Everful

Wholesale toe rings

Factory-direct selection, vetted for quality and ready to order.

Sign Up
Toe Rings

Find the perfect pieces: stainless steel rings, copper rings, alloy rings and more

All products in toe rings

filterShow Filters
Price Drop
Free Shipping
Best Seller
New Arrivals
Men Vintage Signet Ring Carved Alloy With Tiger Eye Stone Ethnic Retro Style Statement Hand Crafted Finger Jewelry
Men Vintage Signet Ring Carved Alloy With Tiger Eye Stone Ethnic Retro Style Statement Hand Crafted Finger Jewelry
like
Find Similar
Retro men's tiger eye ring with vintage floral carvings and braided metal border - US 6 / Yellow Tiger Eye
Vintage silver men's ring with square black agate on textured stone background - US 6 / Black Rectangular Stone
Vintage eagle relief signet ring with square black onyx stone and antique finish - US 6 / Eagle Black Stone
Vintage silver men's ring with large black onyx gemstone and intricate vine engravings - US 6 / Black Oval Stone
+36
Men Vintage Signet Ring Carved Alloy With Tiger Eye Stone Ethnic Retro Style Statement Hand Crafted Finger Jewelry
$0.58-0.84
No MOQ
 · 
297 sold recently
Top 10% Best Sellers
in Rings
Free Shipping
Retro Owl Ring Alloy Vintage Animal Shape Colorful Rhinestone Eyes Punk Gothic Jewelry For Men Women Fashion Accessory
Retro Owl Ring Alloy Vintage Animal Shape Colorful Rhinestone Eyes Punk Gothic Jewelry For Men Women Fashion Accessory
like
Find Similar
Vintage silver owl ring with deep blue eyes on a textured paper background - Blue
Vintage owl ring for women and men with red gemstone eyes on retro letter background - Red
Vintage silver owl ring with green gemstone eyes shown against a retro script background - Green
Macro shot of vintage silver owl ring featuring striking pink eyes on a retro paper backdrop - Pink
+10
Retro Owl Ring Alloy Vintage Animal Shape Colorful Rhinestone Eyes Punk Gothic Jewelry For Men Women Fashion Accessory
$0.16-0.17
No MOQ
 · 
703 sold recently
Top 10% Best Sellers
in Rings
Minimalist Stainless Steel Angel Wing Adjustable Open Ring For Women Men Fashion Personality Feather Design Finger Ring Jewelry
Minimalist Stainless Steel Angel Wing Adjustable Open Ring For Women Men Fashion Personality Feather Design Finger Ring Jewelry
like
Find Similar
Detail of adjustable golden wings ring showing delicate feather texture and metal finish - Double Wing (Gold)
Minimalist adjustable stainless steel wing ring in silver finish for women - Double Wing (Silver)
Macro detail of a black adjustable stainless steel wing ring in a jewelry box display - Double Wing (Black)
Minimalist Stainless Steel Angel Wing Adjustable Open Ring For Women Men Fashion Personality Feather Design Finger Ring Jewelry
$0.50-0.71
No MOQ
 · 
29 sold recently
Retro Hollow Ring With Oval Imitation Turquoise Alloy Bohemian Ethnic Style Jewelry For Women
Retro Hollow Ring With Oval Imitation Turquoise Alloy Bohemian Ethnic Style Jewelry For Women
like
Find Similar
Retro turquoise ring with oval stone and filigree copper-tone metal open design - US 5 / Rose Gold
Retro hollow turquoise ring with antique gold finish and bohemian scroll engraving - US 5 / Gold
Retro hollowed silver ring featuring oval faux turquoise with bohemian braided texture - US 5 / White Gold
+12
Retro Hollow Ring With Oval Imitation Turquoise Alloy Bohemian Ethnic Style Jewelry For Women
$0.58
No MOQ
 · 
566 sold recently
Top 10% Best Sellers
in Rings
Free Shipping
Vintage Gold Plated Stainless Steel Artificial Pearl Rings For Women Elegant Floral Heart Lava Texture Minimalist Statement Finger Jewelry
Vintage Gold Plated Stainless Steel Artificial Pearl Rings For Women Elegant Floral Heart Lava Texture Minimalist Statement Finger Jewelry
like
Find Similar
Detailed view of 18K gold stainless steel ring with 5-petal pearl flower design - Floral Pearl Style (JDR0103017)
Detail view of two-tone beaded ring with silver and gold stainless steel units - Gold and Silver Dual Color Fine Beads Style (JDR0103016-PS-7)
Gold stainless steel watch band ring with large white pearl inlay details - Watchband Structure Single Pearl Style (JDR0112055-6)
Detailed size specifications for 18k gold stainless steel oval hollow geometric ring - Minimalist Hollow Irregular Style (JDR2403002-6)
+5
Vintage Gold Plated Stainless Steel Artificial Pearl Rings For Women Elegant Floral Heart Lava Texture Minimalist Statement Finger Jewelry
$3.41-5.11
No MOQ
 · 
12 views
Free Shipping
Minimalist Stainless Steel Continuous Heart Shaped Band Ring For Women Fashion Korean Style Gold Silver Black Finger Ring
Minimalist Stainless Steel Continuous Heart Shaped Band Ring For Women Fashion Korean Style Gold Silver Black Finger Ring
like
Find Similar
Detailed view of silver heart ring band with 3mm width specification on white background - US 6 / Silver
Detail view of 3mm gold heart ring with continuous heart patterns and polished finish - US 6 / Gold
Macro detail of minimalist black heart clover ring band showing 3mm width measurement - US 6 / Black
+18
Minimalist Stainless Steel Continuous Heart Shaped Band Ring For Women Fashion Korean Style Gold Silver Black Finger Ring
-5%
$0.50-0.57
No MOQ
 · 
35 sold recently
Free Shipping
French Vintage 304 Stainless Steel Heart Evil Eye Open Ring For Women Personalized Fashion Adjustable Enamel Drip Oil Polished Finger Ring Jewelry
French Vintage 304 Stainless Steel Heart Evil Eye Open Ring For Women Personalized Fashion Adjustable Enamel Drip Oil Polished Finger Ring Jewelry
like
Find Similar
Detail of silver vintage heart ring with black enamel eye and 0.9cm width dimensions - Silver Band-Black Heart
Macro detail of vintage gold heart ring with enamel eye design on beige velvet - Gold Band-White Heart
Macro shot of vintage gold heart ring with black enamel and dimensions on silk - Gold Band-Black Heart
French Vintage 304 Stainless Steel Heart Evil Eye Open Ring For Women Personalized Fashion Adjustable Enamel Drip Oil Polished Finger Ring Jewelry
$0.78-1.05
Mix MOQ : 2
 · 
15 sold recently
Free Shipping
