Everful

Wholesale suction cups

Factory-direct selection, vetted for quality and ready to order.

Sign Up
Suction Cups

Find the perfect pieces: home decor, kitchen & dining, arts, crafts & sewing and more

All products in suction cups

filterShow Filters
Best Seller
New Arrivals
Price Drop
Free Shipping
Double Walled Plastic Straw Cup Matte Finish Large Capacity Tumbler With Lid And Straw Leakproof Modern Simple Water Bottle
Double Walled Plastic Straw Cup Matte Finish Large Capacity Tumbler With Lid And Straw Leakproof Modern Simple Water Bottle
like
Find Similar
Matte light blue 24oz double-layer plastic tumbler with matching lid and straw - Light Blue
24oz double-layer matte plastic tumbler with lid and straw in deep purple finish - Fuschia
Matte pink 24oz double-layer plastic tumbler with matching lid and reusable straw - Hot Pink
Pink matte double-layer plastic tumbler with straw and lid in a sleek minimalist design - Smoky Pink
+35
Double Walled Plastic Straw Cup Matte Finish Large Capacity Tumbler With Lid And Straw Leakproof Modern Simple Water Bottle
$4.47
Mix MOQ : 2
 · 
91 sold recently
304 Stainless Steel Tea Strainer Fine Mesh Tea Infuser With Lid And Foldable Handles For Loose Leaf Tea Brewing
304 Stainless Steel Tea Strainer Fine Mesh Tea Infuser With Lid And Foldable Handles For Loose Leaf Tea Brewing
like
Find Similar
Stainless steel tea infuser model ER02B-1 with silicone lid and dual handle measurements - Round Handle Tea Strainer (YR2123-3) / Silver
Stainless steel tea infuser ER02 B-6 with fine mesh and detailed size measurements - Basic Tea Strainer (YR2123-10) / Silver
Silver 304 stainless steel tea strainer with silicone lid and dimensions for ER02B-2 - Uneven Handles Tea Strainer (YR2123-5) / Silver
Stainless steel tea infuser with silicone lid and dual handles, model ER02B-4 with dimensions - Square Handle Tea Strainer (YR2123-4) / Silver
+6
304 Stainless Steel Tea Strainer Fine Mesh Tea Infuser With Lid And Foldable Handles For Loose Leaf Tea Brewing
-5%
$1.15-2.46
No MOQ
 · 
1K+ sold recently
Magnetic Phone Grip Holder Acrylic Transparent MagSafe Compatible Circular Expandable Stand For Mobile Phones
Magnetic Phone Grip Holder Acrylic Transparent MagSafe Compatible Circular Expandable Stand For Mobile Phones
like
Find Similar
Navy blue round magnetic pop socket grip on light green smartphone for easy holding - Flat Magnetic Gasbag Grip / Black
Close-up of clear acrylic magnetic phone socket base on white smartphone back - Flat Magnetic Gasbag Grip / Clear
Purple magnetic pop grip phone stand accessory attached to a green smartphone back - Flat Magnetic Gasbag Grip / White
White magnetic ring adapter with 55mm outer and 45mm inner diameter specifications - 10pcs/Pack / Magnetic Ring (White)
Magnetic Phone Grip Holder Acrylic Transparent MagSafe Compatible Circular Expandable Stand For Mobile Phones
-9%
$1.02-1.44
No MOQ
 · 
684 sold recently
Top 3% Best Sellers
in Tech Accessories
Free Shipping
Waterproof Vinyl Stickers Aesthetic VSCO Decals For Laptop Luggage Guitar Water Bottle Cute Cartoon Outdoor Camping DIY
Waterproof Vinyl Stickers Aesthetic VSCO Decals For Laptop Luggage Guitar Water Bottle Cute Cartoon Outdoor Camping DIY
like
Find Similar
100pcs VSCO aesthetic waterproof PVC stickers for guitar, luggage and laptop decor - Alpaca and Turtle
Waterproof PVC outdoor camping and adventure stickers set for luggage and guitar - Outdoor Theme
Flat lay of colorful waterproof PVC stickers with travel and positive energy slogans - A029 Outdoor Fresh Style
Close-up of colorful waterproof PVC stickers with cute animal and aesthetic designs - A033 Outdoor Fresh Style
+3
Waterproof Vinyl Stickers Aesthetic VSCO Decals For Laptop Luggage Guitar Water Bottle Cute Cartoon Outdoor Camping DIY
$1.73
No MOQ
 · 
44 sold recently
Top 10% Best Sellers
in Labels, Indexes & Stamps
Food Grade Silicone Straws Soft Flexible Liquid Replacement For Children Water Bottle Kids Cup Transparent Accessories
Food Grade Silicone Straws Soft Flexible Liquid Replacement For Children Water Bottle Kids Cup Transparent Accessories
like
Find Similar
32 options
Food Grade Silicone Straws Soft Flexible Liquid Replacement For Children Water Bottle Kids Cup Transparent Accessories
$0.04-0.19
Mix MOQ : 2
 · 
740 sold recently
Gold Rim Glass Cup Transparent Water Glass Heat Resistant Lead-free Egg Shaped Hammered Texture Ins Style Modern Drinkware
Gold Rim Glass Cup Transparent Water Glass Heat Resistant Lead-free Egg Shaped Hammered Texture Ins Style Modern Drinkware
like
Find Similar
Egg-shaped transparent glass water cup with gold rim Style B 340ml 220g capacity - Style B (Gold Rim)
Style C egg-shaped crystal glass with gold rim, 330ml capacity and 8.2cm height dimensions - Style C (Gold Rim)
Egg-shaped transparent crystal glass cup with gold rim, style G, 375ml capacity - Style G (Gold Rim)
Style E minimalist light purple transparent glass vase with elegant gold rim finish - Style E (Gold Rim)
+3
Gold Rim Glass Cup Transparent Water Glass Heat Resistant Lead-free Egg Shaped Hammered Texture Ins Style Modern Drinkware
$2.12
No MOQ
 · 
134 sold recently
Smart Vacuum Flask 304 316 Stainless Steel Thermos LED Temperature Display Tea Infuser Office Outdoor Water Bottle
Smart Vacuum Flask 304 316 Stainless Steel Thermos LED Temperature Display Tea Infuser Office Outdoor Water Bottle
like
Find Similar
Matte black stainless steel insulated vacuum flask with portable cylinder design - Smart Temp Display/316 Liner / Black
Smart Temp Display/316 Liner / Light Blue
Smart Temp Display/316 Liner / Green
