Everful

Wholesale toe rings

Factory-direct selection, vetted for quality and ready to order.

Sign Up
Toe Rings

Find the perfect pieces: stainless steel rings, copper rings, alloy rings and more

All products in toe rings

filterShow Filters
Best Seller
New Arrivals
Price Drop
Free Shipping
Vintage Gothic Punk Evil Eye Adjustable Open Ring Purple Stone Skeleton Claw Alloy Finger Ring Jewelry For Men Women
Vintage Gothic Punk Evil Eye Adjustable Open Ring Purple Stone Skeleton Claw Alloy Finger Ring Jewelry For Men Women
like
Find Similar
Gothic punk alloy ring with purple evil eye and skull claw design, 31mm height - Silver
Vintage Gothic Punk Evil Eye Adjustable Open Ring Purple Stone Skeleton Claw Alloy Finger Ring Jewelry For Men Women
$0.92
Mix MOQ : 2
Retro Jesus Relief Stainless Steel Ring For Men Vintage Thorns Crown Religious Pattern Fashion Jewelry Finger Ring
Retro Jesus Relief Stainless Steel Ring For Men Vintage Thorns Crown Religious Pattern Fashion Jewelry Finger Ring
like
Find Similar
Vintage Jesus portrait relief ring in gold plated stainless steel for men - US 7 / Gold
Retro stainless steel ring for men featuring a 3D Jesus portrait with antique silver finish - US 7 / Steel
+12
NewRetro Jesus Relief Stainless Steel Ring For Men Vintage Thorns Crown Religious Pattern Fashion Jewelry Finger Ring
$2.83-3.09
No MOQ
Free Shipping
Minimalist 925 Sterling Silver Heart Adjustable Ring For Women Vintage Polished 3D Heart Open Ring Fashion Fine Jewelry Gift
Minimalist 925 Sterling Silver Heart Adjustable Ring For Women Vintage Polished 3D Heart Open Ring Fashion Fine Jewelry Gift
like
Find Similar
Close-up of polished S925 sterling silver heart ring displayed in a luxury jewelry box - Adjustable Open / Silver
Minimalist 925 Sterling Silver Heart Adjustable Ring For Women Vintage Polished 3D Heart Open Ring Fashion Fine Jewelry Gift
$24.84
No MOQ
Free Shipping
Vintage Stainless Steel Arabic Script Signet Ring For Men Punk Gothic Viking Style Engraved Celtic Knot Totem Pattern Silver Color Fashion Jewelry Accessory
Vintage Stainless Steel Arabic Script Signet Ring For Men Punk Gothic Viking Style Engraved Celtic Knot Totem Pattern Silver Color Fashion Jewelry Accessory
like
Find Similar
Retro stainless steel signet ring with vintage engraved patterns and braided edge - US 7 / Steel
+5
Vintage Stainless Steel Arabic Script Signet Ring For Men Punk Gothic Viking Style Engraved Celtic Knot Totem Pattern Silver Color Fashion Jewelry Accessory
-4%
$2.74
Mix MOQ : 3
Free Shipping
Women's Titanium Steel Eternity Ring Rhinestone Inlaid Minimalist Luxury Geometric Band Ring For Wedding Party Jewelry Gift
Women's Titanium Steel Eternity Ring Rhinestone Inlaid Minimalist Luxury Geometric Band Ring For Wedding Party Jewelry Gift
like
Find Similar
Macro detail of silver eternity ring featuring channel-set square-cut cubic zirconia gems - US 5 / Steel (One Row Square Zirconia)
Macro detail of rose gold eternity ring featuring square-cut sparkling cubic zirconia - US 5 / Rose Gold (Square Zirconia Row)
Macro detail of a gold-plated eternity ring with square-cut cubic zirconia stones - 12-b-1 Row Of Square Diamonds In Gold (refundable And Exchangeable If Faded) / Size 5
Macro view of rose gold double-row square zircon ring with polished stainless steel finish - US 5 / Rose Gold (Double Row Square Drill)
+172
Women's Titanium Steel Eternity Ring Rhinestone Inlaid Minimalist Luxury Geometric Band Ring For Wedding Party Jewelry Gift
$0.26-0.65
No MOQ
Free Shipping
Vintage Stainless Steel Ring For Men Retro Oval Tiger Eye Aventurine Stone Band Ribbed Design Punk Hip Hop Jewelry Gift
Vintage Stainless Steel Ring For Men Retro Oval Tiger Eye Aventurine Stone Band Ribbed Design Punk Hip Hop Jewelry Gift
like
Find Similar
Macro shot of silver stainless steel ring with oval white stone and textured side grooves - US 7 / Steel Color White Gemstone
Vintage stainless steel ring for men featuring a large oval green gemstone on white background - US 7 / Silver Green Gemstone
Retro men's stainless steel rings featuring oval tiger eye and aventurine gemstones - US 7 / Steel Tiger Eye
Men's vintage titanium steel ring with oval tiger eye stone and gold-tone fluted band - US 7 / Gold Tiger's Eye
+32
Vintage Stainless Steel Ring For Men Retro Oval Tiger Eye Aventurine Stone Band Ribbed Design Punk Hip Hop Jewelry Gift
$3.67-4.06
No MOQ
Free Shipping
Vintage Alloy Braid Wheat Adjustable Open Ring For Women Men Unisex Minimalist Fashion Jewelry Punk Style Stackable Finger Ring
