Everful

Wholesale plush flowers

Factory-direct selection, vetted for quality and ready to order.

Sign Up
Plush Flowers

Find the perfect pieces: hats, keychains, hair accessories and more

filterShow Filters
Best Seller
New Arrivals
Price Drop
Free Shipping
Sweet Plush Faux Mink Fur Hair Clips For Kids Girls Knitted Fabric Geometric BB Clips Soft Warm Hair Pins Hair Accessories
Sweet Plush Faux Mink Fur Hair Clips For Kids Girls Knitted Fabric Geometric BB Clips Soft Warm Hair Pins Hair Accessories
like
Find Similar
Brown faux mink fur drop hair clip 5cm oval BB barrette for autumn and winter styles - Ellipse / 5cm / Brown
Soft beige fuzzy mink fur hair clip with knitted texture and 5cm waterdrop shape design - Ellipse / 5cm / Khaki
Beige 6.2cm faux mink fur teardrop hair clip with a soft knit texture for women - Square / 6.2cm / Khaki
Brown faux mink fur rectangular hair clip with soft fuzzy texture measuring 6.2cm long - Square / 6.2cm / Brown
+3
Sweet Plush Faux Mink Fur Hair Clips For Kids Girls Knitted Fabric Geometric BB Clips Soft Warm Hair Pins Hair Accessories
$0.17-0.23
No MOQ
Easter Plush Bunny Carrot Hair Clips For Kids Cute Animal Costume Party Decoration Accessories Handmade Bunny Ears Hairpins
Easter Plush Bunny Carrot Hair Clips For Kids Cute Animal Costume Party Decoration Accessories Handmade Bunny Ears Hairpins
like
Find Similar
Plush white bunny on orange carrot hair clip for Easter, size 8cm by 6.5cm - White Bunny With Carrot
Mini plush Easter hair clip featuring a pink bunny on a carrot, size 6.5x8cm - Pink Bunny With Carrot
Cute plush Easter bunny hair clip with orange carrot base and red rabbit ears 6.5cm - Red Bunny With Carrot
Gray plush Easter bunny clip on orange carrot base with dimensions 8cm by 6.5cm - Gray Bunny With Carrot
+3
Easter Plush Bunny Carrot Hair Clips For Kids Cute Animal Costume Party Decoration Accessories Handmade Bunny Ears Hairpins
-4%
$0.60
Mix MOQ : 2
Easter Plush Rabbit Carrot Hair Clips Handmade Cartoon Bunny Alligator Clips For Kids Party Costume Photography Hair Accessories
Easter Plush Rabbit Carrot Hair Clips Handmade Cartoon Bunny Alligator Clips For Kids Party Costume Photography Hair Accessories
like
Find Similar
Plush Easter hair clip featuring a white bunny and orange carrot, 8cm handmade accessory - White Rabbit Carrot Style
Pink plush rabbit with carrot hair clip, cute Easter accessory, size 8cm x 6.5cm - Pink Rabbit Carrot Style
Easter hair clip featuring a cute red plush bunny on an orange carrot base, 8cm long - Red Rabbit Carrot Style
Handmade plush Easter bunny hair clip with carrot decor, 6.5cm height and 8cm length - Gray Rabbit Carrot Style
+3
Easter Plush Rabbit Carrot Hair Clips Handmade Cartoon Bunny Alligator Clips For Kids Party Costume Photography Hair Accessories
$0.61
Mix MOQ : 2
Cute Plush Unicorn Crossbody Bag For Kids Girls Rainbow Gradient Furry Mini Shoulder Bag Round Coin Purse Birthday Gift
Cute Plush Unicorn Crossbody Bag For Kids Girls Rainbow Gradient Furry Mini Shoulder Bag Round Coin Purse Birthday Gift
like
Find Similar
Detail of plush rainbow unicorn shoulder bag showing sequin ears and silver horn - Multicolor Plush
Detailed close-up of plush unicorn crossbody bag with rainbow faux fur and silver horn - Purple Plush
Plush unicorn crossbody bag for kids with rainbow gradient fur and golden horn detail - Multicolor with Fringe Detail
Close-up of pink plush unicorn crossbody bag with golden horn and soft faux fur texture - Pink with Fringe Detail
Cute Plush Unicorn Crossbody Bag For Kids Girls Rainbow Gradient Furry Mini Shoulder Bag Round Coin Purse Birthday Gift
-4%
$1.18
No MOQ
Kids Cute Flower Hair Ties Set Resin Floral Elastic Bands For Girls Macaron Colors Toddler Hair Accessories Ponytail Holders
Kids Cute Flower Hair Ties Set Resin Floral Elastic Bands For Girls Macaron Colors Toddler Hair Accessories Ponytail Holders
like
Find Similar
Detail showing five pairs of colorful flower hair elastics on a cute strawberry card - Multicolor Mixed
NewKids Cute Flower Hair Ties Set Resin Floral Elastic Bands For Girls Macaron Colors Toddler Hair Accessories Ponytail Holders
$1.15
Mix MOQ : 2
Infant Christmas Headband And Decorative Glasses Polyester Plush Snowflake Bowknot Festive Photography Props For Babies
Infant Christmas Headband And Decorative Glasses Polyester Plush Snowflake Bowknot Festive Photography Props For Babies
like
Find Similar
Detail view of red Christmas baby headband with pom pom and glitter santa hat glasses frame - Christmas Hat Style (A)
Close-up of baby Christmas headband with large red bow and snowman decorative glasses - Snowman Style (B)
Detailed view of red fur bow headband and Santa Claus glitter glasses for Christmas - Santa Claus Style (C)
Christmas baby set with green knit headband, white bow, and glittery Santa hat glasses - Green Christmas Hat Style (D)
+2
Infant Christmas Headband And Decorative Glasses Polyester Plush Snowflake Bowknot Festive Photography Props For Babies
$1.33
No MOQ
Girls Mini Crossbody Bag Puffy Handle Plush Heart Star Decor PU Leather Denim Plaid Cute Fashion Small Shoulder Handbag
Girls Mini Crossbody Bag Puffy Handle Plush Heart Star Decor PU Leather Denim Plaid Cute Fashion Small Shoulder Handbag
like
Find Similar
Mini green crossbody bag with soft pink handle and heart star charms for girls - Green
Pink mini cloud handbag for girls with plush heart patch and colorful star accents - Pink
Mini colorful plaid children's crossbody bag with pink handle and plush heart patch - Colorful
Blue denim mini cloud bag with pink soft handle and plush heart for sweet girls - Light Blue
+1
Girls Mini Crossbody Bag Puffy Handle Plush Heart Star Decor PU Leather Denim Plaid Cute Fashion Small Shoulder Handbag
$7.78
No MOQ