Dark blue smart thermos with LED temperature display and matte stainless steel finish - Smart Temp Display/304 Liner / Blue
+5
Smart Vacuum Flask 304 316 Stainless Steel Thermos LED Temperature Display Tea Infuser Office Outdoor Water Bottle
$1.99-2.56
No MOQ
 · 
1K+ sold recently
Waterproof Outdoor Adventure Camping Stickers PVC Nature Travel Decals For Suitcase Laptop Skateboard Car Phone Decoration
Waterproof Outdoor Adventure Camping Stickers PVC Nature Travel Decals For Suitcase Laptop Skateboard Car Phone Decoration
like
Find Similar
50pcs waterproof summer adventure stickers with outdoor camping and nature themes - 50 Sheets Outdoor Adventure Theme (TZ-AZ046)
Waterproof Outdoor Adventure Camping Stickers PVC Nature Travel Decals For Suitcase Laptop Skateboard Car Phone Decoration
$1.29
No MOQ
 · 
24 views
Summer Beach Theme Waterproof Stickers Variety Pack Watercolor Hand Painted Tropical Decals For Luggage Laptop Water Bottle
Summer Beach Theme Waterproof Stickers Variety Pack Watercolor Hand Painted Tropical Decals For Luggage Laptop Water Bottle
like
Find Similar
Collection of summer-themed watercolor beach stickers featuring swimsuits and tropical fruits - Summer Beach Style (YCK283)
NewSummer Beach Theme Waterproof Stickers Variety Pack Watercolor Hand Painted Tropical Decals For Luggage Laptop Water Bottle
$0.86
No MOQ
 · 
14 views
Color Changing Plastic Straw Cup With Lid Cold Sensitive Reusable Holiday Tumbler Christmas Halloween Party Drinkware
Color Changing Plastic Straw Cup With Lid Cold Sensitive Reusable Holiday Tumbler Christmas Halloween Party Drinkware
like
Find Similar
Reusable 710ml Santa cold-sensitive color-changing cup with red lid and straw - 701-800ml / Santa Claus (Red)
710ml Christmas themed color changing cup with Santa prints and green straw - 701-800ml / Santa Claus (Green)
Halloween color-changing 710ml straw cup with pumpkin design from white to pink when cold - 701-800ml / Halloween Pumpkin (Red)
Christmas themed color changing plastic straw cup with red lid showing cold effect - 701-800ml / Christmas Tree (Red)
+46
Color Changing Plastic Straw Cup With Lid Cold Sensitive Reusable Holiday Tumbler Christmas Halloween Party Drinkware
$1.96
Mix MOQ : 2
 · 
129 sold recently
304 Stainless Steel Hip Flask Portable Pocket Size Leakproof Brushed Silver Wine Bottle For Outdoor Camping Travel
304 Stainless Steel Hip Flask Portable Pocket Size Leakproof Brushed Silver Wine Bottle For Outdoor Camping Travel
like
Find Similar
Brushed silver 304 stainless steel hip flask on a minimalist white display stand - 4oz 120ml
+9
304 Stainless Steel Hip Flask Portable Pocket Size Leakproof Brushed Silver Wine Bottle For Outdoor Camping Travel
$1.35-2.10
Mix MOQ : 2
 · 
830 sold recently
Top 5% Best Sellers
in Kitchen & Dining
Reusable Drinking Straws Tritan Plastic Large Hole Candy Color For Tumbler Cup Eco Friendly Drinkware Accessory
Reusable Drinking Straws Tritan Plastic Large Hole Candy Color For Tumbler Cup Eco Friendly Drinkware Accessory
like
Find Similar
Close-up of a blue Tritan reusable straw with a smooth finish and 1cm wide diameter - 1*20cm / Navy Blue
Reusable pink Tritan straw with 1cm wide opening and smooth candy color finish - 1*20cm / Pink
Reusable green Tritan straw with 1cm large diameter for candy colored plastic cups - 1*20cm / Olive Green
Reusable black Tritan straw with 1cm wide diameter for candy colored plastic cups - 1*20cm / Black
+25
Reusable Drinking Straws Tritan Plastic Large Hole Candy Color For Tumbler Cup Eco Friendly Drinkware Accessory
$0.72
Mix MOQ : 10
 · 
43 sold recently
Free Shipping
Rhinestone Insulated Wine Tumbler Stainless Steel Bling Coffee Cup With Straw Double Wall Vacuum Glitter Egg Shape Mug
Rhinestone Insulated Wine Tumbler Stainless Steel Bling Coffee Cup With Straw Double Wall Vacuum Glitter Egg Shape Mug
like
Find Similar
Sparkling 12oz diamond wine tumbler with stainless steel straws and clear lids - 360ml with Sealed Lid and Stainless Steel Straw / AB Color
Red rhinestone 12oz stainless steel wine tumbler with straw and sealed lid options - 360ml with Sealed Lid and Stainless Steel Straw / Red
Champagne gold rhinestone 12oz egg-shaped wine tumbler with straw and flat lid options - 360ml with Sealed Lid and Stainless Steel Straw / Gold
12oz purple rhinestone stainless steel wine tumbler with straw and flat lid options - 360ml with Sealed Lid and Stainless Steel Straw / Purple
+61
Rhinestone Insulated Wine Tumbler Stainless Steel Bling Coffee Cup With Straw Double Wall Vacuum Glitter Egg Shape Mug
-5%
$3.56-7.94
Mix MOQ : 2
 · 
14 sold recently
Transparent Adhesive Wall Hooks Heavy Duty Punch-Free Seamless Storage Hooks For Kitchen Bathroom
Transparent Adhesive Wall Hooks Heavy Duty Punch-Free Seamless Storage Hooks For Kitchen Bathroom
like
Find Similar
Transparent double wall hook with 7cm size for kitchen and bathroom storage - 7x7cm Transparent Single Claw Hook
Set of transparent strong adhesive wall hooks with waterproof PVC backing for home storage - 6x6cm Transparent Horn Hook
Transparent adhesive shelf support bracket with L-shaped structure and square sticky backing - 6x6cm Transparent Angle Shelf Support
Strong transparent self-adhesive hook with U-shaped buckle for kitchen and bathroom - 6x6cm Transparent Female Buckle
+42
Transparent Adhesive Wall Hooks Heavy Duty Punch-Free Seamless Storage Hooks For Kitchen Bathroom
$0.01-0.22
No MOQ
 · 
329 sold recently
Butterfly Silicone Straw Cover Caps And Metal Chain Pendant Decorative Cup Accessories Dustproof For Drinking Straws