Vintage Alloy Braid Wheat Adjustable Open Ring For Women Men Unisex Minimalist Fashion Jewelry Punk Style Stackable Finger Ring
like
Find Similar
Adjustable woven wheat ear ring in golden finish with a minimalist open design - Adjustable Open / Champagne Gold
Adjustable golden wheat ear braided open ring with polished metallic finish for men and women - Adjustable Open / Gold
Adjustable silver braided wheat ear ring with a polished metal open band for men and women - Adjustable Open / Silver
Vintage Alloy Braid Wheat Adjustable Open Ring For Women Men Unisex Minimalist Fashion Jewelry Punk Style Stackable Finger Ring
-5%
$0.57
Mix MOQ : 2
Vintage Stainless Steel Claddagh Ring For Women Men Hands Holding Heart Crown Friendship Retro Band Unisex Polished Jewelry
Vintage Stainless Steel Claddagh Ring For Women Men Hands Holding Heart Crown Friendship Retro Band Unisex Polished Jewelry
like
Find Similar
Polished silver stainless steel Claddagh ring featuring a black heart and hands pattern - US 7 / Silver
+5
Vintage Stainless Steel Claddagh Ring For Women Men Hands Holding Heart Crown Friendship Retro Band Unisex Polished Jewelry
-5%
$1.49
No MOQ
Free Shipping
925 Sterling Silver Irregular Leaf Petal Open Ring For Women Minimalist Matte Electroplated Adjustable Vintage Texture Finger Ring Jewelry
925 Sterling Silver Irregular Leaf Petal Open Ring For Women Minimalist Matte Electroplated Adjustable Vintage Texture Finger Ring Jewelry
like
Find Similar
S925 sterling silver adjustable leaf ring with matte vintage texture in a minimalist style - Adjustable Open / Matte Leaf Style (JZE101)
New925 Sterling Silver Irregular Leaf Petal Open Ring For Women Minimalist Matte Electroplated Adjustable Vintage Texture Finger Ring Jewelry
-11%
$27.38
No MOQ
Free Shipping
Vintage Stainless Steel Skull Ring Men Punk Gothic Floral Engraved Skeleton Band Ring Biker Jewelry Party Gift Gold Black Blue
Vintage Stainless Steel Skull Ring Men Punk Gothic Floral Engraved Skeleton Band Ring Biker Jewelry Party Gift Gold Black Blue
like
Find Similar
Men's blue titanium steel skull ring with intricate gothic floral engravings on a white background - US 7 / Blue
Vintage gothic skull ring for men in black finish with floral relief stainless steel - US 7 / Black
Vintage skull ring for men in stainless steel with detailed floral carvings on white background - US 7 / Steel
Men's vintage golden skull ring with intricate floral relief and punk rock style - US 7 / Gold
+24
Vintage Stainless Steel Skull Ring Men Punk Gothic Floral Engraved Skeleton Band Ring Biker Jewelry Party Gift Gold Black Blue
-4%
$2.91-3.06
No MOQ
Free Shipping
Gold Plated Titanium Steel Rings With Heart Black Zircon Red Green White Gemstones Retro Hands Hugging Jewelry For Women
Gold Plated Titanium Steel Rings With Heart Black Zircon Red Green White Gemstones Retro Hands Hugging Jewelry For Women
like
Find Similar
Detailed set of three gold-plated rings featuring a black heart-shaped zircon stone - US 6 / 4 Small Black Diamonds
Macro detail of gold Claddagh ring with black heart zircon held by hands design - US 6 / Black Zircon Heart Hugging Hands
Macro detail of gold-plated wide ring with emerald and clear rectangular zircons - US 6 / Two-Tone Square Zircon
Detailed macro view of a gold ring featuring an oval red zircon and textured band - US 6 / Red Zirconia
+11
Gold Plated Titanium Steel Rings With Heart Black Zircon Red Green White Gemstones Retro Hands Hugging Jewelry For Women
$2.75-4.95
No MOQ
 · 
24 views
Free Shipping
S925 Sterling Silver Open Ring For Women Minimalist Wave Twisted Stripe Design Adjustable Finger Ring Jewelry Gold Platinum Plated
S925 Sterling Silver Open Ring For Women Minimalist Wave Twisted Stripe Design Adjustable Finger Ring Jewelry Gold Platinum Plated
like
Find Similar
Minimalist S925 sterling silver open ring with textured wave pattern and adjustable band - Adjustable Open / Platinum
Minimalist S925 sterling silver open ring featuring a golden braided texture design - Adjustable Open / Gold
S925 Sterling Silver Open Ring For Women Minimalist Wave Twisted Stripe Design Adjustable Finger Ring Jewelry Gold Platinum Plated
-46%
$9.96
No MOQ
Free Shipping
925 Sterling Silver Geometric Pleated Ring For Women Men Minimalist Ins Style High End Light Luxury Finger Ring Jewelry
925 Sterling Silver Geometric Pleated Ring For Women Men Minimalist Ins Style High End Light Luxury Finger Ring Jewelry
like
Find Similar
Elegant 18K gold pleated ring with a textured ribbed design and modern aesthetic - HK Size 13 (US Size 6) / 18K Gold