Hip Hop Fashion Titanium Steel Gold Plated Crossed Intertwined Ring For Men Women Rhinestone Pave Geometric Band Ring Jewelry
Hip Hop Fashion Titanium Steel Gold Plated Crossed Intertwined Ring For Men Women Rhinestone Pave Geometric Band Ring Jewelry
like
Find Similar
Polished gold plated titanium steel ring with three interlocking bands and pave crystals - US 7 / Gold
Detailed close-up of a silver crossover ring with polished bands and sparkling crystals - US 7 / Steel
+6
Hip Hop Fashion Titanium Steel Gold Plated Crossed Intertwined Ring For Men Women Rhinestone Pave Geometric Band Ring Jewelry
$3.01-3.27
No MOQ
 · 
14 views
Free Shipping
Minimalist Titanium Steel Stacked Rings For Women Gold Silver Plated Interlocking Circles Rhinestone Fashion Finger Ring
Minimalist Titanium Steel Stacked Rings For Women Gold Silver Plated Interlocking Circles Rhinestone Fashion Finger Ring
like
Find Similar
Stacked titanium steel rings set with gold and silver bands featuring three clear zircon gems - US 6 / Gold
Polished titanium steel interlinked stacking rings with sparkling zircon accents - US 6 / Silver
+8
Minimalist Titanium Steel Stacked Rings For Women Gold Silver Plated Interlocking Circles Rhinestone Fashion Finger Ring
$2.23
No MOQ
 · 
25 sold recently
Free Shipping
Vintage Stainless Steel Slave Chain Ring Set For Women Gold Butterfly Flower Star Zircon Double Finger Ring Jewelry
Vintage Stainless Steel Slave Chain Ring Set For Women Gold Butterfly Flower Star Zircon Double Finger Ring Jewelry
like
Find Similar
Detail view of gold butterfly chain double ring with bohemian textured coin patterns - Single Zircon and Bohemian Hollow Style (S-R874-A)
Vintage golden stainless steel double ring with floral design and chain link - Zircon Five-Petal Flower Link Style (S-R874-B)
Vintage gold stainless steel star chain ring set with multi-layer hollowed design - Star Embossed and Multi-Layer Hollow Style (S-R874-E)
Vintage Stainless Steel Slave Chain Ring Set For Women Gold Butterfly Flower Star Zircon Double Finger Ring Jewelry
-4%
$1.94-2.12
No MOQ
 · 
34 sold recently
Top 10% Best Sellers
in Rings
Free Shipping
Men Signet Ring Titanium Steel Square Band Carbon Fiber Inlay Fashion Jewelry For Men Daily Party Style Accessory
Men Signet Ring Titanium Steel Square Band Carbon Fiber Inlay Fashion Jewelry For Men Daily Party Style Accessory
like
Find Similar
Men's gold brushed titanium ring with square black carbon fiber inlay design - US 7 / Gold
Mens square signet ring in silver stainless steel with black carbon fiber inlay - US 7 / Silver
Polished black stainless steel signet ring with inlaid carbon fiber pattern texture - US 7 / Black
+18
Men Signet Ring Titanium Steel Square Band Carbon Fiber Inlay Fashion Jewelry For Men Daily Party Style Accessory
-4%
$1.96-1.98
No MOQ
 · 
17 sold recently
Free Shipping
Titanium Steel Spinner Ring For Men Women Punk Style Animal Paw Print Rotatable Stress Relief Fashion Jewelry Finger Ring
Titanium Steel Spinner Ring For Men Women Punk Style Animal Paw Print Rotatable Stress Relief Fashion Jewelry Finger Ring
like
Find Similar
8mm spinner ring with black paw print patterns on rotating stainless steel band - US 6 / Silver
Rotatable 8mm golden stainless steel band with black paw prints for stress relief - US 6 / Gold
Black 8mm titanium steel ring with red paw prints shown from a 45-degree angle - US 6 / Black & Red
8mm black matte stainless steel spinning ring featuring white animal paw print patterns - US 6 / Black & White
+24
Titanium Steel Spinner Ring For Men Women Punk Style Animal Paw Print Rotatable Stress Relief Fashion Jewelry Finger Ring
-5%
$1.74-1.99
No MOQ
Free Shipping
Vintage Men Titanium Steel Ring Square Rhinestone Inlaid Gold Plated Geometric Fashion Signet Ring For Daily Party Gift
Vintage Men Titanium Steel Ring Square Rhinestone Inlaid Gold Plated Geometric Fashion Signet Ring For Daily Party Gift
like
Find Similar
Detail of gold titanium ring with square black gemstone and side groove textures - US 7 / Gold Tone Black Rhinestone
Men's titanium steel ring with a large red square gemstone and gold finish - US 7 / Gold with Red Rhinestones
Detail of square-cut blue gemstone and golden grooved band on men's titanium ring - US 7 / Gold Dark Blue Rhinestone
Detail of gold-plated signet ring featuring a large square-cut green gemstone and grooved band - US 7 / Gold Green Zirconia
+38
Vintage Men Titanium Steel Ring Square Rhinestone Inlaid Gold Plated Geometric Fashion Signet Ring For Daily Party Gift
$3.14
No MOQ
Free Shipping
Retro Punk Alloy Dragon Claw Eagle Claw Ring For Men Vintage Gothic Animal Open Adjustable Ring Jewelry Gift
Retro Punk Alloy Dragon Claw Eagle Claw Ring For Men Vintage Gothic Animal Open Adjustable Ring Jewelry Gift
like
Find Similar
Vintage punk dragon claw ring in stainless steel with detailed scale texture on white background - Eagle Claw
Detailed close-up of antique silver wolf head ring with vintage punk aesthetic carvings - Wolf Head
Vintage guitar style biomechanical men's ring in antique silver punk finish - Guitar
Detailed close-up of antique silver snake ring with textured scales and geometric head design - Silver Snake
+14
Retro Punk Alloy Dragon Claw Eagle Claw Ring For Men Vintage Gothic Animal Open Adjustable Ring Jewelry Gift
$0.05-0.58
No MOQ
 · 
51 sold recently
Butterfly Flower Crown Heart Ring Brass 18K Gold Plated Zircon Inlaid Adjustable Open Finger Band Fairy Aesthetic Women
Butterfly Flower Crown Heart Ring Brass 18K Gold Plated Zircon Inlaid Adjustable Open Finger Band Fairy Aesthetic Women
like
Find Similar
Elegant gold crown ring with pink marquise zircon and sparkling white crystals - Gold / Crown V-Shape Style (Style 1)
Adjustable gold flower ring with sparkling pink and purple cubic zirconia stones - Gold / Triple Flower Style (Style 2)
Slim gold-plated ring with colorful pavé crystals in a grey velvet jewelry box - Gold / Colorful Eternity Style (Style 3)
Floral butterfly ring in gold finish with pink green and white zircon stones - Gold / Flower Cluster Style (Style 4)
+42