Butterfly Silicone Straw Cover Caps And Metal Chain Pendant Decorative Cup Accessories Dustproof For Drinking Straws
like
Find Similar
Green butterfly straw topper set with silicone dust cap and metal chain charm - Suitable for 10mm Straws / Green Zirconia Set
Pink butterfly straw cover set for cups with gold chain butterfly charm accessories - Suitable for 8mm Straws / Pink Jewelry Set
Purple 40oz stainless steel tumbler set with butterfly straw covers and charm pendant - Suitable for 8mm Straws / Purple Jewelry Set
Butterfly silicone straw covers and gold charm chain set for Stanley cups accessories - Suitable for 8mm Straws / Mint Green Set
+6
Butterfly Silicone Straw Cover Caps And Metal Chain Pendant Decorative Cup Accessories Dustproof For Drinking Straws
-5%
$1.04
No MOQ
 · 
25 sold recently
50Pcs Vintage Red Y2K Cherry Graffiti Stickers Waterproof PVC Aesthetic Decals For Laptop Suitcase Guitar DIY Decoration
50Pcs Vintage Red Y2K Cherry Graffiti Stickers Waterproof PVC Aesthetic Decals For Laptop Suitcase Guitar DIY Decoration
like
Find Similar
50 pieces of red Y2K vintage graffiti stickers set featuring cherry and heart designs - 50 Pcs/Bag (YCK395)
50Pcs Vintage Red Y2K Cherry Graffiti Stickers Waterproof PVC Aesthetic Decals For Laptop Suitcase Guitar DIY Decoration
$0.98
No MOQ
 · 
13 views
Strong Magnetic Hooks Heavy Duty Stainless Steel No Drill Wall Hanger For Refrigerator Kitchen Organization Silver
Strong Magnetic Hooks Heavy Duty Stainless Steel No Drill Wall Hanger For Refrigerator Kitchen Organization Silver
like
Find Similar
Silver magnetic hook with 1cm base and 3.2cm height for versatile storage - Magnetic Hook / Silver
Strong Magnetic Hooks Heavy Duty Stainless Steel No Drill Wall Hanger For Refrigerator Kitchen Organization Silver
$0.12
No MOQ
 · 
182 sold recently
Silicone Kitchen Cooking Baking Utensils Spatula Spoon Whisk Tongs Beech Wood Non-Stick Heat Resistant Minimalist Style
Silicone Kitchen Cooking Baking Utensils Spatula Spoon Whisk Tongs Beech Wood Non-Stick Heat Resistant Minimalist Style
like
Find Similar
Pink silicone kitchen utensil set with wooden handles in a matching storage bucket - Kitchenware Set / Pink
14-piece beige silicone kitchen utensil set with wooden handles and storage bucket - Kitchenware Set / Off White
Beige 14-piece silicone kitchen utensil set with wooden handles and a storage bucket - Kitchenware Set / Khaki
Mint green 14-piece silicone cooking utensil set with wooden handles in a storage bucket - Kitchenware Set / Mint Green
+16
Silicone Kitchen Cooking Baking Utensils Spatula Spoon Whisk Tongs Beech Wood Non-Stick Heat Resistant Minimalist Style
-5%
$3.97-6.03
Mix MOQ : 2
 · 
142 sold recently
Popsicle Shaped Water Bottle Creative Plastic Straw Cup With Adjustable Shoulder Strap Leakproof Portable Drinkware
Popsicle Shaped Water Bottle Creative Plastic Straw Cup With Adjustable Shoulder Strap Leakproof Portable Drinkware
like
Find Similar
Pink popsicle-shaped plastic cup with colorful strap held in a cafe setting - 300ml / Pink
Creative cyan popsicle shaped water bottle with colorful shoulder strap held in a cafe - 300ml / Blue
Detail of popsicle-shaped green water bottle with yellow lid and adjustable strap - 300ml / Yellow
Pink purple gradient popsicle shaped plastic water bottle with colorful carrying strap - 300ml / Purple
Popsicle Shaped Water Bottle Creative Plastic Straw Cup With Adjustable Shoulder Strap Leakproof Portable Drinkware
$4.27
No MOQ
 · 
29 sold recently
Universal Round Glitter Gold Foil Expansion Phone Socket Foldable Airbag Grip Stand For Smartphone Tablet Accessories
Universal Round Glitter Gold Foil Expansion Phone Socket Foldable Airbag Grip Stand For Smartphone Tablet Accessories
like
Find Similar
Detail of green epoxy phone grip featuring golden foil and hex glitter on a matching smartphone - Expanding Stand / White Base Gold Foil
Universal folding phone grip with black base and glittering silver foil texture - Expanding Stand / Black Base Silver Foil
Collapsible phone grip stand featuring black base and rose gold glitter foil design - Expanding Stand / Black Base Rose Gold Foil
Macro shot of circular resin phone grip with luxury gold foil and blue shell inlay - Expanding Stand / Black Gold Foil Shell
+6
Universal Round Glitter Gold Foil Expansion Phone Socket Foldable Airbag Grip Stand For Smartphone Tablet Accessories
-8%
$0.34
Mix MOQ : 5
 · 
759 sold recently
50Pcs Cute Fat Frog PVC Waterproof Stickers Kawaii Hand Painted Watercolor Animals Decals For Laptop Phone Journal Decoration
50Pcs Cute Fat Frog PVC Waterproof Stickers Kawaii Hand Painted Watercolor Animals Decals For Laptop Phone Journal Decoration
like
Find Similar
50 pieces of cute watercolor frog stickers for laptop and water bottle decoration - 50Pcs Colorful Fat Frog Stickers (OPQ029)
50Pcs Cute Fat Frog PVC Waterproof Stickers Kawaii Hand Painted Watercolor Animals Decals For Laptop Phone Journal Decoration
$0.96
No MOQ
 · 
12 views
Cute Cartoon Shark Teacup Stickers Waterproof PVC DIY Decals For Laptop Luggage Guitar Stationery Scrapbooking Decoration
Cute Cartoon Shark Teacup Stickers Waterproof PVC DIY Decals For Laptop Luggage Guitar Stationery Scrapbooking Decoration
like
Find Similar
50 pieces of waterproof INS shark teacup stickers for laptop, guitar, and luggage decoration - Shark Teacup Series
Cute Cartoon Shark Teacup Stickers Waterproof PVC DIY Decals For Laptop Luggage Guitar Stationery Scrapbooking Decoration
$0.98
No MOQ
304 Stainless Steel Yerba Mate Bombilla Straw Spoon Reusable Filter Stirring Drinking Straws For Coffee Juice Tea
