Everful

Wholesale card envelopes

Factory-direct selection, vetted for quality and ready to order.

Sign Up
Card Envelopes

Find the perfect pieces: invitation cards & envelopes and more

All products in card envelopes

filterShow Filters
Best Seller
New Arrivals
Price Drop
Free Shipping
Minimalist Blank Place Cards Pearlescent Cardstock Kraft Paper Seat Cards For Wedding Birthday Party Table Name Card Tags
Minimalist Blank Place Cards Pearlescent Cardstock Kraft Paper Seat Cards For Wedding Birthday Party Table Name Card Tags
like
Find Similar
Minimalist white rounded rectangular jewelry display card with pre-punched hole - White
Macro detail of a minimalist black card with rounded corners and a pre-drilled round hole - Black Khaki
Close-up of blank kraft paper place card with rounded corners and a pre-cut hole - Kraft Paper
Minimalist Blank Place Cards Pearlescent Cardstock Kraft Paper Seat Cards For Wedding Birthday Party Table Name Card Tags
$0.05
Mix MOQ : 50
Business Thank You Cards Black Gold Minimalist Note For Small Business Order Packaging Paper Customer Appreciation Stationery
Business Thank You Cards Black Gold Minimalist Note For Small Business Order Packaging Paper Customer Appreciation Stationery
like
Find Similar
Minimalist black and white thank you cards with bold typography for gift packaging - Contrast Layout Style (s640-C)
Minimalist black and gold 'Thank you Ever much' gift cards with elegant heart patterns - Cloud Pattern Gold Style (s640-D)
Minimalist black Thank You cards with elegant white lettering for holiday gift messages - Minimalist Text Style (s640-E)
Business Thank You Cards Black Gold Minimalist Note For Small Business Order Packaging Paper Customer Appreciation Stationery
$0.40
Mix MOQ : 2
Folded Mini Greeting Cards Specialty Paper Gold Stamping Birthday Thank You Message Cards Minimalist Modern Gift Design
Folded Mini Greeting Cards Specialty Paper Gold Stamping Birthday Thank You Message Cards Minimalist Modern Gift Design
like
Find Similar
1 option
Folded Mini Greeting Cards Specialty Paper Gold Stamping Birthday Thank You Message Cards Minimalist Modern Gift Design
$5.19
No MOQ
 · 
17 views
Free Shipping
3D Pop-Up Greeting Card Flower Shop Butterfly Golf Design Handmade Paper Laser Cut For Mother's Day Birthday Celebration
3D Pop-Up Greeting Card Flower Shop Butterfly Golf Design Handmade Paper Laser Cut For Mother's Day Birthday Celebration
like
Find Similar
3D Mother's Day popup card with pink flowers, green base and gold foil text - Mother's Day Card
3D pop-up greeting card featuring a detailed golf course scene with golfer and trees - Golf
3D pop-up greeting card featuring purple butterfly and floral laser-cut paper art design - Butterfly
3D Pop-Up Greeting Card Flower Shop Butterfly Golf Design Handmade Paper Laser Cut For Mother's Day Birthday Celebration
-4%
$2.44-2.96
No MOQ
 · 
1 reviews
Inspirational Affirmation Cards With Moon Floral Designs Positive Quotes Healing Cards For Daily Motivation Women Gift
Inspirational Affirmation Cards With Moon Floral Designs Positive Quotes Healing Cards For Daily Motivation Women Gift
like
Find Similar
Detail of 36 moon and floral affirmation cards with gold foil inspirational quotes - Moon Floral Inspirational Style (T01043522)
Inspirational Affirmation Cards With Moon Floral Designs Positive Quotes Healing Cards For Daily Motivation Women Gift
$1.44
Mix MOQ : 5
 · 
13 views
European Glitter Paper Laser Cut Wedding Invitation Card Elegant Floral Hollow Greeting Card For Banquet Celebration
European Glitter Paper Laser Cut Wedding Invitation Card Elegant Floral Hollow Greeting Card For Banquet Celebration
like
Find Similar
Silver laser cut wedding invitation with luxury glitter texture and floral pattern - Silver Glitter
Elegant gold glitter laser cut square wedding invitation with floral damask pattern - Glitter Champagne Gold