Butterfly Flower Crown Heart Ring Brass 18K Gold Plated Zircon Inlaid Adjustable Open Finger Band Fairy Aesthetic Women
$1.45-1.60
No MOQ
 · 
793 sold recently
Top 3% Best Sellers
in Rings
Free Shipping
8mm American Flag Ring For Men Titanium Steel Electroplated Band Ring Gold Silver Patriotic Jewelry Independence Day Gift
8mm American Flag Ring For Men Titanium Steel Electroplated Band Ring Gold Silver Patriotic Jewelry Independence Day Gift
like
Find Similar
Golden 8mm wide stainless steel ring with laser engraved American flag pattern - US 6 / Gold
8mm stainless steel ring for men featuring an engraved American flag pattern design - US 6 / Silver
+14
8mm American Flag Ring For Men Titanium Steel Electroplated Band Ring Gold Silver Patriotic Jewelry Independence Day Gift
$0.39-0.52
No MOQ
 · 
31 sold recently
Unisex Wave Pattern Titanium Steel Ring Geometric Minimalist Band For Men Women Trendy Personality Electroplated Jewelry Gift
Unisex Wave Pattern Titanium Steel Ring Geometric Minimalist Band For Men Women Trendy Personality Electroplated Jewelry Gift
like
Find Similar
Detailed view of silver wave texture and polished finish on a stainless steel ring - US 6 / Silver
Unisex rainbow stainless steel ring featuring wavy textures and colorful plating - US 6 / Colorful
Unisex black stainless steel wave pattern ring with matte texture and polished inner band - US 6 / Black
+18
Unisex Wave Pattern Titanium Steel Ring Geometric Minimalist Band For Men Women Trendy Personality Electroplated Jewelry Gift
-5%
$1.24-1.49
No MOQ
 · 
22 sold recently
Free Shipping
Men Hip Hop Ring Alloy Cubic Zirconia Iced Out Square Geometric Bling Statement Party Fashion Jewelry
Men Hip Hop Ring Alloy Cubic Zirconia Iced Out Square Geometric Bling Statement Party Fashion Jewelry
like
Find Similar
Macro view of a gold-plated men's ring featuring a large square center stone and pavé setting - US 8 / Gold
Icy square cut clear gemstone ring with double halo diamonds and micro-pave band in silver - US 7 / Silver
+12
Men Hip Hop Ring Alloy Cubic Zirconia Iced Out Square Geometric Bling Statement Party Fashion Jewelry
$0.92
No MOQ
 · 
337 sold recently
Top 10% Best Sellers
in Rings
Free Shipping
Vintage Men Chinese Dragon Adjustable Open Ring Silver Plated Alloy Animal Motif Gothic Punk Style Domineering Finger Jewelry
Vintage Men Chinese Dragon Adjustable Open Ring Silver Plated Alloy Animal Motif Gothic Punk Style Domineering Finger Jewelry
like
Find Similar
Vintage silver-plated Chinese dragon open ring featuring intricate dragon scale textures - Silver Dragon Style
Vintage punk dragon claw ring in stainless steel with detailed scale texture on white background - Eagle Claw Shape
Detailed close-up of antique silver wolf head ring with vintage punk aesthetic carvings - Wolf Head Design
Vintage guitar style biomechanical men's ring in antique silver punk finish - Guitar Shape
+14
Vintage Men Chinese Dragon Adjustable Open Ring Silver Plated Alloy Animal Motif Gothic Punk Style Domineering Finger Jewelry
$0.05-0.58
No MOQ
 · 
37 sold recently
Hip Hop Dollar Sign Ring For Men Iced Out Rhinestone Stainless Steel Vacuum Plated Gold Punk Geometric Jewelry Finger Ring
Hip Hop Dollar Sign Ring For Men Iced Out Rhinestone Stainless Steel Vacuum Plated Gold Punk Geometric Jewelry Finger Ring
like
Find Similar
Iced out gold plated dollar sign hip hop ring for men with micro paved zircons - US 7 / Gold
+6
Hip Hop Dollar Sign Ring For Men Iced Out Rhinestone Stainless Steel Vacuum Plated Gold Punk Geometric Jewelry Finger Ring
$3.41
No MOQ
 · 
10 sold recently
Free Shipping
Stainless Steel Rotatable Spinner Ring Sport Theme Basketball Soccer Rugby Baseball Pattern Men Women Fashion Jewelry Ring
Stainless Steel Rotatable Spinner Ring Sport Theme Basketball Soccer Rugby Baseball Pattern Men Women Fashion Jewelry Ring
like
Find Similar
Detail shot of 8mm wide rotatable basketball ring with orange leather texture and steel band - US 6 / Basketball Style
Detail of 8mm rotating rugby ring in stainless steel with brown texture and white stitching - US 6 / Rugby Football Style
Detail shot of 8mm rotatable soccer ring made of polished stainless steel and leather - US 6 / Soccer Style
Macro detail of rotating baseball ring showing 8mm width and 5g weight parameters - US 6 / Baseball Style
+28
Stainless Steel Rotatable Spinner Ring Sport Theme Basketball Soccer Rugby Baseball Pattern Men Women Fashion Jewelry Ring
$2.20
No MOQ
 · 
19 views
Free Shipping
Modern Stainless Steel Spinner Rings For Men Women Hammered Texture Chain Rotating Greek Key Rhinestone Fashion Jewelry Rings
Modern Stainless Steel Spinner Rings For Men Women Hammered Texture Chain Rotating Greek Key Rhinestone Fashion Jewelry Rings
like
Find Similar
Set of 12 silver titanium steel rings for men featuring chain and greek key textures - US 7 / Silver
12pcs men's titanium steel ring set with chain spinner and matte black signet designs - US 7 / Black
Macro shot of 12-piece men's titanium steel rings set in gold and silver finish - US 7 / Gold
+18
Modern Stainless Steel Spinner Rings For Men Women Hammered Texture Chain Rotating Greek Key Rhinestone Fashion Jewelry Rings
$7.86-9.17
No MOQ
 · 
10 views
Free Shipping
Vintage Titanium Steel Eagle Ring For Men Women Distressed Gothic Punk Jewelry Feather Texture Relief Animal Band Ring
Vintage Titanium Steel Eagle Ring For Men Women Distressed Gothic Punk Jewelry Feather Texture Relief Animal Band Ring
like
Find Similar
10 options
Vintage Titanium Steel Eagle Ring For Men Women Distressed Gothic Punk Jewelry Feather Texture Relief Animal Band Ring
-5%
$3.19-3.68
No MOQ
Free Shipping
Handmade Vintage Dried Flower Resin Stainless Steel Ring Adjustable Open Floral Finger Ring For Women Fashion Jewelry Gift
Handmade Vintage Dried Flower Resin Stainless Steel Ring Adjustable Open Floral Finger Ring For Women Fashion Jewelry Gift
like
Find Similar
Handmade oil painting style dried flower ring with gold textured open stainless steel band - Green Base White Dried Flower Gold Band Style (A款)