Polished S925 sterling silver ring with geometric pyramid facets and 3D architectural design - HK Size 13 (US Size 6) / White Gold
+4
925 Sterling Silver Geometric Pleated Ring For Women Men Minimalist Ins Style High End Light Luxury Finger Ring Jewelry
-10%
$21.54-24.80
No MOQ
Free Shipping
S925 Sterling Silver Irregular Crushed Silver Open Ring For Women Minimalist Adjustable Statement Ring Finger Jewelry Gift
S925 Sterling Silver Irregular Crushed Silver Open Ring For Women Minimalist Adjustable Statement Ring Finger Jewelry Gift
like
Find Similar
Minimalist S925 sterling silver irregular crushed silver ring with a polished round bead - Adjustable Open / Silver
S925 Sterling Silver Irregular Crushed Silver Open Ring For Women Minimalist Adjustable Statement Ring Finger Jewelry Gift
$13.12
No MOQ
Free Shipping
Men Titanium Steel Signet Ring Minimalist Square Black Enamel Polished Finish Individual Fashion Accessory Finger Ring For Men
Men Titanium Steel Signet Ring Minimalist Square Black Enamel Polished Finish Individual Fashion Accessory Finger Ring For Men
like
Find Similar
6 options
Men Titanium Steel Signet Ring Minimalist Square Black Enamel Polished Finish Individual Fashion Accessory Finger Ring For Men
-4%
$3.19
No MOQ
Free Shipping
Vintage Stainless Steel Enamel Heart Sun Cactus Palm Tree Ring Rhinestone Gold Plated Geometric Finger Jewelry Women
Vintage Stainless Steel Enamel Heart Sun Cactus Palm Tree Ring Rhinestone Gold Plated Geometric Finger Jewelry Women
like
Find Similar
Detailed view of 18k gold titanium steel ring featuring celestial planet motifs and rhinestones - Star Moon Planet Style (JDR0205002)
Gold stainless steel ring with pink palm tree motif and micro-set zircon stones - Palm Tree Style (JDR0205004)
Golden octagonal stainless steel ring with cactus enamel and sparkling side crystals - Desert Cactus Style (JDR0205005)
Vintage Stainless Steel Enamel Heart Sun Cactus Palm Tree Ring Rhinestone Gold Plated Geometric Finger Jewelry Women
$5.11
No MOQ
 · 
15 views
Free Shipping
Retro Stainless Steel Venus Goddess Relief Ring For Men Vintage Distressed Gothic Artistic Finger Ring Open Adjustable Jewelry
Retro Stainless Steel Venus Goddess Relief Ring For Men Vintage Distressed Gothic Artistic Finger Ring Open Adjustable Jewelry
like
Find Similar
7 options
Retro Stainless Steel Venus Goddess Relief Ring For Men Vintage Distressed Gothic Artistic Finger Ring Open Adjustable Jewelry
$3.35
No MOQ
Free Shipping
Vintage Mens Titanium Stainless Steel Punk Skull Ring Gothic Biker Skeleton Polished Silver Color Finger Jewelry Accessory
Vintage Mens Titanium Stainless Steel Punk Skull Ring Gothic Biker Skeleton Polished Silver Color Finger Jewelry Accessory
like
Find Similar
6 options
Vintage Mens Titanium Stainless Steel Punk Skull Ring Gothic Biker Skeleton Polished Silver Color Finger Jewelry Accessory
-4%
$2.74
No MOQ
Free Shipping
Men Retro Lion Head Ring Titanium Steel Antique Silver Finish Roaring Lion Totem Punk Rock Gothic Fashion Finger Jewelry
Men Retro Lion Head Ring Titanium Steel Antique Silver Finish Roaring Lion Totem Punk Rock Gothic Fashion Finger Jewelry
like
Find Similar
Men's retro lion totem stainless steel ring featuring a detailed lion head sculpture - 23# / Antique Silver
+5
Men Retro Lion Head Ring Titanium Steel Antique Silver Finish Roaring Lion Totem Punk Rock Gothic Fashion Finger Jewelry
-5%
$3.21
No MOQ
Free Shipping
Minimalist Irregular Molten Lava Texture Stainless Steel Ring For Men Retro Hip Hop Silver Band Ring Jewelry Gift
Minimalist Irregular Molten Lava Texture Stainless Steel Ring For Men Retro Hip Hop Silver Band Ring Jewelry Gift
like
Find Similar
Vintage irregular lava texture titanium steel ring for men with minimalist silver finish - US 7 / Silver
+5
Minimalist Irregular Molten Lava Texture Stainless Steel Ring For Men Retro Hip Hop Silver Band Ring Jewelry Gift
-4%
$3.24
No MOQ
Free Shipping
Celestial Stainless Steel Ring Vintage Sun Moon Star Evil Eye Bohemian Zircon Inlaid Jewelry For Women Fashion Accessory
Celestial Stainless Steel Ring Vintage Sun Moon Star Evil Eye Bohemian Zircon Inlaid Jewelry For Women Fashion Accessory
like
Find Similar
Gold stainless steel ring with 5A zircon featuring sun, moon, and eye starburst patterns - US 7 / Gold White Zirconia
Detail of bohemian gold ring with pink zircon featuring moon star and evil eye motifs - US 7 / Gold Pink Zirconia
Gold stainless steel ring featuring celestial sun and moon motifs with colorful cubic zirconia - US 7 / Gold Multicolor Zircon
Vintage stainless steel ring with 5A zircon featuring sun, moon, and star motifs - US 7 / Silver White Zircon