Kids Chest Bag Crossbody Bag Canvas Plush Rabbit Decoration Adjustable Printed Strap Cute Toddler Lightweight Travel Purse
Kids Chest Bag Crossbody Bag Canvas Plush Rabbit Decoration Adjustable Printed Strap Cute Toddler Lightweight Travel Purse
like
Find Similar
Black canvas kids chest bag with white plush bunny and colorful printed strap - Black
Cream white canvas kids chest bag with plush rabbit doll and colorful cartoon strap - White
Pink canvas kids chest bag featuring a plush white bunny with patterned straps - Purple
Pink canvas kids chest bag featuring 3D white plush bunny and Happy Baby prints - Pink
+1
Kids Chest Bag Crossbody Bag Canvas Plush Rabbit Decoration Adjustable Printed Strap Cute Toddler Lightweight Travel Purse
$4.61
No MOQ
Cute Baby Plush Ear Protection Beanie Winter Warm Soft Beanie Hat With Pom Poms Button Fastener For Toddler Boys Girls
Cute Baby Plush Ear Protection Beanie Winter Warm Soft Beanie Hat With Pom Poms Button Fastener For Toddler Boys Girls
like
Find Similar
Pink fleece baby winter hat with plush pom-poms and warm ear flaps for toddlers - 46-50cm (6 Months - 2 Years) / Pink
Detail of baby plush earflap hat with soft lamb wool texture and wooden button closure - 46-50cm (6 Months - 2 Years) / Beige
Cute baby winter plush earflap hat with dual grey pom-poms and wooden button closure - 46-50cm (6 Months - 2 Years) / Cream
Cute baby winter plush earflap hat with double pom-poms and warm brown teddy fleece - 46-50cm (6 Months - 2 Years) / Coffee
+1
Cute Baby Plush Ear Protection Beanie Winter Warm Soft Beanie Hat With Pom Poms Button Fastener For Toddler Boys Girls
$2.68
No MOQ
Cute Knitted Plush Hair Ties With Artificial Pearls Handmade Elastic Scrunchies For Kids Girls Winter Hair Accessories
Cute Knitted Plush Hair Ties With Artificial Pearls Handmade Elastic Scrunchies For Kids Girls Winter Hair Accessories
like
Find Similar
Pink fuzzy plush hair scrunchie with colorful yarn accents and white pearl beads - Pink
Cute black plush scrunchie with colorful accents and pearl beads in a ceramic dish - Black
Brown plush scrunchie with colorful pom poms and white faux pearls in a warm, elegant setting - Khaki
Grey plush hair scrunchie with colorful dots and white pearls on ceramic plate - White
+1
Cute Knitted Plush Hair Ties With Artificial Pearls Handmade Elastic Scrunchies For Kids Girls Winter Hair Accessories
$0.20
No MOQ
Cute Bear Plush Decor Nylon Crossbody Bag For Women Girls Japanese Style Contrast Color Shoulder Bag Daily Messenger Bag
Cute Bear Plush Decor Nylon Crossbody Bag For Women Girls Japanese Style Contrast Color Shoulder Bag Daily Messenger Bag
like
Find Similar
Mini cream canvas crossbody bag with cute 3D plush bear and yellow dinosaur pocket - White
Cute black canvas crossbody bag with white plush bear and bunny patches for women - Black
Cute Bear Plush Decor Nylon Crossbody Bag For Women Girls Japanese Style Contrast Color Shoulder Bag Daily Messenger Bag
$2.45
No MOQ
Kids Red Festive Hair Clip Set Plush Gingham Bowknot Barrettes For Lunar New Year Christmas Cute Children Hair Accessories
Kids Red Festive Hair Clip Set Plush Gingham Bowknot Barrettes For Lunar New Year Christmas Cute Children Hair Accessories
like
Find Similar
Three-piece red bow and starfish hair clips set for children on white card - Red Velvet Bow With Pearl And Starfish Set (1#)
Three-piece set of red festive hair clips with plaid and tweed bow designs for girls - Red Gold Tweed And Houndstooth Bow Set (2#)
Three-piece red festive hair clips with velvet bow and plush heart on card - Red Velvet Gold Heart And Metallic Bow Set (3#)
Kids Red Velvet Bow and Knitted Flower Hair Clips Set for New Year Hair Accessories - Red Velvet Satin Bow And Knit Flower Set (4#)
+1
Kids Red Festive Hair Clip Set Plush Gingham Bowknot Barrettes For Lunar New Year Christmas Cute Children Hair Accessories
$0.84
Mix MOQ : 2
Handmade Plush Cat Ear Hair Clips Set Cute Cartoon Animal Hairpins Hair Accessories For Little Girls Daily Jewelry Gift
Handmade Plush Cat Ear Hair Clips Set Cute Cartoon Animal Hairpins Hair Accessories For Little Girls Daily Jewelry Gift
like
Find Similar
Pair of white plush cat ear hair clips with colorful glitter strips and pink glitter center - White Style 1
Cute plush cat ear hair clips for girls in black and white with pink glitter details - White Style 2
Cute pair of yellow plush cat ear hair clips with red felt detail and purple wave accents - Yellow Style
Cute mint green plush cat ear hair clips with blue sequins and a pink star for girls - Green
Handmade Plush Cat Ear Hair Clips Set Cute Cartoon Animal Hairpins Hair Accessories For Little Girls Daily Jewelry Gift
$0.70
Mix MOQ : 2
Kawaii Japanese Style Cartoon Rabbit Ears Backpack Nylon Casual School Bag For Girls Teenagers Cute Bunny Plush Decor
Kawaii Japanese Style Cartoon Rabbit Ears Backpack Nylon Casual School Bag For Girls Teenagers Cute Bunny Plush Decor
like
Find Similar
Mint green school backpack featuring cute rabbit plush ears and Lifan Rabbit embroidery - Green
Cute lavender purple rabbit ear backpack with cream accents and Yifan Rabbit embroidery - Purple
Pastel blue school backpack featuring cute plush bunny ears and a rabbit charm - Blue
Cute black canvas backpack featuring plush rabbit ears and a cartoon bunny character - Black
Kawaii Japanese Style Cartoon Rabbit Ears Backpack Nylon Casual School Bag For Girls Teenagers Cute Bunny Plush Decor
$8.65
No MOQ
 · 
15 views
Cute Lamb Wool Rabbit Shoulder Bag Mini Plush Crossbody Handbag With Embroidery For Women Girls Kawaii Faux Fur Purse
Cute Lamb Wool Rabbit Shoulder Bag Mini Plush Crossbody Handbag With Embroidery For Women Girls Kawaii Faux Fur Purse
like
Find Similar
Detail of plush lamb wool mini bag featuring a cute bunny 3D decor and white embroidery - White