Detail of oval silver ring featuring purple dried flowers and gold leaf inside the resin - Purple Dried Flower Silver Band Style (B款)
Close-up of handmade gold ring with pink resin, yellow dried flowers and hammered texture - Pink Base Yellow Dried Flower Gold Band Style (C款)
Close-up of handmade oval ring with blue dried flowers and silver hammered texture - White Base Blue Dried Flower Silver Band Style (D款)
Handmade Vintage Dried Flower Resin Stainless Steel Ring Adjustable Open Floral Finger Ring For Women Fashion Jewelry Gift
$3.67
Mix MOQ : 2
 · 
25 sold recently
Free Shipping
Vintage Titanium Steel Fox Ring Retro Marcasite Inlay Animal Wrap Band For Men Women Antique Silver Jewelry
Vintage Titanium Steel Fox Ring Retro Marcasite Inlay Animal Wrap Band For Men Women Antique Silver Jewelry
like
Find Similar
Vintage oxidized silver fox ring with marcasite stones and unique wraparound design - US 7 / Antique Silver
Vintage Titanium Steel Fox Ring Retro Marcasite Inlay Animal Wrap Band For Men Women Antique Silver Jewelry
-5%
$3.73
No MOQ
Free Shipping
Vintage Titanium Steel Tree Of Life Signet Ring For Men Retro Punk Style Round Finger Ring For Wedding Party Jewelry
Vintage Titanium Steel Tree Of Life Signet Ring For Men Retro Punk Style Round Finger Ring For Wedding Party Jewelry
like
Find Similar
Mens silver stainless steel signet ring featuring a detailed tree of life relief on rock - US 7 / Silver
Gold stainless steel signet ring for men featuring a detailed tree of life relief design - US 7 / Gold
+12
Vintage Titanium Steel Tree Of Life Signet Ring For Men Retro Punk Style Round Finger Ring For Wedding Party Jewelry
$1.70-1.83
No MOQ
 · 
13 sold recently
Free Shipping
Vintage Stainless Steel Wood Inlaid Ring For Men Gold Foil Cracked Texture Pattern Wide Band Fashion Jewelry Unisex Gift
Vintage Stainless Steel Wood Inlaid Ring For Men Gold Foil Cracked Texture Pattern Wide Band Fashion Jewelry Unisex Gift
like
Find Similar
Detailed shot of 8mm blue metallic ring with wood grain texture and gold wire inlay - US 6 / Blue
Detailed macro view of 8mm black matte ring with gold foil and wood grain inlay - US 6 / Black
Retro 8mm silver steel ring with brown wood grain inlay and gold foil marble texture - US 6 / Silver
Macro detail of 8mm gold ring featuring vintage wood grain and marble resin inlay - US 6 / Gold
+28
Vintage Stainless Steel Wood Inlaid Ring For Men Gold Foil Cracked Texture Pattern Wide Band Fashion Jewelry Unisex Gift
$0.92
No MOQ
 · 
137 sold recently
Free Shipping
Men Alloy Nugget Texture Adjustable Band Rings Hip Hop Punk Lava Irregular Vintage Fashion Jewelry For Men Daily Party Accessory
Men Alloy Nugget Texture Adjustable Band Rings Hip Hop Punk Lava Irregular Vintage Fashion Jewelry For Men Daily Party Accessory
like
Find Similar
Three-piece gold textured adjustable alloy ring set for men in trendy hip hop style - Gold
Three-piece silver alloy rings set with lava hammered texture and adjustable open bands - Silver
Men Alloy Nugget Texture Adjustable Band Rings Hip Hop Punk Lava Irregular Vintage Fashion Jewelry For Men Daily Party Accessory
$1.28
No MOQ
Trendy Stainless Steel Cross Signet Ring For Men Women Gothic Punk Rhinestone Inlaid Gold Silver Black Plated Fashion Jewelry Band Ring
Trendy Stainless Steel Cross Signet Ring For Men Women Gothic Punk Rhinestone Inlaid Gold Silver Black Plated Fashion Jewelry Band Ring
like
Find Similar
Men's silver stainless steel signet ring with inlaid cross and white stones on white background - US 6 / Silver
Polished gold signet ring with recessed cross and sparkling white cubic zirconia stones - US 6 / Gold
Men's black stainless steel ring with crystal cross pattern in minimalist matte finish - US 6 / Black
+21
Trendy Stainless Steel Cross Signet Ring For Men Women Gothic Punk Rhinestone Inlaid Gold Silver Black Plated Fashion Jewelry Band Ring
-4%
$2.74-3.24
No MOQ
Free Shipping
Retro Stainless Steel Evil Eye Spinner Ring For Men Women Relief Pattern Relief Embossed Anxiety Relief Spinner Band Ring
Retro Stainless Steel Evil Eye Spinner Ring For Men Women Relief Pattern Relief Embossed Anxiety Relief Spinner Band Ring
like
Find Similar
Vintage stainless steel spinner ring with engraved eye patterns on a wide silver band - US 7 / Steel
Stainless steel spinning ring with embossed eye pattern and black matte textured finish - US 7 / Black
Golden stainless steel spinner ring featuring embossed evil eye patterns on white background - US 7 / Gold
Gold spinner ring with evil eye relief motifs and rotating polished stainless steel band - US 7 / Gold Black
+32
Retro Stainless Steel Evil Eye Spinner Ring For Men Women Relief Pattern Relief Embossed Anxiety Relief Spinner Band Ring
$2.75-3.01
No MOQ
Free Shipping
Vintage Stainless Steel Enamel Floral Open Ring Gold Plated Sunflower Relief Adjustable Finger Jewelry For Women Daily
Vintage Stainless Steel Enamel Floral Open Ring Gold Plated Sunflower Relief Adjustable Finger Jewelry For Women Daily
like
Find Similar
Vintage lavender purple floral open ring with golden embossed flower patterns - Lavender
Vintage floral enamel ring with hand-painted gold flowers on a pink background - Pink
Vintage gold-plated floral ring with white enamel and 3D flower petals for women - White
Macro shot of vintage gold flower patterns on a green enamel wide band ring - Green
+1
Vintage Stainless Steel Enamel Floral Open Ring Gold Plated Sunflower Relief Adjustable Finger Jewelry For Women Daily
-4%
$1.62
No MOQ
 · 
14 sold recently
Free Shipping
Dolphin Pattern Stainless Steel Ring Personalized Animal Band Ring Enamel Drip Oil Fashion Jewelry For Men Women Gift
Dolphin Pattern Stainless Steel Ring Personalized Animal Band Ring Enamel Drip Oil Fashion Jewelry For Men Women Gift
like
Find Similar
Detail of two-tone steel ring featuring a gold leaf pattern and glitter finish - US 7 / Gold with Gold Gear
Polished silver stainless steel ring featuring a dark grey frosted dolphin pattern inlay - US 7 / Silver Base Silver Plate