+2
Celestial Stainless Steel Ring Vintage Sun Moon Star Evil Eye Bohemian Zircon Inlaid Jewelry For Women Fashion Accessory
$3.80-4.06
No MOQ
 · 
16 views
Free Shipping
S925 Sterling Silver Beaded Heart Ring Adjustable Minimalist Fashion Korean Style Vintage Finger Ring Jewelry For Women
S925 Sterling Silver Beaded Heart Ring Adjustable Minimalist Fashion Korean Style Vintage Finger Ring Jewelry For Women
like
Find Similar
Minimalist S925 sterling silver beaded heart ring with a polished pendant on white card - Adjustable Open / Heart Pendant Beaded Style (23JZ33)
S925 Sterling Silver Beaded Heart Ring Adjustable Minimalist Fashion Korean Style Vintage Finger Ring Jewelry For Women
-13%
$12.44
No MOQ
Free Shipping
Rotating Butterfly Ring For Women Copper Inlaid Rhinestone Open Adjustable Finger Ring Fashion Personalized Animal Jewelry
Rotating Butterfly Ring For Women Copper Inlaid Rhinestone Open Adjustable Finger Ring Fashion Personalized Animal Jewelry
like
Find Similar
Adjustable golden spinner ring featuring a white butterfly design on a minimalist band - Adjustable Open / Gold Tone (AJ150)
Silver adjustable spinner ring featuring a minimalist butterfly design on white background - Adjustable Open / Silver Tone (AJ150)
Golden rotating butterfly ring with vibrant red and white enamel on a studio white background - Adjustable Open / Gold Tone (AJ151)
Adjustable S925 sterling silver spinning butterfly ring with sparkling zircon crystals - Adjustable Open / Silver Tone (AJ250)
+20
Rotating Butterfly Ring For Women Copper Inlaid Rhinestone Open Adjustable Finger Ring Fashion Personalized Animal Jewelry
-9%
$1.44-1.99
No MOQ
 · 
40 sold recently
Free Shipping
Gothic Letter Stainless Steel Signet Ring For Men Women Polished Square Face Punk Hip Hop Band Ring Fashion Jewelry Gift
Gothic Letter Stainless Steel Signet Ring For Men Women Polished Square Face Punk Hip Hop Band Ring Fashion Jewelry Gift
like
Find Similar
Men's square stainless steel ring with gothic BB engraving and black hip-hop style - US 7 / Steel
+7
Gothic Letter Stainless Steel Signet Ring For Men Women Polished Square Face Punk Hip Hop Band Ring Fashion Jewelry Gift
-5%
$3.48
No MOQ
Free Shipping
Vintage S925 Sterling Silver Minimalist Fish Open Ring For Women Chic Adjustable Finger Ring Jewelry Anniversary Gift
Vintage S925 Sterling Silver Minimalist Fish Open Ring For Women Chic Adjustable Finger Ring Jewelry Anniversary Gift
like
Find Similar
2 options
Vintage S925 Sterling Silver Minimalist Fish Open Ring For Women Chic Adjustable Finger Ring Jewelry Anniversary Gift
-18%
$7.34-10.22
No MOQ
Free Shipping
Minimalist Stainless Steel Open Ring For Women Adjustable Gold Plated Enamel Oval Geometric Drip Oil Fashion Finger Jewelry
Minimalist Stainless Steel Open Ring For Women Adjustable Gold Plated Enamel Oval Geometric Drip Oil Fashion Finger Jewelry
like
Find Similar
1 option
Minimalist Stainless Steel Open Ring For Women Adjustable Gold Plated Enamel Oval Geometric Drip Oil Fashion Finger Jewelry
-5%
$1.12
No MOQ
Free Shipping
Retro Titanium Steel Gold Ring Square Green Zirconia Emerald Cut Wide Band Brushed Texture Men Luxurious Vintage Jewelry
Retro Titanium Steel Gold Ring Square Green Zirconia Emerald Cut Wide Band Brushed Texture Men Luxurious Vintage Jewelry
like
Find Similar
Men's gold titanium ring with square emerald and side zircon accents on black background - Size 10 (HK)
+4
NewRetro Titanium Steel Gold Ring Square Green Zirconia Emerald Cut Wide Band Brushed Texture Men Luxurious Vintage Jewelry
$4.45
No MOQ
Free Shipping
Minimalist 925 Sterling Silver Open Adjustable Ring Geometric Ball Water Drop Design High Polish Finger Jewelry For Women
Minimalist 925 Sterling Silver Open Adjustable Ring Geometric Ball Water Drop Design High Polish Finger Jewelry For Women
like
Find Similar
Minimalist S925 sterling silver open ring featuring geometric sphere and teardrop design - Size 14 (Adjustable) / Silver
Minimalist 925 Sterling Silver Open Adjustable Ring Geometric Ball Water Drop Design High Polish Finger Jewelry For Women
-15%
$19.98
No MOQ
Free Shipping
S925 Sterling Silver Minimalist Hollow Heart Open Ring For Women Adjustable Twisted Rope Fine Finger Ring Jewelry Gift
S925 Sterling Silver Minimalist Hollow Heart Open Ring For Women Adjustable Twisted Rope Fine Finger Ring Jewelry Gift
like
Find Similar
Stackable S925 sterling silver hollow heart rings with thin twisted band for women - Adjustable Open / Silver
S925 Sterling Silver Minimalist Hollow Heart Open Ring For Women Adjustable Twisted Rope Fine Finger Ring Jewelry Gift