Pink glitter laser-cut wedding invitation card with intricate hollow scroll design - Glitter Pink
European Glitter Paper Laser Cut Wedding Invitation Card Elegant Floral Hollow Greeting Card For Banquet Celebration
-5%
$0.52
Mix MOQ : 50
3D Heart Greeting Card Stereoscopic Hollow Paper Gift Message Card Romantic Anniversary Valentine Birthday Wedding Floral
3D Heart Greeting Card Stereoscopic Hollow Paper Gift Message Card Romantic Anniversary Valentine Birthday Wedding Floral
like
Find Similar
Pink greeting card with red 3D heart cutout and love quote on a wooden desk surface - Pink Heart
Pink gradient 3D heart greeting card with floral butterfly patterns and love quote - Butterfly Heart
Light blue greeting card with 3D red heart and floral watercolor designs on wood - Light Blue Heart
3D pop-up greeting card featuring a blue gradient heart on a light green background - Light Green Heart
+2
3D Heart Greeting Card Stereoscopic Hollow Paper Gift Message Card Romantic Anniversary Valentine Birthday Wedding Floral
$0.03
Mix MOQ : 10
 · 
23 views
Appreciation Thank You Cards Colorful Graffiti Style Cardstock Notes For Gift Package Small Business Message Cards
Appreciation Thank You Cards Colorful Graffiti Style Cardstock Notes For Gift Package Small Business Message Cards
like
Find Similar
Bulk set of 50 colorful graffiti style thank you cards for gift packaging and business - Colorful Graffiti Style (T01042720)
NewAppreciation Thank You Cards Colorful Graffiti Style Cardstock Notes For Gift Package Small Business Message Cards
$2.01
Mix MOQ : 2
3D Hollow Greeting Cards Romantic Strawberry Heart Anchor Shapes Cardstock Message Cards Birthday Valentines Day
3D Hollow Greeting Cards Romantic Strawberry Heart Anchor Shapes Cardstock Message Cards Birthday Valentines Day
like
Find Similar
Pink gift box shaped 3D hollow greeting card with white polka dots and Best Wishes text - Gift
Pink greeting card featuring strawberry patterns and Happy everyday message - Strawberry
Purple greeting card with Eiffel Tower design and Good Luck quote on marble background - Eiffel Tower
White greeting card featuring pink lips and handwritten wishes on a wooden tray - Lip
+5
3D Hollow Greeting Cards Romantic Strawberry Heart Anchor Shapes Cardstock Message Cards Birthday Valentines Day
-5%
$2.66
Mix MOQ : 2
 · 
12 sold recently
Scenery Postcards With Handwritten Quotes Artistic Mountain Snow Forest Decorative Greeting Cards For Gifting Room Decor Wall Art
Scenery Postcards With Handwritten Quotes Artistic Mountain Snow Forest Decorative Greeting Cards For Gifting Room Decor Wall Art
like
Find Similar
Artistic postcard set featuring 30 nature landscapes with Chinese calligraphy and scenery - Wish You Escape From Suffering Toward The Spring Mountain
Scenery Postcards With Handwritten Quotes Artistic Mountain Snow Forest Decorative Greeting Cards For Gifting Room Decor Wall Art
-5%
$1.51
No MOQ
3D Pop Up Greeting Cards Handmade Laser Cut Paper Carving For Christmas Birthday New Year Travel Souvenirs Creative Gift
3D Pop Up Greeting Cards Handmade Laser Cut Paper Carving For Christmas Birthday New Year Travel Souvenirs Creative Gift
like
Find Similar
3D romantic couple pop-up card with blue I DO envelope measuring 15x20cm size - We Are in Love
3D pop-up greeting card featuring Guangzhou city skyline in red and yellow colors - Colored Guangzhou
3D pop-up greeting card featuring orange Hong Kong Travel city skyline architecture - Colored Hong Kong
3D pop-up greeting card featuring Hong Kong city skyline in red and gold paper craft - Hong Kong City Silhouette
+14
3D Pop Up Greeting Cards Handmade Laser Cut Paper Carving For Christmas Birthday New Year Travel Souvenirs Creative Gift
-5%
$1.15-2.81
Mix MOQ : 2
 · 
33 sold recently
Free Shipping
Valentine's Day Gift Cards Pink Cupid Heart Design Coated Paper Greeting Tags For Holiday Presents Party Favors