Silver stainless steel ring with blue glitter inlay and golden dolphin patterns - US 7 / Blue with Gold Gear
Polished stainless steel wide ring with black enamel band and golden dolphin pattern - US 7 / Black Gold
+36
Dolphin Pattern Stainless Steel Ring Personalized Animal Band Ring Enamel Drip Oil Fashion Jewelry For Men Women Gift
-5%
$1.12
Mix MOQ : 10
Free Shipping
Stainless Steel Rings For Women Gold Rose Gold Titanium Zircon Inlaid Minimalist Forever Love Roman Numeral Heart Clover
Stainless Steel Rings For Women Gold Rose Gold Titanium Zircon Inlaid Minimalist Forever Love Roman Numeral Heart Clover
like
Find Similar
Close-up of sparkling silver eternity ring with square cubic zirconia stones on wood - XS / Eternity Band Style / Steel
Macro view of rose gold channel-set ring with square zirconia crystals on beige texture - XS / Eternity Band Style / Rose Gold
Close-up of rose gold stainless steel ring with double-row sparkling crystals inlay - XS / Multi-Row Eternity Band Style / Rose Gold
Close-up of a double-row sparkling zircon silver ring with premium polished finish - 7-b-2 Steel-colored Two-row Square Diamond / Size 5
+245
Stainless Steel Rings For Women Gold Rose Gold Titanium Zircon Inlaid Minimalist Forever Love Roman Numeral Heart Clover
$0.13-0.86
No MOQ
 · 
885 sold recently
Top 10% Best Sellers
in Rings
Free Shipping
Vintage Alloy Ring Constellation Zodiac Sign Carved Portrait Synthetic Gemstone Bohemian Retro Women Jewelry
Vintage Alloy Ring Constellation Zodiac Sign Carved Portrait Synthetic Gemstone Bohemian Retro Women Jewelry
like
Find Similar
Vintage bohemian celestial ring with engraved star moon motifs and clear zircon stone - US 5 / Star Moon Ring
Vintage Taurus alloy ring with floral relief and green gemstone on dark fur background - US 5 / Taurus
Detail of vintage Capricorn alloy ring featuring girl relief and red ruby floral accents - US 5 / Capricorn
Vintage Aries zodiac ring with relief woman profile and floral accents for women - US 5 / Aries
+129
Vintage Alloy Ring Constellation Zodiac Sign Carved Portrait Synthetic Gemstone Bohemian Retro Women Jewelry
$0.79
No MOQ
 · 
546 sold recently
Top 3% Best Sellers
in Rings
Free Shipping
Stainless Steel Billiard 8 Ball Signet Ring Retro Western Streetwear Hip Hop Enamel Band Ring For Men Women Jewelry
Stainless Steel Billiard 8 Ball Signet Ring Retro Western Streetwear Hip Hop Enamel Band Ring For Men Women Jewelry
like
Find Similar
Men's silver titanium steel signet ring featuring a vintage billiard black number 8 design - US 6 / Steel Black Enamel
Men's gold titanium ring with black billiard number 8 signet design in punk style - US 6 / Gold Black Enamel
Detailed view of billiard number 8 pool ball ring made of titanium steel with purple enamel - US 6 / Steel Purple Enamel
Men's vintage titanium steel wide ring featuring a purple billiard 8-ball design element - US 6 / Gold Purple Enamel
+36
Stainless Steel Billiard 8 Ball Signet Ring Retro Western Streetwear Hip Hop Enamel Band Ring For Men Women Jewelry
$2.88-3.14
No MOQ
 · 
12 views
Free Shipping
Vintage Men Retro Copper Ring Set Gothic Punk Adjustable Open Ring Antique Silver Gold Color Fox Cross Crown Ring Jewelry Gift
Vintage Men Retro Copper Ring Set Gothic Punk Adjustable Open Ring Antique Silver Gold Color Fox Cross Crown Ring Jewelry Gift
like
Find Similar
Vintage Thai silver style wide ring with kitsune relief and Celtic knot patterns - Adjustable Open / Kitsune Fox (J970)
Vintage silver stackable ring for men with golden crown relief and sparkling crystal inlay - Adjustable Open / Crown (J1306)
Men's vintage gothic cross ring in silver steel with geometric carved patterns - Adjustable Open / Cross (J982)
Close-up of vintage silver ring with engraved Chinese characters and adjustable open band - Adjustable Open / Eternal Happiness (J1205)
+10
Vintage Men Retro Copper Ring Set Gothic Punk Adjustable Open Ring Antique Silver Gold Color Fox Cross Crown Ring Jewelry Gift
$0.86-1.57
No MOQ
 · 
1 reviews
Free Shipping
Handmade Chinese Style Stainless Steel Open Ring Rectangle Resin Real Dried Flower Botanical Leaf Adjustable Ring Jewelry Gift
Handmade Chinese Style Stainless Steel Open Ring Rectangle Resin Real Dried Flower Botanical Leaf Adjustable Ring Jewelry Gift
like
Find Similar
Handmade Chinese style gold open ring featuring rectangle dried purple flower resin inlay - Dancing Grass/Orange
Handmade Chinese style gold open ring featuring red dried flower resin rectangular inlay - Pearl Plum
Handmade Chinese style open ring with real pink dried flowers in gold metal frame - Lace Flower
Macro shot of rectangular resin ring with dried white and purple flowers on crystal - Emerald Bead
+2
Handmade Chinese Style Stainless Steel Open Ring Rectangle Resin Real Dried Flower Botanical Leaf Adjustable Ring Jewelry Gift
$3.41-3.67
Mix MOQ : 2
 · 
19 sold recently
Free Shipping
Stainless Steel Spinner Ring For Men Women Roman Numerals Rotatable Chain Ring Punk Industrial Style Band Jewelry Ring Gift
Stainless Steel Spinner Ring For Men Women Roman Numerals Rotatable Chain Ring Punk Industrial Style Band Jewelry Ring Gift
like
Find Similar
Gold stainless steel spinner ring with rotatable cuban chain inlay for men - US 5 / Embossed Chain Spinner Style / Gold
Polished silver spinner ring with a rotating stainless steel chain and Roman numerals - US 5 / Embossed Chain Spinner Style / Steel
Polished stainless steel spinner ring featuring a central rotating Cuban link chain design - US 5 / Cuban Chain Inlay Style / Steel
Men's two-tone rotatable Cuban chain ring in black and silver polished stainless steel - 23-c-1 Black Chain Ring / Size 5
+192
Stainless Steel Spinner Ring For Men Women Roman Numerals Rotatable Chain Ring Punk Industrial Style Band Jewelry Ring Gift
$0.16-0.49
No MOQ
Free Shipping
Minimalist Titanium Steel Thin Gear Embossed Ring For Women Fashion Diamond Cut Texture Band Rose Gold Silver Finger Jewelry
Minimalist Titanium Steel Thin Gear Embossed Ring For Women Fashion Diamond Cut Texture Band Rose Gold Silver Finger Jewelry
like
Find Similar