Detail of pink faux shearling bag with 3D bunny decor and Cutie embroidery detail - Pink
Detail of plush beige dumpling bag featuring a round handle and cute bunny pendant - Brown
Close-up of teddy plush moon bag featuring a cute bunny patch and Cutie embroidery - Coffee
Cute Lamb Wool Rabbit Shoulder Bag Mini Plush Crossbody Handbag With Embroidery For Women Girls Kawaii Faux Fur Purse
$3.17
No MOQ
Cat Coin Purse Plush Mini Earphone Storage Pouch Keychain Pendant Cartoon Embroidered Small Zipper Wallet For Kids
Cat Coin Purse Plush Mini Earphone Storage Pouch Keychain Pendant Cartoon Embroidered Small Zipper Wallet For Kids
like
Find Similar
Detail of yellow plush cat coin purse with metal zipper hanging on a canvas bag - Approx. 10cm / Yellow
Cat Coin Purse Plush Mini Earphone Storage Pouch Keychain Pendant Cartoon Embroidered Small Zipper Wallet For Kids
$0.58
No MOQ
 · 
18 views
Cute Kids Flower Decoration Oval Polyester Shoulder Bag Fashion Girls Mini Handbag Sweet Crossbody Purse For Daily Match
Cute Kids Flower Decoration Oval Polyester Shoulder Bag Fashion Girls Mini Handbag Sweet Crossbody Purse For Daily Match
like
Find Similar
4 options
Cute Kids Flower Decoration Oval Polyester Shoulder Bag Fashion Girls Mini Handbag Sweet Crossbody Purse For Daily Match
$4.61
No MOQ
Kids Animal Backpack Cartoon Neoprene Plush Anti Lost Leash Toddler School Bag Lightweight For Preschool Boys Girls
Kids Animal Backpack Cartoon Neoprene Plush Anti Lost Leash Toddler School Bag Lightweight For Preschool Boys Girls
like
Find Similar
Cartoon zebra toddler backpack made of soft diving material with mesh side pocket - Neoprene Zebra
Toddler backpack featuring a 3D plush bumblebee design in vibrant orange and yellow tones - Neoprene Bee
Kids Animal Backpack Cartoon Neoprene Plush Anti Lost Leash Toddler School Bag Lightweight For Preschool Boys Girls
$14.12
No MOQ
 · 
25 views
Elastic Polyester Knitted Baby Headband With 3D Plush Rabbit Ear Cute Infant Hair Band For Toddler Girls Headwear Accessory
Elastic Polyester Knitted Baby Headband With 3D Plush Rabbit Ear Cute Infant Hair Band For Toddler Girls Headwear Accessory
like
Find Similar
Pink knitted baby headband with a cute 3D plush rabbit head and soft elastic fabric - Pink
Close-up of white soft knit baby headband with 3D plush bunny and embroidery - White
Detail of baby elastic headband in light blue rib knit fabric with a cute 3D bunny ornament - Blue
Detail of yellow knit baby headband with cute plush rabbit ornament and cable texture - Yellow
+2
Elastic Polyester Knitted Baby Headband With 3D Plush Rabbit Ear Cute Infant Hair Band For Toddler Girls Headwear Accessory
$0.69
No MOQ
Star Plush Hair Clips Knitted Fabric Pentagram Hair Pins Cute Sweet Side Clips Hair Accessories For Kids Girls Daily Use
Star Plush Hair Clips Knitted Fabric Pentagram Hair Pins Cute Sweet Side Clips Hair Accessories For Kids Girls Daily Use
like
Find Similar
Detail of star-shaped plush hair clips with blue and white pattern on ceramic plate - Blue
Detail of star-shaped hair clips in rosy pink plush texture on brand display card - Pink
Detail view of handmade star plush hair clips on a ceramic plate with warm background decor - Red
Detailed view of handmade star-shaped hair clips with striped knit fabric on a ceramic plate - Brown
+2
NewStar Plush Hair Clips Knitted Fabric Pentagram Hair Pins Cute Sweet Side Clips Hair Accessories For Kids Girls Daily Use
$1.41
No MOQ
Free Shipping
Kids Newsboy Cap Vintage Polyester Beret Hat With Plush Trim For Boys Girls Warm Winter Painter Hat Adjustable
Kids Newsboy Cap Vintage Polyester Beret Hat With Plush Trim For Boys Girls Warm Winter Painter Hat Adjustable
like
Find Similar
Classic black newsboy hat for kids with brown faux fur trim and gold metal R detail - One Size (Head Circumference 48-52cm) / Black
Brown suede kids beret hat with faux fur trim and octagonal shape for winter warmth - One Size (Head Circumference 48-52cm) / Khaki
Vintage brown suede baker boy hat with beige faux fur trim and metal logo detail - One Size (Head Circumference 48-52cm) / Coffee
+3
Kids Newsboy Cap Vintage Polyester Beret Hat With Plush Trim For Boys Girls Warm Winter Painter Hat Adjustable
$8.33
Mix MOQ : 2
Free Shipping
Christmas Hair Accessories Set Plush Reindeer Santa Claus Christmas Tree Hair Clips Brooches 4-Piece Festive Gift For Women Kids
Christmas Hair Accessories Set Plush Reindeer Santa Claus Christmas Tree Hair Clips Brooches 4-Piece Festive Gift For Women Kids
like
Find Similar
Christmas hair accessory set with red reindeer antlers, Santa clips and plush hair ties - Santa Claus Set / Four-Piece Set
4-piece Christmas hair accessory set featuring reindeer antlers and plush stars on card - Reindeer Set / Four-Piece Set
Christmas hair accessories set with reindeer plush scrunchie and festive tree hair clips - Christmas Tree Set / Four-Piece Set
Christmas Hair Accessories Set Plush Reindeer Santa Claus Christmas Tree Hair Clips Brooches 4-Piece Festive Gift For Women Kids
-4%
$1.91
Mix MOQ : 2
Kids School Backpack For Boys Girls Nylon Cartoon Bear Printed Bag With Plush Bear Pendant Lightweight Toddler Backpack
Kids School Backpack For Boys Girls Nylon Cartoon Bear Printed Bag With Plush Bear Pendant Lightweight Toddler Backpack
like
Find Similar
Black and white canvas kids backpack with cartoon bear print and plush charm accessory - Black
Pink children's canvas backpack featuring a cartoon animal print and a plush bear pendant - Pink
Yellow kids backpack with cartoon bear print and cute plush bear keychain accessory - Yellow
Sky blue kids bear backpack with plush toy pendant and yellow cartoon bear print - Blue
+1
Kids School Backpack For Boys Girls Nylon Cartoon Bear Printed Bag With Plush Bear Pendant Lightweight Toddler Backpack