$6.55
No MOQ
Free Shipping
Vintage Anubis Jackal Head Titanium Steel Ring For Men Retro Ancient Egyptian Ankh Symbol Punk Gothic Fashion Jewelry Ring
Vintage Anubis Jackal Head Titanium Steel Ring For Men Retro Ancient Egyptian Ankh Symbol Punk Gothic Fashion Jewelry Ring
like
Find Similar
Vintage stainless steel Anubis wolf head ring with gold Ankh symbol on white background - US 7 / Silver
+5
Vintage Anubis Jackal Head Titanium Steel Ring For Men Retro Ancient Egyptian Ankh Symbol Punk Gothic Fashion Jewelry Ring
-4%
$2.74
No MOQ
Free Shipping
925 Sterling Silver Bowknot Ring For Women Minimalist Adjustable Hollow Out Finger Ring Korean Style Vintage Jewelry
925 Sterling Silver Bowknot Ring For Women Minimalist Adjustable Hollow Out Finger Ring Korean Style Vintage Jewelry
like
Find Similar
Detailed close-up of S925 silver bow crown ring with elegant beaded texture and glossy finish - Adjustable Open / Silver
925 Sterling Silver Bowknot Ring For Women Minimalist Adjustable Hollow Out Finger Ring Korean Style Vintage Jewelry
$8.04
No MOQ
Free Shipping
Vintage Men Titanium Steel Dragon Shield Signet Ring Gothic Punk Dragon Wing Two-Tone Gold Silver Stainless Steel Jewelry
Vintage Men Titanium Steel Dragon Shield Signet Ring Gothic Punk Dragon Wing Two-Tone Gold Silver Stainless Steel Jewelry
like
Find Similar
Vintage gothic men's stainless steel shield ring featuring a 3D dragon wings emblem - US 7 / Steel
Vintage gothic dragon shield ring in stainless steel with golden dragon relief - US 7 / Gold & Silver
+12
NewVintage Men Titanium Steel Dragon Shield Signet Ring Gothic Punk Dragon Wing Two-Tone Gold Silver Stainless Steel Jewelry
-5%
$2.99-3.48
No MOQ
Free Shipping
Gold Plated Stainless Steel Starfish Artificial Pearl Open Ring Exaggerated Trendy Marine Style Adjustable Finger Jewelry For Women
Gold Plated Stainless Steel Starfish Artificial Pearl Open Ring Exaggerated Trendy Marine Style Adjustable Finger Jewelry For Women
like
Find Similar
1 option
Gold Plated Stainless Steel Starfish Artificial Pearl Open Ring Exaggerated Trendy Marine Style Adjustable Finger Jewelry For Women
-4%
$1.94
No MOQ
Free Shipping
925 Sterling Silver Round Moving Pendant Ring With Micro Inlaid Zirconia Minimalist Fashion Elegant Finger Ring For Women Jewelry Gift
925 Sterling Silver Round Moving Pendant Ring With Micro Inlaid Zirconia Minimalist Fashion Elegant Finger Ring For Women Jewelry Gift
like
Find Similar
5 options
925 Sterling Silver Round Moving Pendant Ring With Micro Inlaid Zirconia Minimalist Fashion Elegant Finger Ring For Women Jewelry Gift
-14%
$14.03
No MOQ
Free Shipping
Vintage Cross Ring Men Stainless Steel Punk Band Gothic Relief Polished Distressed Silver Steel Color Finger Jewelry Gift
Vintage Cross Ring Men Stainless Steel Punk Band Gothic Relief Polished Distressed Silver Steel Color Finger Jewelry Gift
like
Find Similar
7 options
Vintage Cross Ring Men Stainless Steel Punk Band Gothic Relief Polished Distressed Silver Steel Color Finger Jewelry Gift
-4%
$3.29
No MOQ
Free Shipping
Vintage Stainless Steel Evil Eye Ring For Men Gothic Punk Rock Texture Biker Finger Ring Jewelry Antique Finish Gift
Vintage Stainless Steel Evil Eye Ring For Men Gothic Punk Rock Texture Biker Finger Ring Jewelry Antique Finish Gift
like
Find Similar
Macro detail of gothic demon eye ring with yellow stone and dragon scale texture - US Size 7 / Yellow
Macro shot of gothic stainless steel ring with red dragon eye gemstone and scale texture - US Size 7 / Red
+12
NewVintage Stainless Steel Evil Eye Ring For Men Gothic Punk Rock Texture Biker Finger Ring Jewelry Antique Finish Gift
$3.88
No MOQ
Free Shipping
925 Sterling Silver Prince Ruperts Drop Couple Rings For Women Men Adjustable Open Mobius Rhinestone Ring Set Valentine Gift Fashion Jewelry
925 Sterling Silver Prince Ruperts Drop Couple Rings For Women Men Adjustable Open Mobius Rhinestone Ring Set Valentine Gift Fashion Jewelry
like
Find Similar
Polished silver couple rings featuring a Mobius twist and sparkling textured finish - Adjustable Open / Female Style
925 Sterling Silver Prince Ruperts Drop Couple Rings For Women Men Adjustable Open Mobius Rhinestone Ring Set Valentine Gift Fashion Jewelry
-10%
$11.20
No MOQ
Free Shipping
Minimalist S925 Sterling Silver Gold Bead Open Ring For Women Chic Adjustable Geometric Finger Ring Fine Jewelry Gift
Minimalist S925 Sterling Silver Gold Bead Open Ring For Women Chic Adjustable Geometric Finger Ring Fine Jewelry Gift
like
Find Similar
Minimalist S925 sterling silver thin gold bead open ring with adjustable minimalist band - Adjustable Open / Gold