Minimalist silver textured ring with diamond-cut gear engraving for women's fashion - US 6 / Silver
Minimalist rose gold ring with hammered texture in an ultra-slim elegant design - US 6 / Rose Gold
Minimalist gold-plated slim ring featuring diamond-cut texture and elegant gear embossing - US 5 / Gold
+15
Minimalist Titanium Steel Thin Gear Embossed Ring For Women Fashion Diamond Cut Texture Band Rose Gold Silver Finger Jewelry
-5%
$0.75-0.87
No MOQ
 · 
15 sold recently
Free Shipping
925 Sterling Silver Open Rings For Women Irregular Lava Texture Minimalist Heart Moon Star Flower Adjustable Fashion Jewelry
925 Sterling Silver Open Rings For Women Irregular Lava Texture Minimalist Heart Moon Star Flower Adjustable Fashion Jewelry
like
Find Similar
Adjustable 925 sterling silver ring featuring organic lava texture and handmade finish - Irregular Lava Pleated Style (J7291)
Unique 925 sterling silver open ring with irregular lava texture and metallic finish - Irregular Pleated Texture Style (J7281)
Unique 925 sterling silver ring with handmade hammered texture and adjustable open band - Handmade Hammered Texture Style (J7289)
Handcrafted 925 sterling silver ring with organic hammered texture and small ring charm - Ring Pendant Hammered Texture Style (J7290)
+32
925 Sterling Silver Open Rings For Women Irregular Lava Texture Minimalist Heart Moon Star Flower Adjustable Fashion Jewelry
$0.73-0.92
No MOQ
 · 
11 sold recently
Free Shipping
Minimalist Stainless Steel Rings For Women Silver Geometric Horsebit Chain Heart Adjustable Fashion Jewelry Accessories
Minimalist Stainless Steel Rings For Women Silver Geometric Horsebit Chain Heart Adjustable Fashion Jewelry Accessories
like
Find Similar
Silver stainless steel open ring with irregular wave design and modern minimalist style - Wave Irregular Curve Style (JDRW2305068-S) / Inner Diameter 1.85cm
Irregular textured titanium steel open ring with handcrafted hammered silver finish - Hammered Irregular Curve Style (JDR202399-S) / Inner Diameter 1.68cm
Silver stainless steel double heart open ring with dimension labels and waterproof features - Double Heart Open Style (JDR0211009-S) / Outer Diameter 1.71cm
French vintage silver titanium steel open ring featuring irregular wave texture and layers - Multilayer Liquid Metal Wave Style (JDR202409-S) / Inner Diameter 1.57cm
+1
Minimalist Stainless Steel Rings For Women Silver Geometric Horsebit Chain Heart Adjustable Fashion Jewelry Accessories
$1.57-4.19
No MOQ
 · 
11 sold recently
Free Shipping
Men's Fashion Stainless Steel Carbon Fiber Ring Hip Hop Polished Mirror Finish Geometric Finger Ring For Teens Unisex Jewelry
Men's Fashion Stainless Steel Carbon Fiber Ring Hip Hop Polished Mirror Finish Geometric Finger Ring For Teens Unisex Jewelry
like
Find Similar
Polished silver stainless steel ring with a stylish black carbon fiber inlay design - Size 7 / Steel
Men's black titanium ring with carbon fiber inlay and polished finish detail - Size 7 / Black
+10
Men's Fashion Stainless Steel Carbon Fiber Ring Hip Hop Polished Mirror Finish Geometric Finger Ring For Teens Unisex Jewelry
$1.96-2.23
No MOQ
 · 
12 sold recently
Free Shipping
Fashion Gold Plated Alloy Enamel Adjustable Open Ring For Men Women Colorful Letters Heart Flower Smiley Face Hip Hop Jewelry
Fashion Gold Plated Alloy Enamel Adjustable Open Ring For Men Women Colorful Letters Heart Flower Smiley Face Hip Hop Jewelry
like
Find Similar
Gold-plated ring with colorful Fuck You enamel lettering on a minimalist band - Adjustable Open / FUCK YOU Lettering Style
Pink enamel flower ring with gold plating and stylish floral patterns in minimalist style - Adjustable Open / Flower Style
Gold-plated heart ring with pink and red enamel oil drips in a sweet minimalist style - Adjustable Open / Heart Style
Golden band ring featuring colorful enamel smiley face patterns in a minimalist style - Adjustable Open / Smile Face Style
Fashion Gold Plated Alloy Enamel Adjustable Open Ring For Men Women Colorful Letters Heart Flower Smiley Face Hip Hop Jewelry
$0.41
No MOQ
 · 
43 sold recently
Free Shipping
Fingertip Nail Rings Zircon Butterfly Heart Crown Adjustable Copper Inlaid Luxury Elegant Jewelry For Women
Fingertip Nail Rings Zircon Butterfly Heart Crown Adjustable Copper Inlaid Luxury Elegant Jewelry For Women
like
Find Similar
Adjustable golden nail ring with double oval zircon pavé setting in modern style - Double Overlapping Oval Style (9913) / Light KC Gold
Luxury silver-toned zircon nail ring with overlapping oval hollow design for women - Overlapping Oval Pave Hollow Ring (9992) / White Gold
Geometric gold-plated double-layer nail ring with sparkling pave-set white zircons - Double-Layer Geometric Hollow Style (9859) / Light KC Gold
Geometric silver fingernail ring with sparkling rhinestones in an open-end design - Double-Layer Parallel Arch Style (9867) / White Gold
+75
Fingertip Nail Rings Zircon Butterfly Heart Crown Adjustable Copper Inlaid Luxury Elegant Jewelry For Women
-6%
$0.24-5.19
No MOQ
 · 
47 sold recently
Free Shipping
Vintage Stainless Steel Lion Head Ring For Men Punk Biker Domineering Red Rhinestone Eye Animal Finger Ring Fashion Jewelry
Vintage Stainless Steel Lion Head Ring For Men Punk Biker Domineering Red Rhinestone Eye Animal Finger Ring Fashion Jewelry
like
Find Similar
Silver lion head ring for men with vintage carving and red zircon eyes detail - US 7 / Steel
Men's vintage lion head ring with gold and silver finish and red zircon eyes - US 7 / Two-tone (Gold & Silver)
Bold lion head ring in gold finish with red zircon eyes and intricate mane texture - US 7 / Gold
Bold golden lion head ring with red rhinestone eyes in a polished punk rock style - US 7 / Gold Black
+41
Vintage Stainless Steel Lion Head Ring For Men Punk Biker Domineering Red Rhinestone Eye Animal Finger Ring Fashion Jewelry
$3.35
No MOQ
 · 
1 reviews
Free Shipping
Hip Hop Men Five Point Star Ring Titanium Steel Full Zirconia Inlaid Gold Silver Color Geometric Band Ring Party Jewelry