-5%
$4.65
No MOQ
Cute Canvas Chest Bag For Kids Girls With Plush Rabbit Doll Decoration Adjustable Strap Casual Crossbody Waist Pouch
Cute Canvas Chest Bag For Kids Girls With Plush Rabbit Doll Decoration Adjustable Strap Casual Crossbody Waist Pouch
like
Find Similar
Cute bright yellow canvas crossbody bag featuring a 3D plush bunny doll and adjustable strap - Yellow
Cute red and white canvas crossbody bag for girls featuring a 3D bunny plush decoration - Red
Green canvas crossbody chest bag with cute plush rabbit doll and adjustable strap - Green
Cute black canvas crossbody bag for kids with cream bunny plush toy decoration - Black
+1
Cute Canvas Chest Bag For Kids Girls With Plush Rabbit Doll Decoration Adjustable Strap Casual Crossbody Waist Pouch
-3%
$2.68
No MOQ
Baby Turban Hat Cute Plush Rabbit Knitted Beanie Warm Winter Infant Toddler Headwrap Solid Color Bohemian Soft Kids Hat
Baby Turban Hat Cute Plush Rabbit Knitted Beanie Warm Winter Infant Toddler Headwrap Solid Color Bohemian Soft Kids Hat
like
Find Similar
Cute pink knitted baby turban hat with stuffed 3D bunny decoration for winter warmth - Nude Pink
Soft mint green baby knitted hat with cute bunny ornament and warm vertical ribbed texture - Mint Green
Cute orange baby knit hat featuring a soft 3D plush rabbit doll design for winter warmth - Orange
Cute yellow knitted baby beanie with plush rabbit character for warm winter protection - Khaki/Earth Yellow
+1
NewBaby Turban Hat Cute Plush Rabbit Knitted Beanie Warm Winter Infant Toddler Headwrap Solid Color Bohemian Soft Kids Hat
$0.98
No MOQ
Cartoon Animal Plush Hair Ties Cute Fabric Doll Hair Scrunchies For Girls Kids Rabbit Panda Bear Frog Elastic Hair Bands
Cartoon Animal Plush Hair Ties Cute Fabric Doll Hair Scrunchies For Girls Kids Rabbit Panda Bear Frog Elastic Hair Bands
like
Find Similar
Detail of cute yellow plush cat hair accessory on a white display card over a wooden desk - Yellow Cat Style
Detail of cute knitted panda plush accessory with a brown scarf and Pom.Kr brand card - Black and White Panda Style
Cartoon Animal Plush Hair Ties Cute Fabric Doll Hair Scrunchies For Girls Kids Rabbit Panda Bear Frog Elastic Hair Bands
$2.75
No MOQ
Free Shipping
Cute Rabbit Ears Striped Backpack Nylon Schoolbag With Plush Stars Apple Embroidery For Teenage Girls Casual Travel Daypack
Cute Rabbit Ears Striped Backpack Nylon Schoolbag With Plush Stars Apple Embroidery For Teenage Girls Casual Travel Daypack
like
Find Similar
Cute blue and white striped backpack with plush stars and apple embroidery for school girls - With Plush Stars / Blue
Cute pink striped backpack with rabbit ears and apple patch for teenage girls - With Plush Stars / Pink
Cute Rabbit Ears Striped Backpack Nylon Schoolbag With Plush Stars Apple Embroidery For Teenage Girls Casual Travel Daypack
$4.61-5.19
Mix MOQ : 2
Cute Plush Bear Ear Headband For Kids Girls Korean Style Soft Faux Fur Hair Band For Face Washing Daily Hair Accessories
Cute Plush Bear Ear Headband For Kids Girls Korean Style Soft Faux Fur Hair Band For Face Washing Daily Hair Accessories
like
Find Similar
Plush lamb wool light green bear ear headband for children featuring fuzzy round ears - Light Green
Cute brown plush bear ear headband with soft faux lamb wool texture for girls - Khaki
Cute light blue plush bear ear headband for girls made of soft teddy fleece fabric - Blue
Pink plush teddy bear ear headband for girls, made of soft fleece material for cute style - Rose Red
Cute Plush Bear Ear Headband For Kids Girls Korean Style Soft Faux Fur Hair Band For Face Washing Daily Hair Accessories
$0.71
No MOQ
Cute Tie-Dye Plush Cat Face Crossbody Bag For Kids Cartoon Embroidery Soft Semicircle Shoulder Bag For Daily Decoration
Cute Tie-Dye Plush Cat Face Crossbody Bag For Kids Cartoon Embroidery Soft Semicircle Shoulder Bag For Daily Decoration
like
Find Similar
Close-up of the tie-dye plush crossbody bag with cute cat embroidery and pink strap - Semicircle Cat Style / Pink Tie-dye
Close-up of the tie-dye plush cat crossbody bag with soft pink embroidery and strap - Semicircle Cat Style
Close-up of cat-shaped plush crossbody bag showing tie-dye fur and embroidery details - Semicircle Cat Style / Purple Multicolor Tie-Dye
NewCute Tie-Dye Plush Cat Face Crossbody Bag For Kids Cartoon Embroidery Soft Semicircle Shoulder Bag For Daily Decoration
$1.96
No MOQ
Cute Panda Plush Crossbody Bag Cartoon Animal Shape Shoulder Handbag For Women Teen Girls Versatile Small Plush Purse
Cute Panda Plush Crossbody Bag Cartoon Animal Shape Shoulder Handbag For Women Teen Girls Versatile Small Plush Purse
like
Find Similar
Cute panda plush crossbody bag with red strawberry detail and adjustable red nylon strap - Red
Cute panda plush handbag in black and white with pink straps and strawberry detail - Pink
Cute panda plush crossbody bag in black and white with green bamboo detail - Green
Cute Panda Plush Crossbody Bag Cartoon Animal Shape Shoulder Handbag For Women Teen Girls Versatile Small Plush Purse
$3.89
Mix MOQ : 3
Cartoon Animal Plush Hair Ties Embroidered Rabbit Duck Bear Koala Elastic Hair Bands Sweet Hair Scrunchies For Kids Girls
Cartoon Animal Plush Hair Ties Embroidered Rabbit Duck Bear Koala Elastic Hair Bands Sweet Hair Scrunchies For Kids Girls
like
Find Similar
Detail of two plush brown bear hair ties with embroidery on a ceramic flower plate - Bear Style
Close-up of cute cartoon stuffed duck hair ties with embroidery on a ceramic tray - Duck Style
Close-up of pink 3D stuffed bunny hair ties with detailed embroidery on a display card - Rabbit Style
Detail of plush koala hair ties with blue linen texture and fine animal embroidery - Koala Style
+1
Cartoon Animal Plush Hair Ties Embroidered Rabbit Duck Bear Koala Elastic Hair Bands Sweet Hair Scrunchies For Kids Girls