Valentine's Day Gift Cards Pink Cupid Heart Design Coated Paper Greeting Tags For Holiday Presents Party Favors
like
Find Similar
Pink Valentine's Day paper card featuring cartoon Cupid, hearts and 7x11cm dimensions - Cupid Style (A) / 11*7cm
Valentine's Day Gift Cards Pink Cupid Heart Design Coated Paper Greeting Tags For Holiday Presents Party Favors
$0.08
No MOQ
3D Floral Greeting Card Set Multicolor White Cardboard Flower Pattern Message Card For Birthday Mother Day Teacher Day
3D Floral Greeting Card Set Multicolor White Cardboard Flower Pattern Message Card For Birthday Mother Day Teacher Day
like
Find Similar
Close-up of a floral greeting card with sunflowers and All the best text on wooden stand - Sunflower
Close-up of a Love You floral card with red roses and a butterfly on a wooden tray - Rose
Detailed view of carnation card on wooden stand with Best Wishes text for Mother's Day - Carnation
Detail of Thank You card with lavender bouquet on a wooden stand with roses - Lavender
+2
3D Floral Greeting Card Set Multicolor White Cardboard Flower Pattern Message Card For Birthday Mother Day Teacher Day
$0.03
No MOQ
Cartoon Animal Greeting Cards Cardboard Heart Shaped Foldable Birthday Mothers Day Fathers Day Teachers Day Note Cards
Cartoon Animal Greeting Cards Cardboard Heart Shaped Foldable Birthday Mothers Day Fathers Day Teachers Day Note Cards
like
Find Similar
Cartoon elephant birthday card in blue and grey with 'Happy Every Day' artistic text - Elephant
Green swan-shaped heart greeting card with Best wishes text for birthday celebration - Swan
Pink heart-shaped Mother's Day card featuring mother and daughter illustration and love you mom text - Mother's Day Pink Girl
Pastel heart-shaped Mother's Day card featuring Love You Mom handwritten script design - Mother's Day Blue Boy
+16
Cartoon Animal Greeting Cards Cardboard Heart Shaped Foldable Birthday Mothers Day Fathers Day Teachers Day Note Cards
$0.03
Mix MOQ : 10
 · 
200 sold recently
Holographic Laser Heart Star Card Sleeves Clear PP Photocard Protectors For K-pop Album Collection Idol Photo Sleeves
Holographic Laser Heart Star Card Sleeves Clear PP Photocard Protectors For K-pop Album Collection Idol Photo Sleeves
like
Find Similar
Laser Heart Pink / Flat Opening 61x91mm
Close-up of purple laser heart card sleeves showing iridescent effect for album cards - Laser Heart Purple / Flat Opening 61x91mm
Laser Heart Green / Flat Opening 61x91mm
Laser Heart Blue / Flat Opening 61x91mm
+2
Holographic Laser Heart Star Card Sleeves Clear PP Photocard Protectors For K-pop Album Collection Idol Photo Sleeves
$0.78
Mix MOQ : 2
Christmas Greeting Cards And Gift Tags Cardstock 3D Money Holder Hanging Labels Holiday Festive Party Decor
Christmas Greeting Cards And Gift Tags Cardstock 3D Money Holder Hanging Labels Holiday Festive Party Decor
like
Find Similar
Set of 4 mini square Christmas cards with gold and silver tree and sled patterns - Small Card Type 1 / Set of 4
Set of 4 Christmas cards with reindeer, socks, and bells designs, 5.9x5.9cm size - Small Card Type 2 / Set of 4
Set of 4 Christmas mini square cards with classic red and white holiday patterns - Small Card Type 3 / Set of 4
Christmas greeting card set featuring sled and tree patterns in gold and silver tones - Small Card Type 4 / Set of 4
+13
Christmas Greeting Cards And Gift Tags Cardstock 3D Money Holder Hanging Labels Holiday Festive Party Decor
-5%
$0.73-2.14
No MOQ
DIY Valentine's Day Scratch Off Love Coupons Romantic Heart Printed Cardstock Interactive Game Cards For Couples Women Wedding Party Gift
DIY Valentine's Day Scratch Off Love Coupons Romantic Heart Printed Cardstock Interactive Game Cards For Couples Women Wedding Party Gift
like
Find Similar
Detail of 10-piece DIY Love Coupons set with pink heart cards and scratch-off stickers - 10 Pieces Pack