Hip Hop Men Five Point Star Ring Titanium Steel Full Zirconia Inlaid Gold Silver Color Geometric Band Ring Party Jewelry
like
Find Similar
Hip-hop gold star ring with full pavé cubic zirconia inlay in stainless steel - US 7 / Gold
Macro shot of hip-hop pentagram ring with iced-out pave diamonds on wide steel band - US 7 / Steel
+12
Hip Hop Men Five Point Star Ring Titanium Steel Full Zirconia Inlaid Gold Silver Color Geometric Band Ring Party Jewelry
-5%
$3.61-3.86
No MOQ
Free Shipping
Stainless Steel Ring Simple Mirror Polished Glossy Band Ring For Men Women Minimalist Fashion Jewelry
Stainless Steel Ring Simple Mirror Polished Glossy Band Ring For Men Women Minimalist Fashion Jewelry
like
Find Similar
Macro detail of 8mm silver stainless steel ring featuring polished mirror surface and beveled edges - US 5 / Silver Mirror
Polished 8mm rainbow titanium steel ring showing smooth metallic finish and vibrant colors - US 5 / Mirror Rainbow
Minimalist 8mm black mirror polished stainless steel ring on a white background - US 5 / Black Mirror
Classic 8mm deep blue mirror polished stainless steel ring shown in a side floating view - US 5 / Mirror Blue
+50
Stainless Steel Ring Simple Mirror Polished Glossy Band Ring For Men Women Minimalist Fashion Jewelry
-6%
$0.15-0.28
Mix MOQ : 2
 · 
23K+ sold recently
Top 3% Best Sellers
in Rings
Bohemian Stainless Steel Turquoise Open Ring For Women Vintage Evil Eye Mandala Sun Pattern Adjustable Retro Jewelry Ring
Bohemian Stainless Steel Turquoise Open Ring For Women Vintage Evil Eye Mandala Sun Pattern Adjustable Retro Jewelry Ring
like
Find Similar
Three-layer golden ring with turquoise stone, 1.3cm width and 3g weight specifications - Triple Layer Band Style (RC-1035G)
Macro shot of turquoise evil eye ring in gold showing diameter and weight measurements - Evil Eye Design Style (RC-1036G)
Detail view of gold turquoise ring with beadwork design showing 1.35cm size dimension - Sun Pattern Design Style (RC-1037G)
Bohemian Stainless Steel Turquoise Open Ring For Women Vintage Evil Eye Mandala Sun Pattern Adjustable Retro Jewelry Ring
$1.05-1.44
No MOQ
Free Shipping
Retro Geometric Stripe Enamel Stainless Steel Open Ring Macaron Glazed Color Adjustable Finger Ring For Women Vintage Aesthetic Jewelry
Retro Geometric Stripe Enamel Stainless Steel Open Ring Macaron Glazed Color Adjustable Finger Ring For Women Vintage Aesthetic Jewelry
like
Find Similar
Detail of gold enamel ring with orange and pink marble textures and golden triangles - Orange Pink Marble
Irregular striped enamel open ring in peach orange and marble white gold finish - Peach Orange White
Detail view of irregular geometric ring with colorful enamel inlay and dimension labels - Cherry Pink Purple
Macro shot of colorful enamel irregular striped gold open ring on white geometric background - Purple Green Pink Collage
+1
Retro Geometric Stripe Enamel Stainless Steel Open Ring Macaron Glazed Color Adjustable Finger Ring For Women Vintage Aesthetic Jewelry
$1.70
No MOQ
 · 
12 sold recently
Free Shipping
Vintage Geometric Frog Eye Stainless Steel Ring For Men Women Fashion Commuter Gold Silver Color Finger Jewelry Accessory
Vintage Geometric Frog Eye Stainless Steel Ring For Men Women Fashion Commuter Gold Silver Color Finger Jewelry Accessory
like
Find Similar
Retro frog-shaped stainless steel ring in silver with a 45-degree angle top view - US 7 / Frog Shape / Steel
Vintage geometric round stainless steel ring with antique silver finish and dual beads - US 7 / Vintage Ball Shape / Antique Silver
Modern geometric wavy ring with decorative screw head accents in gold-plated steel - US 7 / Screw Wave Design / Gold
+18
Vintage Geometric Frog Eye Stainless Steel Ring For Men Women Fashion Commuter Gold Silver Color Finger Jewelry Accessory
$2.88-3.14
No MOQ
 · 
13 sold recently
Free Shipping
Multi Row Rhinestone Paved Curved Ring Titanium Steel Iced Out Band Fashion Jewelry For Men Women
Multi Row Rhinestone Paved Curved Ring Titanium Steel Iced Out Band Fashion Jewelry For Men Women
like
Find Similar
Minimalist five-row diamond eternity ring in titanium steel with a polished silver finish - US 6 / Silver
Luxurious five-row pavé set cubic zirconia ring in polished gold titanium steel - US 7 / Gold
+14
Multi Row Rhinestone Paved Curved Ring Titanium Steel Iced Out Band Fashion Jewelry For Men Women
$0.50-0.58
No MOQ
 · 
471 sold recently
Top 10% Best Sellers
in Rings
Free Shipping
Retro Oval Gemstone Signet Ring For Women 304 Stainless Steel Gold Plated Artificial Stone Maillard Style Fashion Jewelry
Retro Oval Gemstone Signet Ring For Women 304 Stainless Steel Gold Plated Artificial Stone Maillard Style Fashion Jewelry
like
Find Similar
Vintage gold-plated signet ring with a large oval turquoise stone and mineral texture - US 7 / Gold-Green Turquoise Texture (1)
Retro gold stainless steel signet ring featuring a marble textured oval stone inlay - US 7 / Gold-Colorful Marble Texture (2)
Vintage gold plated stainless steel ring with oval green marble stone and geometric facets - US 7 / Gold-Dark Green Marble Texture (3)
Vintage gold chunky ring featuring a large oval blue sea stone with wave patterns - US 7 / Gold-Ocean Blue Texture (4)
+80
Retro Oval Gemstone Signet Ring For Women 304 Stainless Steel Gold Plated Artificial Stone Maillard Style Fashion Jewelry
$4.19-4.45
No MOQ
 · 
11 views
Free Shipping
Men Minimalist Titanium Steel Brushed Ring Double Groove Design Fashion Jewelry Band Ring Silver Black Gold Blue Colors
Men Minimalist Titanium Steel Brushed Ring Double Groove Design Fashion Jewelry Band Ring Silver Black Gold Blue Colors
like
Find Similar
Macro view of matte brushed titanium steel ring with double gold grooved parallel lines - US 6 / Two Gold Lines
Detail view of silver brushed titanium steel ring with parallel black stripes for men - US 6 / Two Black Lines
Close-up of brushed titanium steel ring with parallel blue grooves and polished inner band - US 6 / Two Blue Lines
+21
Men Minimalist Titanium Steel Brushed Ring Double Groove Design Fashion Jewelry Band Ring Silver Black Gold Blue Colors
-4%