$1.21-1.30
Mix MOQ : 2
Cute Rabbit Ears Children's Backpack For Girls Nylon Waterproof School Bag With Plush Tail Ball Sweet Lightweight Kids Mini Backpack
Cute Rabbit Ears Children's Backpack For Girls Nylon Waterproof School Bag With Plush Tail Ball Sweet Lightweight Kids Mini Backpack
like
Find Similar
Cute black rabbit backpack with white ears and plush tail decoration for girls - Black
Cute white bunny-shaped backpack for girls with long ears and plush pom-pom tail - White
Cute pink girl backpack with white bunny ears and plush ball detail in a warm home setting - Pink
Cute bright blue rabbit backpack for girls with soft white bunny ears and pom-pom tail - Blue
+1
Cute Rabbit Ears Children's Backpack For Girls Nylon Waterproof School Bag With Plush Tail Ball Sweet Lightweight Kids Mini Backpack
$4.47
No MOQ
Handmade Cartoon Animal Cloth Hair Clips For Kids Women Cute Bear Rabbit Mushroom Dog Plush Hairpins Soft Headwear Accessories
Handmade Cartoon Animal Cloth Hair Clips For Kids Women Cute Bear Rabbit Mushroom Dog Plush Hairpins Soft Headwear Accessories
like
Find Similar
Cute brown corduroy bear hair clip for kids with blue beret hat on beige tray - 1# Bear with Red Scarf Style
Detailed macro view of handmade plaid knitted hair clip with white faux fur and pompom trim - 4# Cake Style
Close-up of a plush koala charm with a white chef hat on a beige linen display tray - 5# Grey Bear with White Hat
Detailed close-up of handmade brown fabric bear hair clip with a red scarf on a tray - 17# Large Bear Style
+2
Handmade Cartoon Animal Cloth Hair Clips For Kids Women Cute Bear Rabbit Mushroom Dog Plush Hairpins Soft Headwear Accessories
$0.86-2.85
No MOQ
Free Shipping
Cute Bunny Mini Plush Shoulder Bag For Women Girls Lamb Wool Handbag Crossbody Bag Cutie Embroidery Small Satchel
Cute Bunny Mini Plush Shoulder Bag For Women Girls Lamb Wool Handbag Crossbody Bag Cutie Embroidery Small Satchel
like
Find Similar
Khaki plush teddy bag with Cutie embroidery and bunny patch, crossbody style - Brown
Cute white faux shearling shoulder bag with plush bunny ornament and embroidery - White
Pink lamb wool tote bag with cute rabbit embroidery and Cutie text decoration - Pink
Cute dark brown plush lamb wool handbag with bunny decor and Cutie embroidery - Brown
NewCute Bunny Mini Plush Shoulder Bag For Women Girls Lamb Wool Handbag Crossbody Bag Cutie Embroidery Small Satchel
-4%
$2.88
No MOQ
Kids Knitted Scarf Cartoon Animal Fox Shape Plush Pom Poms Warm Autumn Winter Crossover Neck Warmer For Baby Toddler
Kids Knitted Scarf Cartoon Animal Fox Shape Plush Pom Poms Warm Autumn Winter Crossover Neck Warmer For Baby Toddler
like
Find Similar
Detail of yellow knit children scarf with cute animal design and navy blue pom-pom accent - Turmeric
Detail of red knit kids scarf featuring navy pompoms and white circular decorations - Burgundy
Grey knitted children's scarf with orange pompoms and soft texture on white background - Light Gray
Detailed knit texture of a warm kids scarf featuring white pom-poms and cross-through style - Sky Blue
Kids Knitted Scarf Cartoon Animal Fox Shape Plush Pom Poms Warm Autumn Winter Crossover Neck Warmer For Baby Toddler
$3.03
No MOQ
Kids Backpack Lightweight Nylon Large Capacity Ink Landscape Print New Chinese Style Students School Bag With Plush Pendant
Kids Backpack Lightweight Nylon Large Capacity Ink Landscape Print New Chinese Style Students School Bag With Plush Pendant
like
Find Similar
Chic pink and white marble pattern lightweight travel backpack for girls - Pink
New Chinese style backpack for women with red landscape ink print on white waterproof canvas - Red
Lightweight floral print backpack with mountain pattern and forest green accents - Green
Ink landscape print backpack in white with black trim and multi-pocket design - Black
NewKids Backpack Lightweight Nylon Large Capacity Ink Landscape Print New Chinese Style Students School Bag With Plush Pendant
$9.08
No MOQ
Cute Rabbit Ear Plush Mini Backpack Plaid Faux Fur Drawstring Bucket Bag For Women Teens Korean Style Fashion
Cute Rabbit Ear Plush Mini Backpack Plaid Faux Fur Drawstring Bucket Bag For Women Teens Korean Style Fashion
like
Find Similar
Cute brown rabbit backpack with fluffy fur ears and vintage checkered pattern detail - Brown
Plush bunny backpack with black and white checkered ears and fluffy rabbit design - Black
Cute grey plaid rabbit backpack with soft white faux fur and floppy ears for girls - Grey Plaid
Cute Korean style plaid plush backpack with rabbit ears and Happy Days patch - Brown Grid
Cute Rabbit Ear Plush Mini Backpack Plaid Faux Fur Drawstring Bucket Bag For Women Teens Korean Style Fashion
-4%
$9.86
No MOQ
Kids Mini Backpack With 3D Plush Rabbit Doll PU Suede Lightweight Cartoon Animal School Bag For Toddler Girls Boys
Kids Mini Backpack With 3D Plush Rabbit Doll PU Suede Lightweight Cartoon Animal School Bag For Toddler Girls Boys
like
Find Similar
Cute pink plush rabbit backpack for toddlers with adjustable straps and soft texture - Pink
Detail of mini plush backpack with cute white rabbit doll in front pocket for girls - Brown
Detail of a mini brown suede backpack featuring a cute 3D white plush rabbit doll - Brown
Leopard print mini backpack featuring a 3D plush bunny doll and brown leather straps - Leopard Brown
Kids Mini Backpack With 3D Plush Rabbit Doll PU Suede Lightweight Cartoon Animal School Bag For Toddler Girls Boys
$9.51
No MOQ
Kids Backpack Cute Bunny Ears Corduroy Plush Checkered Cartoon Toddler School Bag Adjustable Straps Kawaii Daypack
Kids Backpack Cute Bunny Ears Corduroy Plush Checkered Cartoon Toddler School Bag Adjustable Straps Kawaii Daypack
like
Find Similar