304 Stainless Steel Yerba Mate Bombilla Straw Spoon Reusable Filter Stirring Drinking Straws For Coffee Juice Tea
like
Find Similar
Golden 304 stainless steel Yerba Mate straw spoon with filter head, 15cm length - 15cm-Gold Filtering Straw
Golden 18.5cm stainless steel Yerba Mate straw spoon with detachable filter head - 18.5cm-Gold Filtering Straw
21cm rose gold stainless steel Yerba Mate bombilla straw with filter spoon and dimensions - 21cm-Gold Filtering Straw
Rose gold 30cm stainless steel Yerba Mate straw with integrated filter spoon and 16g weight - 30cm-Gold Filtering Straw
+22
304 Stainless Steel Yerba Mate Bombilla Straw Spoon Reusable Filter Stirring Drinking Straws For Coffee Juice Tea
$0.09-0.61
No MOQ
 · 
130 sold recently
Portable Desk Side Bag Hook ABS Plastic Cartoon Animal Folding No Punch Schoolbag Hanging Holder Students Office
Portable Desk Side Bag Hook ABS Plastic Cartoon Animal Folding No Punch Schoolbag Hanging Holder Students Office
like
Find Similar
Portable cat shaped desk bag hook in yellow and white color for school bags - Yellow Cat
Portable panda desk bag hook in orange and grey made of durable ABS and TPR material - Raccoon
Portable cat shaped school bag hook in white and orange pink, durable ABS material - Pink Cat
Foldable panda desk hook for bags made of durable ABS and TPR material in black and white - Red Panda
+3
Portable Desk Side Bag Hook ABS Plastic Cartoon Animal Folding No Punch Schoolbag Hanging Holder Students Office
$0.37-0.69
No MOQ
 · 
42 sold recently
Cute Cartoon Animal Waterproof PVC Stickers For DIY Journal Scrapbook Water Bottle Laptop Decorative Stickers Collection
Cute Cartoon Animal Waterproof PVC Stickers For DIY Journal Scrapbook Water Bottle Laptop Decorative Stickers Collection
like
Find Similar
Vibrant 50pcs waterproof cartoon animal sticker set featuring panda pig bear and duck - Animal Series
Cute Cartoon Animal Waterproof PVC Stickers For DIY Journal Scrapbook Water Bottle Laptop Decorative Stickers Collection
-4%
$0.69
No MOQ
 · 
17 views
Sparkling Glitter Straw Bow Decoration PU Leather Bowknot Straw Topper With Elastic Band For Tumbler Cups DIY Accessory
Sparkling Glitter Straw Bow Decoration PU Leather Bowknot Straw Topper With Elastic Band For Tumbler Cups DIY Accessory
like
Find Similar
Pink glitter bow hair clip with shimmering fabric for stylish ponytails and buns - Watermelon red
Sparkly blue and pink glitter double-layered bow hair clip on a clean white background - Gray
Close-up of a sparkling black glitter bow hair clip showing textured shiny material - Black
Close-up of a 5-inch glitter bow hair clip with pink, purple, and gold gradient shine - Colorful
+13
Sparkling Glitter Straw Bow Decoration PU Leather Bowknot Straw Topper With Elastic Band For Tumbler Cups DIY Accessory
$0.46
Mix MOQ : 5
 · 
1K+ sold recently
Ins Style Cat Paw Shaped Acrylic Coasters Heat Resistant Anti-Slip Cup Mats Table Decor Photography Props For Home Office
Ins Style Cat Paw Shaped Acrylic Coasters Heat Resistant Anti-Slip Cup Mats Table Decor Photography Props For Home Office
like
Find Similar
5 options
Ins Style Cat Paw Shaped Acrylic Coasters Heat Resistant Anti-Slip Cup Mats Table Decor Photography Props For Home Office
-4%
$1.37
No MOQ
 · 
13 views
Heat Resistant High Borosilicate Glass Ripple Cup With Wood Lid And Glass Straw Modern Minimalist Transparent Caterpillar Shape Coffee Milk Drinking Water Cup For Home Office
Heat Resistant High Borosilicate Glass Ripple Cup With Wood Lid And Glass Straw Modern Minimalist Transparent Caterpillar Shape Coffee Milk Drinking Water Cup For Home Office
like
Find Similar
8 options
Heat Resistant High Borosilicate Glass Ripple Cup With Wood Lid And Glass Straw Modern Minimalist Transparent Caterpillar Shape Coffee Milk Drinking Water Cup For Home Office
$0.92-6.63
No MOQ
 · 
47 views
Cake Decorating Piping Tips Stainless Steel Nozzles Reusable EVA Piping Bags Plastic Scrapers Professional Baking Tools Supplies
Cake Decorating Piping Tips Stainless Steel Nozzles Reusable EVA Piping Bags Plastic Scrapers Professional Baking Tools Supplies
like
Find Similar
14-piece cake decorating set with 12 stainless steel tips and a blue 31cm EVA piping bag - 12-Piece Set (OPP Bag) / Blue
24-piece stainless steel piping tips set with blue EVA pastry bag and coupler tool - 24-Piece Set (OPP Bag) / Blue
29-piece pink cake decorating set with stainless steel nozzles and EVA piping bag - 24-Piece Set with 3 Scrapers (OPP Bag) / Pink
24-piece stainless steel piping tip set with a 12-inch reusable pastry bag and coupler - 24-Piece Set (OPP Bag) / White
+46
Cake Decorating Piping Tips Stainless Steel Nozzles Reusable EVA Piping Bags Plastic Scrapers Professional Baking Tools Supplies
$0.40-4.03
Mix MOQ : 2
 · 
85 sold recently
Nano Double Sided Tape Strong Adhesive Transparent Acrylic Gel Washable Reusable Removable No Residue Multipurpose Mounting Tape
Nano Double Sided Tape Strong Adhesive Transparent Acrylic Gel Washable Reusable Removable No Residue Multipurpose Mounting Tape
like
Find Similar
19 options
Nano Double Sided Tape Strong Adhesive Transparent Acrylic Gel Washable Reusable Removable No Residue Multipurpose Mounting Tape
-4%
$0.16-2.73
No MOQ
 · 
42 sold recently
Gothic Black Cat Stickers Waterproof PVC Stained Glass Art Style Decals For Laptop Luggage Skateboard DIY Scrapbook Decoration
Gothic Black Cat Stickers Waterproof PVC Stained Glass Art Style Decals For Laptop Luggage Skateboard DIY Scrapbook Decoration
like
Find Similar
50 Gothic dark cat stickers in stained glass style for suitcases and laptops - 50PCS Gothic Dark Cat Stickers