Minimalist S925 Sterling Silver Gold Bead Open Ring For Women Chic Adjustable Geometric Finger Ring Fine Jewelry Gift
-16%
$5.98
No MOQ
Free Shipping
Minimalist 925 Sterling Silver Open Ring For Women Korean Style Matte Brushed Plain Band Adjustable Niche Design Fashion Finger Ring Jewelry
Minimalist 925 Sterling Silver Open Ring For Women Korean Style Matte Brushed Plain Band Adjustable Niche Design Fashion Finger Ring Jewelry
like
Find Similar
Minimalist S925 sterling silver matte rings set with adjustable open band in jewelry box - Matte Wide Band Style (JZB130) / Adjustable Open / Silver
Minimalist 925 Sterling Silver Open Ring For Women Korean Style Matte Brushed Plain Band Adjustable Niche Design Fashion Finger Ring Jewelry
-12%
$33.85
No MOQ
Free Shipping
Vintage Stainless Steel Skull Head Ring For Men Punk Gothic Distressed Titanium Steel Band Ring Fashion Jewelry Gift
Vintage Stainless Steel Skull Head Ring For Men Punk Gothic Distressed Titanium Steel Band Ring Fashion Jewelry Gift
like
Find Similar
7 options
Vintage Stainless Steel Skull Head Ring For Men Punk Gothic Distressed Titanium Steel Band Ring Fashion Jewelry Gift
-4%
$3.24
No MOQ
Free Shipping
Vintage 925 Sterling Silver Square Geometric Open Ring For Women Minimalist Adjustable Brushed Texture Fashion Jewelry Finger Ring
Vintage 925 Sterling Silver Square Geometric Open Ring For Women Minimalist Adjustable Brushed Texture Fashion Jewelry Finger Ring
like
Find Similar
Minimalist S925 sterling silver square ring with matte finish on a finger - Adjustable Open / Square Geometric Style (JZG145)
Vintage 925 Sterling Silver Square Geometric Open Ring For Women Minimalist Adjustable Brushed Texture Fashion Jewelry Finger Ring
-11%
$26.13
No MOQ
Free Shipping
Minimalist S925 Sterling Silver Gold Plated Wave Ring For Women Fashion Tiny Line Rippled Finger Ring Everyday Jewelry
Minimalist S925 Sterling Silver Gold Plated Wave Ring For Women Fashion Tiny Line Rippled Finger Ring Everyday Jewelry
like
Find Similar
Minimalist s925 sterling silver golden wavy ring with a smooth matte finish for women - US Size 6 / Gold
Minimalist S925 Sterling Silver Gold Plated Wave Ring For Women Fashion Tiny Line Rippled Finger Ring Everyday Jewelry
$7.47
No MOQ
Free Shipping
Minimalist Stainless Steel Hollow Heart Open Ring For Women Adjustable Gold Interlocking Heart Pattern Fashion Finger Jewelry
Minimalist Stainless Steel Hollow Heart Open Ring For Women Adjustable Gold Interlocking Heart Pattern Fashion Finger Jewelry
like
Find Similar
1 option
Minimalist Stainless Steel Hollow Heart Open Ring For Women Adjustable Gold Interlocking Heart Pattern Fashion Finger Jewelry
-5%
$1.24
No MOQ
Free Shipping
925 Sterling Silver Butterfly Ring Vintage Adjustable Open Design Gold Silver Brushed Texture Jewelry For Daily Picnic Party Women Accessory
925 Sterling Silver Butterfly Ring Vintage Adjustable Open Design Gold Silver Brushed Texture Jewelry For Daily Picnic Party Women Accessory
like
Find Similar
Detail of S925 sterling silver butterfly ring with matte brushed finish on wooden box - Adjustable Open / Silver
925 Sterling Silver Butterfly Ring Vintage Adjustable Open Design Gold Silver Brushed Texture Jewelry For Daily Picnic Party Women Accessory
$20.23
No MOQ
Free Shipping
Vintage Evil Eye Water Drop Open Ring Copper Gold Plated Micro Inlaid Zirconia Colorful Enamel Adjustable Jewelry Gift
Vintage Evil Eye Water Drop Open Ring Copper Gold Plated Micro Inlaid Zirconia Colorful Enamel Adjustable Jewelry Gift
like
Find Similar
Gold-plated teardrop evil eye ring with red enamel coating and colorful zircon stones - Adjustable Open / Red
Close-up of gold-plated teardrop enamel ring with multi-color zircon evil eye detail - Adjustable Open / White
Adjustable golden teardrop ring with pink enamel and colorful stones in a top view - Adjustable Open / Pink
Gold plated teardrop evil eye ring with colorful zircon cross and black enamel finish - Adjustable Open / Black
+3
Vintage Evil Eye Water Drop Open Ring Copper Gold Plated Micro Inlaid Zirconia Colorful Enamel Adjustable Jewelry Gift
$1.96
No MOQ
Free Shipping
Stainless Steel Gold Signet Ring For Men Vintage Business Square Black Green Inlaid Rhinestone Fashion Jewelry Finger Ring
Stainless Steel Gold Signet Ring For Men Vintage Business Square Black Green Inlaid Rhinestone Fashion Jewelry Finger Ring
like
Find Similar
Men's gold-plated stainless steel ring with a large rectangular black onyx stone setting - US 7 / Black Rhinestone