Pink plush bunny ear backpack for kids with checkered lining and soft corduroy fabric - Pink
Yellow corduroy child backpack with plush rabbit ears and checkered fabric accents - Yellow
Cute kids backpack with corduroy bunny ears and plush checkerboard details for school - Brown
Brown corduroy toddler backpack with plush white bunny ears and a cute checkered pattern - Brown
Kids Backpack Cute Bunny Ears Corduroy Plush Checkered Cartoon Toddler School Bag Adjustable Straps Kawaii Daypack
$8.07
No MOQ
Kids Corduroy Backpack Cartoon Dog Plush Decoration School Bag For Kindergarten Boys Girls Cute Kawaii Daypack
Kids Corduroy Backpack Cartoon Dog Plush Decoration School Bag For Kindergarten Boys Girls Cute Kawaii Daypack
like
Find Similar
Brown corduroy kids backpack featuring a cute 3D cartoon dog and bone accessory - Brown
Beige corduroy kids backpack featuring a plush cartoon dog and soft bone charm - White
Black corduroy toddler backpack with a 3D cartoon dog character and front zipper pocket - Black
Dark green corduroy toddler backpack with cute cartoon dog and white bone detail - Green
Kids Corduroy Backpack Cartoon Dog Plush Decoration School Bag For Kindergarten Boys Girls Cute Kawaii Daypack
$5.91
No MOQ
Kids Canvas Chest Bag Large Capacity Crossbody Sling Pack Boys Girls Plush Pendant Lightweight Trendy
Kids Canvas Chest Bag Large Capacity Crossbody Sling Pack Boys Girls Plush Pendant Lightweight Trendy
like
Find Similar
Kids black and white canvas crossbody chest bag with plush pendant and adjustable strap - White (Without Pendant)
Boys mint green and black canvas chest bag with cute plush duck pendant and adjustable strap - Green (No Pendant)
Blue and black kids sling bag in nylon with reflective strip and chick pendant - Blue (No Pendant)
Black canvas chest bag for kids featuring a reflective zipper and plush doll pendant - Black (Without Pendant)
Kids Canvas Chest Bag Large Capacity Crossbody Sling Pack Boys Girls Plush Pendant Lightweight Trendy
$5.47
No MOQ
Kids Mini Cylinder Shoulder Bag PU Leather With Plush Bread Handle And Biscuit Charm Korean Style Fashion For Girls
Kids Mini Cylinder Shoulder Bag PU Leather With Plush Bread Handle And Biscuit Charm Korean Style Fashion For Girls
like
Find Similar
Mini cylindrical faux leather girl handbag with brown plush handle and round charm - Black
Brown faux leather cylinder handbag for girls with plush lamb wool handle and cookie charm - Brown
Brown cylinder PU leather bag for girls featuring plush handle and cookie charm accessory - Brown
Mini gray plush handbag for girls with baguette-style shearling handle and cookie charm - Elephant Gray
Kids Mini Cylinder Shoulder Bag PU Leather With Plush Bread Handle And Biscuit Charm Korean Style Fashion For Girls
$5.48
No MOQ
Children Semicircle Crossbody Bag Cute Cartoon Striped Composite Fabric Shoulder Handbag With Plush Dog Pendant For Kids
Children Semicircle Crossbody Bag Cute Cartoon Striped Composite Fabric Shoulder Handbag With Plush Dog Pendant For Kids
like
Find Similar
Blue striped semi-circle bag with Lucky embroidery and plush puppy keychain - Alpaca
Kids semi-circular striped handbag with cartoon rabbit print and white plush dog charm - Rabbit
Striped semi-circle kids handbag in red and blue with a plush dog charm and Lucky print - Orange Dog
Kids red striped semi-circle handbag with blue strap and plush dog pendant - Red Apple
Children Semicircle Crossbody Bag Cute Cartoon Striped Composite Fabric Shoulder Handbag With Plush Dog Pendant For Kids
$6.30
No MOQ
Kids Chest Bag Cute Cartoon Animal 3D EVA Hard Shell Crossbody Bag With Plush Tail For Toddlers Lightweight Fashionable
Kids Chest Bag Cute Cartoon Animal 3D EVA Hard Shell Crossbody Bag With Plush Tail For Toddlers Lightweight Fashionable
like
Find Similar
Detailed view of pink kitty chest bag for kids with cute plush faux fur tail pendant - Pink
Close-up of children's hard shell chest bag with gradient pink design and plush tail detail - Orange
Detail of light blue cartoon cat crossbody bag with plush pom-pom and shell design - Blue
Detail of purple cat EVA chest bag showing smooth hardshell texture and plush tail charm - Purple
Kids Chest Bag Cute Cartoon Animal 3D EVA Hard Shell Crossbody Bag With Plush Tail For Toddlers Lightweight Fashionable
$4.61
No MOQ
Cute Cartoon Bear Backpack Large Capacity Denim Synthetic Leather School Bag With 3D Plush Teddy Decor For Girls Student
Cute Cartoon Bear Backpack Large Capacity Denim Synthetic Leather School Bag With 3D Plush Teddy Decor For Girls Student
like
Find Similar
Blue denim backpack with 3D plush bear and cute cartoon patterns for girls - Large / Blue
Pink cartoon backpack featuring a 3D plush bear toy and bear head prints for girls - Large / Pink
Blue denim backpack with 3D plush bear and cartoon prints for girls and kids - Small / Blue
Pink cartoon bear backpack for girls featuring a cute 3D plush bear and heart patterns - Small / Pink
Cute Cartoon Bear Backpack Large Capacity Denim Synthetic Leather School Bag With 3D Plush Teddy Decor For Girls Student
$13.54-14.12
No MOQ
Kids Mini Cylinder Shoulder Bag Plush Puppy Polka Dot Bow Suede Crossbody Handbag Cute Cartoon Toddler Girls
Kids Mini Cylinder Shoulder Bag Plush Puppy Polka Dot Bow Suede Crossbody Handbag Cute Cartoon Toddler Girls
like
Find Similar
Mini black plush puppy shoulder bag with polka dot bow and brown dog motif for kids - Black
Cute pink plush puppy cylinder shoulder bag for kids with polka dot bow accent - Pink
Mini red plush puppy shoulder bag with a large red and white polka dot bow decoration - Red
Brown suede mini cylinder bag with large polka dot bow and plush puppy applique - Brown
Kids Mini Cylinder Shoulder Bag Plush Puppy Polka Dot Bow Suede Crossbody Handbag Cute Cartoon Toddler Girls
$6.34
No MOQ
Free Shipping