Gothic Black Cat Stickers Waterproof PVC Stained Glass Art Style Decals For Laptop Luggage Skateboard DIY Scrapbook Decoration
$1.33
Mix MOQ : 2
 · 
56 sold recently
Top 10% Best Sellers
in Labels, Indexes & Stamps
Wooden Mug Jujube Wood Tea Cup Coffee Cup Japanese Style Handmade Natural Grain Drinkware For Home Office Gift Vintage
Wooden Mug Jujube Wood Tea Cup Coffee Cup Japanese Style Handmade Natural Grain Drinkware For Home Office Gift Vintage
like
Find Similar
Handcrafted small wooden tea cup made of natural solid wood with 50ml capacity - Small Wine/Tea Cup
Handcrafted jujube wood small tea cup in reddish brown with natural wood grain 70ml - Trumpet Cup
Handcrafted jujube wood cup 140ml large size with natural grain texture and handle - Large Wine Cup
Natural jujube wood coffee cup with five horizontal grooves and 130ml capacity - Five-Line Cup
+17
Wooden Mug Jujube Wood Tea Cup Coffee Cup Japanese Style Handmade Natural Grain Drinkware For Home Office Gift Vintage
-5%
$1.26-6.02
No MOQ
 · 
373 sold recently
Star Shaped Adhesive Hooks Transparent Gold Metal Wall Mount For Kitchen Bathroom Waterproof No Drill Heavy Duty
Star Shaped Adhesive Hooks Transparent Gold Metal Wall Mount For Kitchen Bathroom Waterproof No Drill Heavy Duty
like
Find Similar
Detail showing two star-shaped adhesive hooks with golden metal finish and clear base - Star Transparent / 1 Piece
+7
Star Shaped Adhesive Hooks Transparent Gold Metal Wall Mount For Kitchen Bathroom Waterproof No Drill Heavy Duty
$0.10-1.15
No MOQ
 · 
30 views
Fruit Vegetable Storage Pods Silicone Stretch Lid Food Preservation Box For Onion Lemon Tomato Avocado Reusable Organizer
Fruit Vegetable Storage Pods Silicone Stretch Lid Food Preservation Box For Onion Lemon Tomato Avocado Reusable Organizer
like
Find Similar
Red round airtight food storage box with flexible film for avocado freshness - Single Piece / Red
Yellow round plastic food storage container with peach flexible seal for fresh fruit storage - Single Piece / Yellow
Green plastic oval foot rasp with grey frosted surface for skin exfoliation - Single Piece / Green
Orange fruit storage container with flexible film seal for keeping avocado fresh - Single Piece / Brown
Fruit Vegetable Storage Pods Silicone Stretch Lid Food Preservation Box For Onion Lemon Tomato Avocado Reusable Organizer
$1.10
No MOQ
 · 
131 sold recently
Acrylic Cup Lid Decoration Nameplate Plate Straw Topper Miniature Landscape For Tumblers Panda Halloween Christmas Animal Decor
Acrylic Cup Lid Decoration Nameplate Plate Straw Topper Miniature Landscape For Tumblers Panda Halloween Christmas Animal Decor
like
Find Similar
Detail of green silicone frog straw cover and matching lotus pond theme lid ornament - 40OZ-Frog Pond Theme
Close-up of farm animal micro landscape on acrylic cup lid with cow and pig figures - 40OZ-Farm Cow Micro Landscape
Detail of pink 40oz tumbler lid with cute cat figurines and cat paw straw cover - 40OZ-Home Cat Single Lid
Detail showing a pink 40oz cup lid with rabbit straw topper and carrot house miniature - 40OZ-Forest Rabbit Single Lid
+74
Acrylic Cup Lid Decoration Nameplate Plate Straw Topper Miniature Landscape For Tumblers Panda Halloween Christmas Animal Decor
-5%
$4.38-4.93
No MOQ
 · 
49 views
Silicone Straw Cup Accessories With Glitter Straw Covers Cup Boots And Cleaning Brush Dustproof Protective Reusable
Silicone Straw Cup Accessories With Glitter Straw Covers Cup Boots And Cleaning Brush Dustproof Protective Reusable
like
Find Similar
Pink glitter silicone cup accessory set with straw covers, base sleeves and cleaning brush - Pink Glitter Set
Stanley cup accessory set with glitter straw covers, silicone boots, and cleaning brush - Silver Glitter Set
Blue glitter cup accessory set with silicone covers, straws, brush and straw caps - Blue Glitter Set
Purple glitter silicone accessories set with straw covers and cup boots for tumblers - Purple Glitter Set
+1
Silicone Straw Cup Accessories With Glitter Straw Covers Cup Boots And Cleaning Brush Dustproof Protective Reusable
-4%
$3.56
No MOQ
 · 
66 views
Double Wall Vacuum Insulated Tumbler 304 Stainless Steel Slender Straight Travel Cup With Lid And Straw For Cold Hot Drinks
Double Wall Vacuum Insulated Tumbler 304 Stainless Steel Slender Straight Travel Cup With Lid And Straw For Cold Hot Drinks
like
Find Similar
Glossy white 20oz sublimation tumbler with straight cylinder body and smooth finish - 20oz / White
20oz sublimation tumbler in vibrant glossy red finish with a sleek cylindrical shape - 20oz / Red
Sky blue 20oz straight sublimation tumbler with matte frosted finish and sleek design - 20oz / Blue
Deep charcoal 20oz sublimation tumbler with matte frosted finish and thermal insulation - 20oz / Black
+9
Double Wall Vacuum Insulated Tumbler 304 Stainless Steel Slender Straight Travel Cup With Lid And Straw For Cold Hot Drinks
$4.29
Mix MOQ : 2
 · 
258 sold recently
304 Stainless Steel Straw Spoon Long Handle Spiral Reusable Stirring Straw For Coffee Juice Cocktail
304 Stainless Steel Straw Spoon Long Handle Spiral Reusable Stirring Straw For Coffee Juice Cocktail
like
Find Similar
Polished silver 304 stainless steel straw spoon with long handle for coffee drinks - Long Handle - Silver
Polished gold 304 stainless steel straw spoon with filtered head for yerba mate - Long Handle - Gold
304 stainless steel straw spoon with long handle in a sleek black finish for drinks - Long Handle - Black
Reusable green 304 stainless steel straw spoon for coffee and stirring drinks - Long Handle - Green
+17