Macro detail of DIY Love Coupons set with pink greeting cards and silver scratch stickers - 20 Pieces Set
Detailed view of 30 DIY pink love coupons with scratch-off stickers for Valentine gifts - 30Pcs Pack
Detail view of 40Pcs pink Valentine's Love Coupons with scratch stickers and dimensions - 40Pcs Pack
+3
DIY Valentine's Day Scratch Off Love Coupons Romantic Heart Printed Cardstock Interactive Game Cards For Couples Women Wedding Party Gift
$0.35-3.17
Mix MOQ : 2
Cute Cartoon Folding Greeting Cards Paper Kawaii Animal Sun Heart Message Card For Birthday Children Gift
Cute Cartoon Folding Greeting Cards Paper Kawaii Animal Sun Heart Message Card For Birthday Children Gift
like
Find Similar
Pink cartoon animal themed card stand for children with cute unicorn and rainbow motifs - Little Sheep
Cute yellow duck cartoon folding greeting card with love love text on textured paper - Yellow Duck
Kawaii cartoon sun card for Children's Day with cute star and cloud patterns - Warm Sun
Cute red cartoon bear and orange folding greeting card with a mini pineapple toy - Bear
+4
Cute Cartoon Folding Greeting Cards Paper Kawaii Animal Sun Heart Message Card For Birthday Children Gift
$0.03
Mix MOQ : 10
 · 
42 views
Pearlescent Paper Place Cards For Wedding Party Decoration Elegant Folded Table Name Cards Baptism Tent Seat Cards
Pearlescent Paper Place Cards For Wedding Party Decoration Elegant Folded Table Name Cards Baptism Tent Seat Cards
like
Find Similar
Folded white pearlescent paper place cards for wedding or party table settings - White
Pink glitter paper place card with V-fold design for wedding or party table settings - Pink
Close-up of golden pearlescent paper table card with a premium metallic finish - Gold
Detail of royal blue pearlescent folding place card with elegant paper texture - Sapphire Blue
+5
Pearlescent Paper Place Cards For Wedding Party Decoration Elegant Folded Table Name Cards Baptism Tent Seat Cards
$0.07
Mix MOQ : 50
Valentine's Day Greeting Cards Heart Shaped White Cardboard Gift Notes For Romantic Message Holiday Party Celebration
Valentine's Day Greeting Cards Heart Shaped White Cardboard Gift Notes For Romantic Message Holiday Party Celebration
like
Find Similar
Set of 8 Happy Valentine's Day cards featuring romantic hearts, letters, and birds designs - Style A Mixed Pack (8 Sheets/Pack)
Valentine's Day Greeting Cards Heart Shaped White Cardboard Gift Notes For Romantic Message Holiday Party Celebration
$0.81
Mix MOQ : 2
Easter Greeting Cards Invitation Rabbit Egg Flower Cardstock Paper Holiday Party Celebration Cute Cartoon Style Blank Back
Easter Greeting Cards Invitation Rabbit Egg Flower Cardstock Paper Holiday Party Celebration Cute Cartoon Style Blank Back
like
Find Similar
Set of 12 Happy Easter greeting cards featuring 6 cute rabbit and floral egg designs - 12 Pcs Set (G-00130-1)
24-piece Easter card set featuring 6 assorted rabbit and egg designs in 6-grid layout - 24 Pcs Set (G-00130-2)
Easter Greeting Cards Invitation Rabbit Egg Flower Cardstock Paper Holiday Party Celebration Cute Cartoon Style Blank Back
-5%
$0.74-1.48
Mix MOQ : 5
Motivational Inspirational Cards Cyberpunk Rainbow Art Decorative Greeting Cards Home Office Wall Decor Art Paper Cards
Motivational Inspirational Cards Cyberpunk Rainbow Art Decorative Greeting Cards Home Office Wall Decor Art Paper Cards
like
Find Similar
Neon style 67 card with Find Your Rhythm quote and musical wave art for friends - Inspirational Text (RXHA0057)
Motivational Inspirational Cards Cyberpunk Rainbow Art Decorative Greeting Cards Home Office Wall Decor Art Paper Cards
$0.86
Mix MOQ : 5
Handmade Dried Flower Greeting Cards Gypsophila Baby Breath Cardstock Mini Gift Note Minimalist Korean Style For Teachers Day
Handmade Dried Flower Greeting Cards Gypsophila Baby Breath Cardstock Mini Gift Note Minimalist Korean Style For Teachers Day
like
Find Similar