Men's gold-plated stainless steel ring with rectangular green agate stone inlay - US 7 / Green Zirconia
+10
Stainless Steel Gold Signet Ring For Men Vintage Business Square Black Green Inlaid Rhinestone Fashion Jewelry Finger Ring
$3.92
No MOQ
Free Shipping
Vintage Floral Stainless Steel Ring Oval Red Blue Rhinestone Inlaid Ring Retro Punk Hollow Flower Unisex Finger Jewelry
Vintage Floral Stainless Steel Ring Oval Red Blue Rhinestone Inlaid Ring Retro Punk Hollow Flower Unisex Finger Jewelry
like
Find Similar
Vintage stainless steel ring with blue sandstone gem and detailed floral carvings - US Size 6 / Blue
Vintage stainless steel ring with large oval ruby gemstone and floral filigree details - US Size 7 / Red
+9
Vintage Floral Stainless Steel Ring Oval Red Blue Rhinestone Inlaid Ring Retro Punk Hollow Flower Unisex Finger Jewelry
$3.88
No MOQ
Free Shipping
Vintage Stainless Steel Rhinestone Signet Ring For Men Geometric Square Polished Punk Hip Hop Decorative Finger Ring Jewelry Gift
Vintage Stainless Steel Rhinestone Signet Ring For Men Geometric Square Polished Punk Hip Hop Decorative Finger Ring Jewelry Gift
like
Find Similar
Vintage stainless steel signet ring with large square red gemstone and wave textures - US 7 / Silver Red
Vintage palace style stainless steel square ring with a large purple zircon gemstone - US 7 / Silver Purple Zirconia
Vintage stainless steel square signet ring with black stone and 222 relief pattern - US 7 / Silver Black
+15
Vintage Stainless Steel Rhinestone Signet Ring For Men Geometric Square Polished Punk Hip Hop Decorative Finger Ring Jewelry Gift
$4.19
No MOQ
Free Shipping
Vintage Ginkgo Leaf Adjustable Open Ring Copper Plant Branch Finger Jewelry For Women Elegant Natural Style Finger Ring
Vintage Ginkgo Leaf Adjustable Open Ring Copper Plant Branch Finger Jewelry For Women Elegant Natural Style Finger Ring
like
Find Similar
Elegant S925 sterling silver ginkgo leaf open ring with adjustable branch design - Ginkgo Ring / Silver
Vintage Ginkgo Leaf Adjustable Open Ring Copper Plant Branch Finger Jewelry For Women Elegant Natural Style Finger Ring
-4%
$0.62
No MOQ
Free Shipping
Retro Punk Stainless Steel Skull Ring For Men Vintage Gothic Skeleton Middle Finger Gesture Signet Ring Biker Rock Hip Hop Jewelry
Retro Punk Stainless Steel Skull Ring For Men Vintage Gothic Skeleton Middle Finger Gesture Signet Ring Biker Rock Hip Hop Jewelry
like
Find Similar
Vintage stainless steel cowboy skull ring with punk style shield design on white background - US 7 / Steel
Vintage punk skull ring in silver and gold stainless steel with boney hand detail - US 7 / Two-tone (Gold & Silver)
+10
Retro Punk Stainless Steel Skull Ring For Men Vintage Gothic Skeleton Middle Finger Gesture Signet Ring Biker Rock Hip Hop Jewelry
$3.41-3.93
No MOQ
Free Shipping
925 Sterling Silver Mobius Couples Rings Adjustable Open Finger Rings Minimalist Zirconia Inlaid Jewelry For Lovers Gift
925 Sterling Silver Mobius Couples Rings Adjustable Open Finger Rings Minimalist Zirconia Inlaid Jewelry For Lovers Gift
like
Find Similar
S925 sterling silver Mobius rings for couples featuring a sleek twist and diamond accents - Adjustable Open / Couple Rings Set
Adjustable S925 sterling silver Mobius ring featuring a polished bright silver finish - Adjustable Open / Male Style
Silver Mobius ring with S925 stamp and cubic zirconia inlay in adjustable open design - Adjustable Open / Female Style
925 Sterling Silver Mobius Couples Rings Adjustable Open Finger Rings Minimalist Zirconia Inlaid Jewelry For Lovers Gift
-15%
$8.65-19.91
No MOQ
Free Shipping
925 Sterling Silver Multi Layer Intertwined Spiky Open Ring Minimalist Geometric Claw Ring Adjustable Fashion Jewelry For Women
925 Sterling Silver Multi Layer Intertwined Spiky Open Ring Minimalist Geometric Claw Ring Adjustable Fashion Jewelry For Women
like
Find Similar
Minimalist 925 sterling silver multi-layer wrap ring with polished sharp edge design - Adjustable Open / Cross Wrapped Design (JZB064)
New925 Sterling Silver Multi Layer Intertwined Spiky Open Ring Minimalist Geometric Claw Ring Adjustable Fashion Jewelry For Women
-13%
$34.84
No MOQ
Free Shipping
Vintage Stainless Steel Boxing Glove Ring For Men Punk Cuban Chain Band Polished Sports Style Ring Gold Steel Color Jewelry Gift
Vintage Stainless Steel Boxing Glove Ring For Men Punk Cuban Chain Band Polished Sports Style Ring Gold Steel Color Jewelry Gift
like
Find Similar
Retro stainless steel cobra head ring with 11mm width and rugged chain link band - US 7 / Steel
Men's vintage golden stainless steel boxing glove ring with hollow chain pattern - US 7 / Gold