304 Stainless Steel Straw Spoon Long Handle Spiral Reusable Stirring Straw For Coffee Juice Cocktail
-4%
$0.07-0.77
Mix MOQ : 5
 · 
46 sold recently
Cartoon Capybara Stickers Waterproof PVC Vinyl Decals For Laptop Luggage Guitar DIY Scrapbooking Cute Animal Decorations
Cartoon Capybara Stickers Waterproof PVC Vinyl Decals For Laptop Luggage Guitar DIY Scrapbooking Cute Animal Decorations
like
Find Similar
Set of 100 waterproof cartoon capybara stickers for laptop and guitar decoration - Assorted Capybara Patterns
Cartoon Capybara Stickers Waterproof PVC Vinyl Decals For Laptop Luggage Guitar DIY Scrapbooking Cute Animal Decorations
$2.48
No MOQ
Free Shipping
Butterfly Glass Straws Reusable Decorative Curved Transparent Heat Resistant Drinking Straws For Milk Juice Coffee
Butterfly Glass Straws Reusable Decorative Curved Transparent Heat Resistant Drinking Straws For Milk Juice Coffee
like
Find Similar
Transparent butterfly glass stirrer with green bow ornament on wooden texture surface - 8*200mm Bent Tube / Green Bow
Transparent glass straw with a yellow butterfly ornament on a white ceramic rest - 8*200mm Bent Tube / Yellow Bowknot
Transparent glass straw with a blue butterfly charm on a white ceramic bowl background - 8*200mm Bent Tube / Blue Bow
Transparent glass straw with a small purple butterfly ornament on a wood surface - 8*200mm Bent Tube / Purple Bowknot
+6
Butterfly Glass Straws Reusable Decorative Curved Transparent Heat Resistant Drinking Straws For Milk Juice Coffee
$0.43
No MOQ
 · 
517 sold recently
Glitter Gemstone Straw Cover Cap Silicone Dust Plug Reusable For Tumbler Cups Alloy Rhinestone Decorative Drinking Accessory
Glitter Gemstone Straw Cover Cap Silicone Dust Plug Reusable For Tumbler Cups Alloy Rhinestone Decorative Drinking Accessory
like
Find Similar
Sparkly diamond straw covers for 30/40oz tumblers in white and pink glitter gemstone sets - Style 1 (Set of 6)
Glitter Gemstone Straw Cover Cap Silicone Dust Plug Reusable For Tumbler Cups Alloy Rhinestone Decorative Drinking Accessory
-5%
$1.90
No MOQ
 · 
49 views
Dachshund Dog Wine Bottle Holder Creative Animal Shape ABS Plastic Wine Rack Desktop Decor Ornament Home Bar Kitchen
Dachshund Dog Wine Bottle Holder Creative Animal Shape ABS Plastic Wine Rack Desktop Decor Ornament Home Bar Kitchen
like
Find Similar
Macro shot of the black dachshund wine bottle holder highlighting its sleek textured finish - Small / Black
Creative yellow dachshund dog wine bottle holder made of durable 3D printed material - Standard Type / Yellow
Creative blue dachshund wine bottle holder stand made of durable resin on white background - Standard Type / Blue
Detail view of pink dachshund wine bottle holder made of 3D printed material - Standard Type / Rose Red
+3
Dachshund Dog Wine Bottle Holder Creative Animal Shape ABS Plastic Wine Rack Desktop Decor Ornament Home Bar Kitchen
$3.79-4.11
Mix MOQ : 2
 · 
12 sold recently
Heart Shaped Glass Cup Clear Ribbed Hammered Texture Creative Love Design Aesthetic Drinking Mug For Women Breakfast Home
Heart Shaped Glass Cup Clear Ribbed Hammered Texture Creative Love Design Aesthetic Drinking Mug For Women Breakfast Home
like
Find Similar
Hammered heart-shaped glass cup with 150ml capacity and unique ins style aesthetic - 150ML / Hammered Texture Heart Cup
Iridescent heart-shaped glass cup with vertical texture, 150ml capacity with 7.5cm diameter - 150ML / Vertical Ribbed Heart Cup
Heart Shaped Glass Cup Clear Ribbed Hammered Texture Creative Love Design Aesthetic Drinking Mug For Women Breakfast Home
-5%
$0.49
No MOQ
 · 
200 sold recently
Silicone Straw Covers And Cup Boot With Glitter Butterfly Bow Pendants For Tumblers Decorative Accessories
Silicone Straw Covers And Cup Boot With Glitter Butterfly Bow Pendants For Tumblers Decorative Accessories
like
Find Similar
Detailed set of white glitter bows and golden butterfly charms for Stanley tumbler cups - White
Pink glitter butterfly straw covers and silicone boot set for 40oz tumblers - Pink
Blue glitter butterfly straw cover set with silicone boot and gold charm chains for cups - Blue
Glitter butterfly straw cover set with silicone cup sleeve and gold chain for water cups - Green
+4
Silicone Straw Covers And Cup Boot With Glitter Butterfly Bow Pendants For Tumblers Decorative Accessories
$3.72
Mix MOQ : 2
 · 
48 views
Disco Ball Cup With Cowboy Hat Lid And Straw Plastic Electroplated Reflective Party Drinkware Bachelorette Festival
Disco Ball Cup With Cowboy Hat Lid And Straw Plastic Electroplated Reflective Party Drinkware Bachelorette Festival
like
Find Similar
Silver disco ball cup with pink cowboy hat lid and pink straw on white background - 600ml / Rose Red Cowboy Hat
Creative 600ml disco ball tumbler with white cowboy hat lid and matching straw - 600ml / White Cowboy Hat
Silver disco ball drinking cup with orange cowboy hat lid for festive party supplies - 600ml / Coffee Cowboy Hat
Disco ball cup with pink cowboy hat lid and pink straw for creative party beverage service - 600ml / Pink Cowboy Hat
Disco Ball Cup With Cowboy Hat Lid And Straw Plastic Electroplated Reflective Party Drinkware Bachelorette Festival
$2.88
Mix MOQ : 2
 · 
10 sold recently
Cute Cartoon Waterproof PVC Stickers Korean Style For DIY Scrapbooking Journal Laptop Luggage Bottle Guitar Decorative Decals
Cute Cartoon Waterproof PVC Stickers Korean Style For DIY Scrapbooking Journal Laptop Luggage Bottle Guitar Decorative Decals
like
Find Similar
80pcs cute cartoon character stickers for journals and laptops featuring animals and kids - Childhood Memories Style