$0.45
No MOQ
 · 
130 sold recently
Vintage Stainless Steel Lion Head Ring For Men Gothic Punk Biker Jewelry Gold Black Silver Tone Geometric Finger Ring Gift
Vintage Stainless Steel Lion Head Ring For Men Gothic Punk Biker Jewelry Gold Black Silver Tone Geometric Finger Ring Gift
like
Find Similar
Men's stainless steel ring featuring a black lion head design on a clean white background - US 7 / Black
Macro shot of silver lion head ring showing 3D embossed texture and antique steel finish - US 7 / Steel
Bold vintage gold lion head statement ring crafted in durable polished stainless steel - US 7 / Gold
Two-tone stainless steel lion head ring with gold mane and silver face in high relief - US 7 / Two-tone (Gold & Silver)
+32
Vintage Stainless Steel Lion Head Ring For Men Gothic Punk Biker Jewelry Gold Black Silver Tone Geometric Finger Ring Gift
-5%
$2.74-2.98
No MOQ
Free Shipping
Vintage Stainless Steel Ring For Men Women Black Electroplated Laser Engraved Greek Key Skull Flame Paw Print Jewelry Ring Gift
Vintage Stainless Steel Ring For Men Women Black Electroplated Laser Engraved Greek Key Skull Flame Paw Print Jewelry Ring Gift
like
Find Similar
Macro view of 8mm black stainless steel ring featuring laser engraved grey checkered pattern - US 6 / Checkered Pattern
Detail view of 8mm black stainless steel ring featuring silver Greek meander pattern - US 6 / Greek Key Pattern
8mm black stainless steel ring for men with laser-etched silver paw prints and beveled edges - US 6 / Paw Prints
Macro view of 8mm black stainless steel ring featuring laser etched silver flame patterns - US 6 / Flame
+44
Vintage Stainless Steel Ring For Men Women Black Electroplated Laser Engraved Greek Key Skull Flame Paw Print Jewelry Ring Gift
$0.29
No MOQ
 · 
75 sold recently
Men Stainless Steel Tiger Eye Stone Square Signet Ring Hip Hop Punk Style Silver Polished Band Jewelry For Daily Party Accessory
Men Stainless Steel Tiger Eye Stone Square Signet Ring Hip Hop Punk Style Silver Polished Band Jewelry For Daily Party Accessory
like
Find Similar
5 options
Men Stainless Steel Tiger Eye Stone Square Signet Ring Hip Hop Punk Style Silver Polished Band Jewelry For Daily Party Accessory
$4.72
Mix MOQ : 2
Free Shipping
Vintage Titanium Steel Feather Wing Open Ring Retro Punk Gothic Adjustable Band Ring For Men Women Fashion Jewelry
Vintage Titanium Steel Feather Wing Open Ring Retro Punk Gothic Adjustable Band Ring For Men Women Fashion Jewelry
like
Find Similar
Retro oxidized silver feather wing open ring made of durable titanium steel for men and women - US 7 / Steel
Retro titanium steel feather open ring with detailed wing texture for men and women - US 7 / Gold
+8
Vintage Titanium Steel Feather Wing Open Ring Retro Punk Gothic Adjustable Band Ring For Men Women Fashion Jewelry
-4%
$2.94-3.24
No MOQ
 · 
11 sold recently
Free Shipping
Vintage Gothic Punk Alloy Rings For Women Men Antique Silver Color Heart Snake Butterfly Motifs Bohemian Jewelry
Vintage Gothic Punk Alloy Rings For Women Men Antique Silver Color Heart Snake Butterfly Motifs Bohemian Jewelry
like
Find Similar
Bohemian silver ring set featuring snake, flower, and hollow heart designs for women - Bohemian Snake Flower Ring Set 7Pcs / Silver
7-piece silver heart ring set with vintage texture and adjustable open bands for women - Vintage Silver Heart Theme Ring Set / Antique Silver
Vintage silver punk ring set featuring billiard ball and ace of spades designs - Punk Poker No. 8 Ball Ring Set 5Pcs / Antique Silver
Close-up of five-piece silver ring set featuring a butterfly diamond ring on a hand model - Korean Style Butterfly Ring Set 5Pcs / Silver
+43
Vintage Gothic Punk Alloy Rings For Women Men Antique Silver Color Heart Snake Butterfly Motifs Bohemian Jewelry
$0.34-1.41
Mix MOQ : 2
 · 
12 sold recently
Minimalist Titanium Steel Smooth Polished Band Ring For Men Women Couple Plain Simple Geometric Finger Jewelry Simple Design
Minimalist Titanium Steel Smooth Polished Band Ring For Men Women Couple Plain Simple Geometric Finger Jewelry Simple Design
like
Find Similar
Minimalist silver titanium steel ring with a smooth polished finish on a white background - US 5 / 2mm Silver
Minimalist black titanium steel band ring with a high-polish finish for women and men - US 5 / 2mm Black
Minimalist polished golden stainless steel ring shown on a clean white background - 2mm Gold / Size 7
Detailed close-up of a slim rose gold titanium steel ring with a polished minimalist finish - US 5 / 2mm Rose Gold
+176
Minimalist Titanium Steel Smooth Polished Band Ring For Men Women Couple Plain Simple Geometric Finger Jewelry Simple Design
$0.16-0.37
No MOQ
 · 
6K+ sold recently
Top 3% Best Sellers
in Rings
Free Shipping
Luminous Football Ring Stainless Steel Honeycomb Hexagon Pattern Glow In The Dark Sporty Fashion Band Ring For Men Jewelry
Luminous Football Ring Stainless Steel Honeycomb Hexagon Pattern Glow In The Dark Sporty Fashion Band Ring For Men Jewelry
like
Find Similar
Luminous soccer ring in stainless steel with blue hexagonal honeycomb pattern for men - US 6 / Silver
Detail of gold football ring with blue hexagonal pattern showing texture and finish - US 6 / Gold
Macro shot of black stainless steel ring with silver honeycomb soccer pattern details - US 6 / Black
Luminous blue stainless steel soccer ring with white honeycomb texture for men - US 6 / Blue
+24
Luminous Football Ring Stainless Steel Honeycomb Hexagon Pattern Glow In The Dark Sporty Fashion Band Ring For Men Jewelry
$1.83-2.10
No MOQ
Free Shipping
Go to

More in jewelry

Lab-Created Gemstone Jewelry

Explore more in toe rings

openfoot jewelryfingersimplewhiteplasticinlaiddesignbodyplated stainless steel
footgold platedsteelartificialpolishedgirlsgold plated adjustableturquoise18k gold platedcolor ring

Ready to source like an insider

Get a direct line to the factory floor — no minimums, no middlemen, no guesswork.
iconReal factory pricing, no markup in betweeniconEvery order hand-inspected before it shipsicon5,000+ new products added daily
Get Inside Access