Mini Shoulder Bag PU Leather Plush Bear Patch Lace Trim Cute Sweet Crossbody Handbag For Toddler Girls Fashion Accessory
Mini Shoulder Bag PU Leather Plush Bear Patch Lace Trim Cute Sweet Crossbody Handbag For Toddler Girls Fashion Accessory
like
Find Similar
Mini black faux leather shoulder bag with bear plush patch and white lace trim - Black
Cute red PU leather mini shoulder bag with plush bear patch and white lace trim - Red
Pink cartoon bear crossbody bag for children with white lace trim and top handle - Pink
Deep brown faux leather kids crossbody bag with white lace trim and plush bear detail - Brown
Mini Shoulder Bag PU Leather Plush Bear Patch Lace Trim Cute Sweet Crossbody Handbag For Toddler Girls Fashion Accessory
$5.47
No MOQ
Kids Crossbody Bag Mini Bucket Handbag PU Leather Tweed Patchwork Plush Animal Decoration Drawstring Closure Sweet Girls
Kids Crossbody Bag Mini Bucket Handbag PU Leather Tweed Patchwork Plush Animal Decoration Drawstring Closure Sweet Girls
like
Find Similar
Cute gray knit kids crossbody bag featuring a plush beige puppy with a stylish bow tie - Black
Pink drawstring bucket bag for kids featuring a plush puppy and colorful Vogue tag - Pink
Cute purple plush bear crossbody bag for kids with drawstring and VOGUE label detail - Purple
Kids brown leather bucket bag with cute plush puppy and plaid bow on woven fabric - Brown
Kids Crossbody Bag Mini Bucket Handbag PU Leather Tweed Patchwork Plush Animal Decoration Drawstring Closure Sweet Girls
$7.78
No MOQ
Kids Mini Cylinder Shoulder Bag PU Leather Cute Plush Baguette Handle Cookie Pendant Cartoon Crossbody Purse Novelty
Kids Mini Cylinder Shoulder Bag PU Leather Cute Plush Baguette Handle Cookie Pendant Cartoon Crossbody Purse Novelty
like
Find Similar
Black round leather cylinder bag for kids with bread plush handle and cookie charm - Large / Black
Cute brown cylinder bag with croissant plush handle and cookie charm for kids - Large / Brown
Minimalist black leather cylinder bag with brown plush handle and cookie charm - Small / Black
Macro detail of brown barrel bag with fuzzy handle and cookie plush pendant - Small / Brown
Kids Mini Cylinder Shoulder Bag PU Leather Cute Plush Baguette Handle Cookie Pendant Cartoon Crossbody Purse Novelty
$6.05-6.63
No MOQ
Cartoon Plush Crossbody Bag Mini Mobile Phone Pouch Cute Animal Embroidery Soft Handbag With Top Handle For Women Girls
Cartoon Plush Crossbody Bag Mini Mobile Phone Pouch Cute Animal Embroidery Soft Handbag With Top Handle For Women Girls
like
Find Similar
Pink plush monster crossbody bag with yellow handle and embroidered cartoon face detail - Pink Rabbit
Blue plush cartoon cat crossbody bag with pink handle and woven shoulder strap - Black-faced Cat
Cute blue plush phone bag with cat embroidery and a stylish braided crossbody strap - Telephone
Cute green plush cartoon crossbody phone bag with black ears and adjustable rope strap - Green Pear Dog
Cartoon Plush Crossbody Bag Mini Mobile Phone Pouch Cute Animal Embroidery Soft Handbag With Top Handle For Women Girls
$5.47
No MOQ
Unicorn Kids Girls Plush Waist Bag Cute Cartoon Big Eyes Gradient Tie-dye Crossbody Fanny Pack Adjustable Strap
Unicorn Kids Girls Plush Waist Bag Cute Cartoon Big Eyes Gradient Tie-dye Crossbody Fanny Pack Adjustable Strap
like
Find Similar
Detail of pink plush unicorn waist bag showing soft texture and glittery silver horn - Pure Pink
Detail of plush unicorn waist bag with silver sequin horn and embroidered eyes - Pure Purple
Detailed macro view of rainbow plush unicorn bag with shiny horn and cute eyes - Light Pink Gradient
Detail of plush unicorn waist bag with gradient faux fur and large embroidered eyes - Violet Gradient
Unicorn Kids Girls Plush Waist Bag Cute Cartoon Big Eyes Gradient Tie-dye Crossbody Fanny Pack Adjustable Strap
$2.31
No MOQ
Denim Baseball Cap Cotton Hat With Plush Cartoon Animal Adjustable Sun Protection Fashion Cute Casual For Women Teens
Denim Baseball Cap Cotton Hat With Plush Cartoon Animal Adjustable Sun Protection Fashion Cute Casual For Women Teens
like
Find Similar
Detailed embroidery of Kauchu text and plush bear head on a blue denim baseball cap - One Size / Blue
Detail of denim baseball cap with plush bear ornament and vintage Rucru embroidery patch - One Size / Black
Detail of denim baseball cap featuring a plush character patch and a red plaid bow - One Size / Khaki
Detail of light blue denim baseball cap featuring a 3D plush bear and Richu embroidery - One Size / Light Blue
Denim Baseball Cap Cotton Hat With Plush Cartoon Animal Adjustable Sun Protection Fashion Cute Casual For Women Teens
$3.98
No MOQ
Kids Plush Ear Protection Trapper Hat Cute Lion Cartoon Lamb Wool Winter Warm Windproof Aviator Style For Toddler
Kids Plush Ear Protection Trapper Hat Cute Lion Cartoon Lamb Wool Winter Warm Windproof Aviator Style For Toddler
like
Find Similar
Detail of plush earflap hat for kids showing soft faux shearling and cute bear ears - 2-6 Years Old / White
Detail of plush lamb wool hat for kids with 3D ears and lion patch on wooden stand - 2-6 Years Old / Beige
Detail of plush lion earflap hat for kids featuring teddy fleece and chin strap - 2-6 Years Old / Coffee
Detail of cute lion plush ear-flap hat with warm wool texture and chin straps - 2-6 Years Old / Brown
Kids Plush Ear Protection Trapper Hat Cute Lion Cartoon Lamb Wool Winter Warm Windproof Aviator Style For Toddler
$4.61
Mix MOQ : 2
Kids Plush Faux Fur Beret Hat With Cat Ears Winter Warm Windproof Artist Cap For Toddler Girls Fashionable Headwear
Kids Plush Faux Fur Beret Hat With Cat Ears Winter Warm Windproof Artist Cap For Toddler Girls Fashionable Headwear
like
Find Similar
Close-up of white plush knit hat featuring cute cat ears and soft faux fur texture - 1-3 Years / White