Cute Cartoon Waterproof PVC Stickers Korean Style For DIY Scrapbooking Journal Laptop Luggage Bottle Guitar Decorative Decals
$0.72
No MOQ
Large Capacity Water Bottle Plastic Big Belly Straw Strap Time Marker Cute Stickers Travel Sport Cup For Girls Kids
Large Capacity Water Bottle Plastic Big Belly Straw Strap Time Marker Cute Stickers Travel Sport Cup For Girls Kids
like
Find Similar
Clear large capacity water bottle with time markings and straw in white finish - 1300ml White Dual Drink With Stickers
Large purple gradient plastic water bottle with time markings and straw for fitness - 1300ml Purple Dual Drink With Stickers
Cute animal-shaped high capacity water bottle with strap in cream white variant - 1000ml White Bear Style
Milk tea colored bear shaped straw water bottle with a wide adjustable shoulder strap - 1000ml Coffee Bear Style
+15
Large Capacity Water Bottle Plastic Big Belly Straw Strap Time Marker Cute Stickers Travel Sport Cup For Girls Kids
$0.86-1.73
No MOQ
 · 
63 sold recently
Transparent Stackable Washi Tape Dispenser Storage Box Plastic Desktop Stationery Organizer With Serrated Cutter For Office School Hand Account
Transparent Stackable Washi Tape Dispenser Storage Box Plastic Desktop Stationery Organizer With Serrated Cutter For Office School Hand Account
like
Find Similar
Transparent washi tape dispenser with a green spool and sharp cutting edge for stationery - Green
Transparent plastic washi tape dispenser with beige cutter for office stationery - Yellow
Transparent desktop tape dispenser with cream-colored spindle for office stationery storage - Beige
Transparent multi-roll washi tape dispenser with five colorful tape rolls - Brown
Transparent Stackable Washi Tape Dispenser Storage Box Plastic Desktop Stationery Organizer With Serrated Cutter For Office School Hand Account
-5%
$1.01
No MOQ
 · 
36 views
Gothic Dark Academia Aesthetic Stickers Retro Mystical Occult Decals For Scrapbooking Journaling Laptop Fridge PVC Waterproof Stickers
Gothic Dark Academia Aesthetic Stickers Retro Mystical Occult Decals For Scrapbooking Journaling Laptop Fridge PVC Waterproof Stickers
like
Find Similar
Gothic dark aesthetic stickers with skull and vintage magic elements on white background - Dark Aesthetics Diary Style 1 (WES296)
50pcs Dark Academia Gothic stickers featuring skulls and mystical botanical patterns - Dark Aesthetics Diary Style 2 (WES297)
Gothic Dark Academia Aesthetic Stickers Retro Mystical Occult Decals For Scrapbooking Journaling Laptop Fridge PVC Waterproof Stickers
$0.86
No MOQ
 · 
27 sold recently
Wall Mounted Glasses Holder Punch-Free Adhesive Sunglasses Display Rack Plastic Home Organization Storage Organizer
Wall Mounted Glasses Holder Punch-Free Adhesive Sunglasses Display Rack Plastic Home Organization Storage Organizer
like
Find Similar
3 options
Wall Mounted Glasses Holder Punch-Free Adhesive Sunglasses Display Rack Plastic Home Organization Storage Organizer
$0.22
Mix MOQ : 2
 · 
233 sold recently
Wall Mounted Mop Holder No-Drill Broom Organizer Hook Plastic Non-Marking Self Adhesive Rack For Bathroom Kitchen
Wall Mounted Mop Holder No-Drill Broom Organizer Hook Plastic Non-Marking Self Adhesive Rack For Bathroom Kitchen
like
Find Similar
10 options
Wall Mounted Mop Holder No-Drill Broom Organizer Hook Plastic Non-Marking Self Adhesive Rack For Bathroom Kitchen
$0.01
Mix MOQ : 4
 · 
26 views
Dreamy Bubble Stickers PET Waterproof Transparent Decorative Decals For Journaling Laptop Guitar DIY Stationery Cute Watercolor Style Stickers
Dreamy Bubble Stickers PET Waterproof Transparent Decorative Decals For Journaling Laptop Guitar DIY Stationery Cute Watercolor Style Stickers
like
Find Similar
50 pieces pack of waterproof transparent dream bubble stickers for scrapbooking and laptops - Colorful Bubbles (Pack of 50)
Dreamy Bubble Stickers PET Waterproof Transparent Decorative Decals For Journaling Laptop Guitar DIY Stationery Cute Watercolor Style Stickers
$1.04
No MOQ
 · 
10 views
Adhesive Wall Hooks Transparent Plastic Punch Free Waterproof Heavy Duty Hangers For Bathroom Kitchen Home Organization
Adhesive Wall Hooks Transparent Plastic Punch Free Waterproof Heavy Duty Hangers For Bathroom Kitchen Home Organization
like
Find Similar
Self-adhesive square golden wall hook base with a transparent U-shaped plastic slot - 6x6cm / Gold Brushed Single Row
Silver shower gel holder with transparent U-shaped adhesive wall mount hook - 6x6cm / Silver Brushed Single Row
Transparent double U-shaped adhesive wall hooks for drill-free storage rack mounting - 14x6cm / Transparent Double Row
Transparent self-adhesive square wall hook with U-shaped slot for storage racks - 6x6cm / Transparent Single Row
+6
Adhesive Wall Hooks Transparent Plastic Punch Free Waterproof Heavy Duty Hangers For Bathroom Kitchen Home Organization
$0.01-0.02
Mix MOQ : 4
Japanese Style Hammered Glass Sake Carafe And Cups Peacock Blue Amber Gradient Wine Warmer Pot Home Bar
Japanese Style Hammered Glass Sake Carafe And Cups Peacock Blue Amber Gradient Wine Warmer Pot Home Bar
like
Find Similar
Peacock blue hammered glass sake cup 47ml with detailed dimensions on white background - 47ml / Peacock Blue Sake Cup
Japanese style amber hammered glass tea cup with textured finish and footed base - 50ml / Amber Sake Cup
Amber honeycomb textured glass jar with cork lid, studio shot on white background - Amber Sake Pot
Peacock blue Japanese hammered texture glass sake cup with green gradient finish - Peacock Blue Warming Tank
+6
Japanese Style Hammered Glass Sake Carafe And Cups Peacock Blue Amber Gradient Wine Warmer Pot Home Bar
$0.72-8.93
No MOQ
 · 
22 sold recently