+12
Vintage Stainless Steel Boxing Glove Ring For Men Punk Cuban Chain Band Polished Sports Style Ring Gold Steel Color Jewelry Gift
-5%
$3.12-3.36
No MOQ
Free Shipping
Men Vintage Feather Open Ring Gothic Punk Style With Red Pupil Evil Eye Alloy Rhinestone Adjustable Finger Jewelry Gift
Men Vintage Feather Open Ring Gothic Punk Style With Red Pupil Evil Eye Alloy Rhinestone Adjustable Finger Jewelry Gift
like
Find Similar
Vintage silver feather ring for men with a striking red eye stone and intricate details - Silver
Men Vintage Feather Open Ring Gothic Punk Style With Red Pupil Evil Eye Alloy Rhinestone Adjustable Finger Jewelry Gift
$0.73
Mix MOQ : 2
Vintage Stainless Steel Compass Ring For Men Women Eight Pointed Star Nautical Poseidon Polished Two Tone Band Jewelry
Vintage Stainless Steel Compass Ring For Men Women Eight Pointed Star Nautical Poseidon Polished Two Tone Band Jewelry
like
Find Similar
Men's vintage titanium steel compass ring with zircon star design on white background - US 7 / Steel
Vintage stainless steel compass ring with gold star and engraved nautical directions - US 7 / Two-tone (Gold & Silver)
+10
Vintage Stainless Steel Compass Ring For Men Women Eight Pointed Star Nautical Poseidon Polished Two Tone Band Jewelry
$3.41-3.93
No MOQ
Free Shipping
Gothic Punk Stainless Steel Skull Ring For Men Vintage Winged Dragon Claw Hip Hop Biker Jewelry Antique Silver Finish Ring
Gothic Punk Stainless Steel Skull Ring For Men Vintage Winged Dragon Claw Hip Hop Biker Jewelry Antique Silver Finish Ring
like
Find Similar
Macro side view of hip hop punk ring featuring skull and wing details on silver metal - US 12 / Wing Skull Ring
Polished silver skull ring with gothic claw design for men in punk hip hop style - US 12 / Dragon Claw Skull Ring
+8
Gothic Punk Stainless Steel Skull Ring For Men Vintage Winged Dragon Claw Hip Hop Biker Jewelry Antique Silver Finish Ring
$3.93
No MOQ
Free Shipping
Industrial Titanium Steel Ring For Men Women Black Grid Texture Knurling Band Ring Two-Tone Polished Modern Fashion Jewelry
Industrial Titanium Steel Ring For Men Women Black Grid Texture Knurling Band Ring Two-Tone Polished Modern Fashion Jewelry
like
Find Similar
Three-tone titanium steel men's ring with black textured pattern and rose gold inlay - US 7 / Black and Rose Gold
Mens creative two-tone titanium steel ring with black knurled edges and polished silver center - US 7 / Black and Steel Color
+12
Industrial Titanium Steel Ring For Men Women Black Grid Texture Knurling Band Ring Two-Tone Polished Modern Fashion Jewelry
$3.93-4.19
No MOQ
Free Shipping
Punk Gothic Eagle Claw Nail Ring Alloy Finger Armor Adjustable Open Ring Jewelry For Women Accessory
Punk Gothic Eagle Claw Nail Ring Alloy Finger Armor Adjustable Open Ring Jewelry For Women Accessory
like
Find Similar
Vintage punk style golden claw nail ring with distressed metal texture on white background - Antique Gold
Silver punk claw fingernail ring for party wear displayed on grey satin background - Antique Silver
Punk Gothic Eagle Claw Nail Ring Alloy Finger Armor Adjustable Open Ring Jewelry For Women Accessory
-4%
$0.24
No MOQ
925 Sterling Silver Mobius Couple Rings Adjustable Minimalist Smooth Men Band And Inlaid Zirconia Women Ring Jewelry
925 Sterling Silver Mobius Couple Rings Adjustable Minimalist Smooth Men Band And Inlaid Zirconia Women Ring Jewelry
like
Find Similar
2 options
925 Sterling Silver Mobius Couple Rings Adjustable Minimalist Smooth Men Band And Inlaid Zirconia Women Ring Jewelry
-19%
$10.22-15.46
No MOQ
Free Shipping
Retro Men Stainless Steel Skull And Crossbones Ring Gothic Punk Distressed Band Ring Pirate Style Jewelry Gold Silver Tone
Retro Men Stainless Steel Skull And Crossbones Ring Gothic Punk Distressed Band Ring Pirate Style Jewelry Gold Silver Tone
like
Find Similar
14 options
Retro Men Stainless Steel Skull And Crossbones Ring Gothic Punk Distressed Band Ring Pirate Style Jewelry Gold Silver Tone
-4%
$2.94-3.19
No MOQ
Free Shipping
Go to

More in jewelry

Lab-Created Gemstone Jewelry

Explore more in toe rings

openfoot jewelryfingersimplewhiteplasticgold plated adjustableturquoise18k gold platedcolor ring
footgold platedlayerartificialpolishedgirlsdesignbodyplated stainless steelartificial pearls rhinestone

Ready to source like an insider

Get a direct line to the factory floor — no minimums, no middlemen, no guesswork.
iconReal factory pricing, no markup in betweeniconEvery order hand-inspected before it shipsicon5,000+ new products added daily
Get Inside Access