Close-up of beige knitted beret with cute cat ears made of soft plush fabric - 1-3 Years / Beige
Close-up of caramel brown plush beret featuring adorable cat ears and soft knit texture - 1-3 Years / Khaki
Close-up of brown plush beret with cute bear ears on a white display stand - 1-3 Years / Coffee
Kids Plush Faux Fur Beret Hat With Cat Ears Winter Warm Windproof Artist Cap For Toddler Girls Fashionable Headwear
$3.46
Mix MOQ : 2
Baby Peaked Cap Quilted Plush Hat With 3D Bear Toddler Corduroy Brim Warm Windproof Soft Baseball Hat
Baby Peaked Cap Quilted Plush Hat With 3D Bear Toddler Corduroy Brim Warm Windproof Soft Baseball Hat
like
Find Similar
Detail of warm beige quilted fleece baby hat featuring a plush bear doll and corduroy brim - 48cm (6 Months-2 Years) / Beige
Detailed view of plush teddy bear doll and quilted fleece texture on infant winter cap - 48cm (6 Months-2 Years) / Khaki
Detail of warm brown baby cap with diamond quilting, plush bear, and corduroy brim - 48cm (6 Months-2 Years) / Caramel color
Detailed blue quilted baby hat with plush bear doll and corduroy brim for winter warmth - 48cm (6 Months-2 Years) / Blue
Baby Peaked Cap Quilted Plush Hat With 3D Bear Toddler Corduroy Brim Warm Windproof Soft Baseball Hat
$3.17
Mix MOQ : 2
Kids Beanie Hat Plush Knitted Winter Warm Pullover Cap With Star Pattern Soft Faux Fur For Toddler Boys Girls Outdoor
Kids Beanie Hat Plush Knitted Winter Warm Pullover Cap With Star Pattern Soft Faux Fur For Toddler Boys Girls Outdoor
like
Find Similar
Detail of pink and white plush knit beanie with soft faux fur texture on a grey rug - 2-4 years old / Pink
Winter plush knit beanie with white bird jacquard pattern for kids outdoor warmth - 2-4 years old / Blue
Close-up of plush yellow star pattern knit beanie showing soft fuzzy texture - 2-4 years old / Yellow
Detail of soft plush knitted beanie featuring a white bird jacquard pattern in light brown - 2-4 years old / Brown
Kids Beanie Hat Plush Knitted Winter Warm Pullover Cap With Star Pattern Soft Faux Fur For Toddler Boys Girls Outdoor
$3.31
Mix MOQ : 2
Kids Plush Corduroy Baseball Cap Winter Warm Windproof Nice Smile Embroidery Patchwork Fashion Children Adjustable Hat
Kids Plush Corduroy Baseball Cap Winter Warm Windproof Nice Smile Embroidery Patchwork Fashion Children Adjustable Hat
like
Find Similar
Detail of nice embroidery and smiley face on plush and corduroy baseball cap - 52-54cm (3-8 Years) / Off White
Detail of plush brown teddy fabric baseball cap with blue Nice embroidery and corduroy brim - 52-54cm (3-8 Years) / Khaki
Close-up of kids plush baseball cap featuring Nice embroidery and corduroy brim - 52-54cm (3-8 Years) / Brown
Detail of kids plush baseball cap with Nice embroidery and corduroy brim - 52-54cm (3-8 Years) / Black
Kids Plush Corduroy Baseball Cap Winter Warm Windproof Nice Smile Embroidery Patchwork Fashion Children Adjustable Hat
$4.03
Mix MOQ : 2
Baby Plush Teddy Fleece Hat With Cute Bear Ears And Earflaps Ties Winter Warm Windproof For Toddler Infants
Baby Plush Teddy Fleece Hat With Cute Bear Ears And Earflaps Ties Winter Warm Windproof For Toddler Infants
like
Find Similar
Detailed texture of beige plush baby bear ear hat with soft lining and metal M logo tag - Off White / 1-3 Years
Close-up of the plush texture and 3D bear ears on this warm baby winter hood - Khaki / 1-3 Years
Detail of plush baby winter hat with bear ears and chin straps in warm brown - Coffee / 1-3 Years
Close-up of baby plush bear ear hat in brown sherpa fleece with leather M tag detail - Caramel color / 1-3 Years
Baby Plush Teddy Fleece Hat With Cute Bear Ears And Earflaps Ties Winter Warm Windproof For Toddler Infants
$4.32
Mix MOQ : 2
Kids Winter Plush And Corduroy Baseball Cap Warm Embroidered Letter Peaked Hat Fashion Outdoor Accessory
Kids Winter Plush And Corduroy Baseball Cap Warm Embroidered Letter Peaked Hat Fashion Outdoor Accessory
like
Find Similar
Close-up of plush wool blend texture and Sports Dept 2058 embroidery on kids baseball cap - 54-56cm (4-8 Years) / Off White
Detailed view of the SD embroidery and contrast corduroy brim on kids' wool baseball cap - 54-56cm (4-8 Years) / Khaki
Detail of plush grey fabric and beige corduroy brim on kids winter baseball cap - 54-56cm (4-8 Years) / Coffee
Close-up of black fuzzy plush hat with khaki corduroy brim and white Sports embroidery - 54-56cm (4-8 Years) / Black
Kids Winter Plush And Corduroy Baseball Cap Warm Embroidered Letter Peaked Hat Fashion Outdoor Accessory
$4.03
Mix MOQ : 2
Baby Winter Warm Plush Ear Protection Hat Windproof Cute 3D Bear Ears Soft Polyester Beanie For Infants Toddlers
Baby Winter Warm Plush Ear Protection Hat Windproof Cute 3D Bear Ears Soft Polyester Beanie For Infants Toddlers
like
Find Similar
Detailed view of plush baby winter hat with cute bear ears and fashion label tag - 6 Months - 2 Years / Cream
Detail of baby winter earflap hat featuring soft plush fabric and bear ear accents - 6 Months - 2 Years / Beige
Detail of warm plush baby winter hat with bear ears and fashion label in caramel brown - 6 Months - 2 Years / Brown
Detail showing the plush pink faux lamb wool texture and faux leather label on baby hat - 6 Months - 2 Years / Pink
Baby Winter Warm Plush Ear Protection Hat Windproof Cute 3D Bear Ears Soft Polyester Beanie For Infants Toddlers
$3.46
Mix MOQ : 2
Go to

Explore more in plush flowers

girlscoverartificialkidsdiywhiteshapebandshangingstar
decorativehandmadeshortroomartificial pearlfacewarmliving room bedroomphoneclaw

Ready to source like an insider

Get a direct line to the factory floor — no minimums, no middlemen, no guesswork.
iconReal factory pricing, no markup in betweeniconEvery order hand-inspected before it shipsicon5,000+ new products added daily
Get Inside Access