Butterfly Phone Grip Acrylic Resin Retractable Foldable Adhesive Universal Stand For Smartphone Women Fashion
Butterfly Phone Grip Acrylic Resin Retractable Foldable Adhesive Universal Stand For Smartphone Women Fashion
like
Find Similar
Minimalist butterfly phone grip with black and white cow print and acrylic base - Transparent Spotted Butterfly
Macro shot of purple gradient butterfly phone grip with glitter finish on ceramic tray - Purple Butterfly
Detail shot of a pink butterfly phone griptok made of clear acrylic on a ceramic dish - Pink Butterfly
Close-up of a stylish black and white butterfly retractable phone grip on ceramic plate - Black and White Spotted Butterfly
+5
Butterfly Phone Grip Acrylic Resin Retractable Foldable Adhesive Universal Stand For Smartphone Women Fashion
-10%
$0.52
No MOQ
 · 
154 sold recently
Thumbs Up Shape Phone Holder Portable Flexible Plastic Desktop Tablet Stand For Universal Mobile Devices Office Home Use
Thumbs Up Shape Phone Holder Portable Flexible Plastic Desktop Tablet Stand For Universal Mobile Devices Office Home Use
like
Find Similar
Universal white thumb OK gesture phone holder for smartphones and tablets - Bulk/Loose Packaging / White
Dark grey thumb-up shaped flexible phone stand for creative desk support - Bulk/Loose Packaging / Black
Portable red thumb-up gesture phone holder and tablet stand made of flexible silicone - Bulk/Loose Packaging / Red
Bright yellow thumbs-up phone stand for portable tablet support on blue background - Bulk/Loose Packaging / Yellow
+28
Thumbs Up Shape Phone Holder Portable Flexible Plastic Desktop Tablet Stand For Universal Mobile Devices Office Home Use
-9%
$0.16-0.20
No MOQ
 · 
934 sold recently
Magnetic Phone Holder Water Bottle 304 Stainless Steel Vacuum Insulated Flask Sports Outdoor Gym Large Capacity
Magnetic Phone Holder Water Bottle 304 Stainless Steel Vacuum Insulated Flask Sports Outdoor Gym Large Capacity
like
Find Similar
Rose red insulated sports bottle with magnetic Booster Ring phone holder and matte finish - 1 L / Fuschia
Matte navy blue 1L sports water bottle with magnetic phone mount booster ring - 1 L / Indigo Blue
Mint green 1L magnetic phone holder water bottle with stainless steel matte finish - 1 L / Cyan White
White magnetic phone holder water bottle with booster ring for all mobile devices - 1 L / Ivory
+39
Magnetic Phone Holder Water Bottle 304 Stainless Steel Vacuum Insulated Flask Sports Outdoor Gym Large Capacity
$12.97
No MOQ
 · 
55 sold recently
Refillable Card Spray Bottle PETG Portable Fine Mist Travel Container With Silicone Sleeve And Hook For Hand Sanitizer
Refillable Card Spray Bottle PETG Portable Fine Mist Travel Container With Silicone Sleeve And Hook For Hand Sanitizer
like
Find Similar
Pink portable travel spray bottle with flat card shape design for perfume and sanitizer - Card Bottle / 45ml / Pink
Portable flat card-style spray bottle with white nozzle and clear bottom section - Card Bottle / 45ml / White
Light blue frame portable credit card shaped spray bottle for perfume or sanitizer - Card Bottle / 45ml / Blue
Portable purple 38ml card spray bottle with transparent reservoir for perfume refills - Card Bottle / 45ml / Purple
+6
Refillable Card Spray Bottle PETG Portable Fine Mist Travel Container With Silicone Sleeve And Hook For Hand Sanitizer
$0.43-0.55
No MOQ
 · 
395 sold recently
Top 10% Best Sellers
in Storage & Organization
Creative Football Soccer Sunglasses With World Cup National Flag For Fans Cheering Props Party Supplies Men Women Decor
Creative Football Soccer Sunglasses With World Cup National Flag For Fans Cheering Props Party Supplies Men Women Decor
like
Find Similar
Close-up of soccer ball shaped party sunglasses featuring US flags on top of the frame - United States
World Cup soccer ball sunglasses with Canadian flag flags for sports fans and events - Canada
Detail of soccer themed party sunglasses with football frames and Mexico flag flags - Mexico
Soccer ball glasses with Portugal flags for World Cup fans and sports events - Portugal Style
+17
Creative Football Soccer Sunglasses With World Cup National Flag For Fans Cheering Props Party Supplies Men Women Decor
$1.87
No MOQ
 · 
325 sold recently
PVC Waterproof Graffiti Stickers For Suitcase Laptop Skateboards Assorted Cartoon Animal Astronaut Landscape Decals Decor
PVC Waterproof Graffiti Stickers For Suitcase Laptop Skateboards Assorted Cartoon Animal Astronaut Landscape Decals Decor
like
Find Similar
Assorted colorful waterproof cartoon animal stickers for laptop and luggage decoration - Cute Cartoon Animal Style (T01040459)
Colorful cartoon transport stickers featuring planes, cars, and trucks for luggage decor - Transportation Theme Style (T01040596)
Retro hand-drawn inspirational slogan stickers with rainbow and floral patterns - Vintage Inspirational Slogan Style (T01040554)
Set of 100 vibrant cartoon animal stickers featuring pandas and elephants for luggage decoration - Cute Forest Animals Large Set (BP-0000711)
+3
PVC Waterproof Graffiti Stickers For Suitcase Laptop Skateboards Assorted Cartoon Animal Astronaut Landscape Decals Decor
$0.92-2.02
Mix MOQ : 2
Go to

More in home & kitchen

Explore more in suction cups

wallplasticwindowbabystainlessadjustableholidaypartyroundstorage rack
hangingracksteelshapewarmcleaningfoothomeopenpet

Ready to source like an insider

Get a direct line to the factory floor — no minimums, no middlemen, no guesswork.
iconReal factory pricing, no markup in betweeniconEvery order hand-inspected before it shipsicon5,000+ new products added daily
Get Inside Access