes
Laser Cut Swan Heart Candy Box With Ribbon Bow Pearlescent Paper Wedding Party Favor Gift Box Hollow Chocolate Treat Boxes
like
Find Similar
Elegant white laser-cut swan heart wedding favor box with a delicate white organza ribbon - White
Close-up of white laser-cut wedding favor box featuring swan heart design and organza ribbon - Ivory
Pink laser cut wedding gift box featuring hollow swan heart design and organza ribbon - Pink
Detailed laser-cut gold swan heart wedding candy box with elegant ribbon bow tie - Gold
+7
Laser Cut Swan Heart Candy Box With Ribbon Bow Pearlescent Paper Wedding Party Favor Gift Box Hollow Chocolate Treat Boxes
$0.13
No MOQ
Laser Cut Hollow Floral Wedding Candy Box Pearlescent Paper Gift Boxes With Ribbon For Party Favor Celebration Decoration
Laser Cut Hollow Floral Wedding Candy Box Pearlescent Paper Gift Boxes With Ribbon For Party Favor Celebration Decoration
like
Find Similar
Elegant white laser-cut heart wedding favor box with a delicate white ribbon bow - White
Detail of red laser-cut candy box with floral patterns and matching chiffon ribbon bow - Pearlescent Red
Elegant hollow black favor box with intricate floral laser-cut design and ribbon - Black Khaki
Laser cut hollow wedding candy gift box in tiffany blue with elegant silk ribbon bow - Tiffany Blue
+6
Laser Cut Hollow Floral Wedding Candy Box Pearlescent Paper Gift Boxes With Ribbon For Party Favor Celebration Decoration
$0.12
Mix MOQ : 50
European Laser Cut Hollow Heart Pattern Wedding Candy Box Pearlescent Paper Gift Box With Ribbon For Party Chocolate Packaging
European Laser Cut Hollow Heart Pattern Wedding Candy Box Pearlescent Paper Gift Box With Ribbon For Party Chocolate Packaging
like
Find Similar
White laser-cut heart pattern wedding candy box with a white ribbon and golden chocolates - White
Pink laser-cut heart pattern gift box with satin ribbon bow for wedding candy packaging - Pink
Elegant champagne gold hollow heart gift box with a sheer organza ribbon bow - Beige Gold
Elegant purple laser-cut wedding favor box with intricate heart patterns and silk ribbon - Dark Purple
+4
European Laser Cut Hollow Heart Pattern Wedding Candy Box Pearlescent Paper Gift Box With Ribbon For Party Chocolate Packaging
$0.13
Mix MOQ : 50
European Laser Cut Hollow Wedding Candy Box Pearl Paper Gift Box With Ribbon For Wedding Party Celebration Favors Chocolate Packing
European Laser Cut Hollow Wedding Candy Box Pearl Paper Gift Box With Ribbon For Wedding Party Celebration Favors Chocolate Packing
like
Find Similar
Elegant white laser-cut lace candy box with floral patterns and a sheer organza ribbon bow - White
Elegant ivory laser-cut lace candy box with fine vine patterns and silk ribbon bow - Ivory
Elegant black laser-cut candy box with ornate hollow patterns and matching ribbon bow - Black Khaki
Golden hollow lace candy box with elegant orange organza ribbon for weddings - Reflective Gold
+7
European Laser Cut Hollow Wedding Candy Box Pearl Paper Gift Box With Ribbon For Wedding Party Celebration Favors Chocolate Packing
$0.12
Mix MOQ : 50
Go to

More in party supplies

Explore more in transparent gift boxes

partyplasticgoldartificialdiycakecardpetdisplaysmall
holidaystoragehomesanta clauskidsstorage boxtreesolid colorstylestar

Ready to source like an insider

Get a direct line to the factory floor — no minimums, no middlemen, no guesswork.
iconReal factory pricing, no markup in betweeniconEvery order hand-inspected before it shipsicon5,000+ new products added daily
Get Inside Access