Detailed view of dried flower greeting card with pink gypsophila measuring 8cm by 14cm - Pink Gypsophila Style (C367)
Detailed view of dried purple flowers on a white gift card with size 8x14cm marked - Purple Gypsophila Style (C368)
Detailed size view showing 8x14cm greeting card with blue dried flowers and quote - Blue Gypsophila Style (C369)
Detail of creative handmade gift card featuring dried yellow flowers on premium paper - Yellow Gypsophila Style (C370)
Handmade Dried Flower Greeting Cards Gypsophila Baby Breath Cardstock Mini Gift Note Minimalist Korean Style For Teachers Day
-5%
$0.19
No MOQ
 · 
16 views
Floral Print Wedding Place Cards Elegant Rose Autumn Leaf Design Cardboard Tent Style Table Name Cards for Party Banquet
Floral Print Wedding Place Cards Elegant Rose Autumn Leaf Design Cardboard Tent Style Table Name Cards for Party Banquet
like
Find Similar
Elegant floral wedding place card with watercolor roses and stable tent fold design - Pink Rose Style (XWK-147)
Foldable Thanksgiving place card featuring watercolor maple leaf and berry prints - Autumn Leaves Style (XWK-146)
Elegant white foldable wedding place cards with pink watercolor roses and green leaves - Watercolor Rose Style (XWK-148)
Floral Print Wedding Place Cards Elegant Rose Autumn Leaf Design Cardboard Tent Style Table Name Cards for Party Banquet
$0.09
Mix MOQ : 50
Laser Cut Butterfly Flower Invitation Cover Glitter Paper Greeting Card For Wedding Party Banquet Valentine Day Invitation Shell
Laser Cut Butterfly Flower Invitation Cover Glitter Paper Greeting Card For Wedding Party Banquet Valentine Day Invitation Shell
like
Find Similar
Glittery champagne gold laser cut butterfly invitation cover for wedding and parties - Light Gold Glitter
Elegant silver glitter laser-cut invitation card with butterfly and floral hollow patterns - Silver Glitter
Detail of laser-cut glitter champagne gold invitation with butterfly and rose lace pattern - Glitter Rose Gold
Glitter pink laser-cut butterfly invitation card with intricate hollow rose floral patterns - Glitter Pink
+4
Laser Cut Butterfly Flower Invitation Cover Glitter Paper Greeting Card For Wedding Party Banquet Valentine Day Invitation Shell
$0.52
Mix MOQ : 50
 · 
250 sold recently
Laser Cut Heart Shape Wine Glass Cards Pearlescent Paper Place Cards For Wedding Banquet Party Table Decoration Hollow Floral Cup Card
Laser Cut Heart Shape Wine Glass Cards Pearlescent Paper Place Cards For Wedding Banquet Party Table Decoration Hollow Floral Cup Card
like
Find Similar
Laser-cut heart-shaped place card in red for wedding wine glass decoration - Pearlescent Red
White heart-shaped laser cut wine glass place card with floral hollow design for weddings - White
Laser-cut heart-shaped place card in pearlescent pink for wedding wine glass decoration - Pink
Elegant gold heart laser-cut place card for wine glass wedding table decoration - Gold
+2
Laser Cut Heart Shape Wine Glass Cards Pearlescent Paper Place Cards For Wedding Banquet Party Table Decoration Hollow Floral Cup Card
$0.07
Mix MOQ : 50
Coated Paper Wedding Thank You Cards Advice And Wishes Floral Elegant Table Decor For Party Event
Coated Paper Wedding Thank You Cards Advice And Wishes Floral Elegant Table Decor For Party Event
like
Find Similar
Watercolor floral wedding advice and wishes table cards for guests, 10x15cm white paper - Advice And Wishes Pink Floral Style (K-130) / 50 Sheets/Pack
Watercolor floral wedding advice and wishes card on premium white cardstock - Advice And Wishes Rose Leaves Style (K-131) / 50 Sheets/Pack
Elegant floral wedding thank you cards with pink roses and gold geometric frames - Thank You Pink Rose Gold Geometric Style (K-133) / 50 Sheets/Pack
Minimalist 10x15cm wedding thank you cards with green watercolor leaf patterns - Thank You Minimalist Green Leaves Style (K-134) / 50 Sheets/Pack
+4
Coated Paper Wedding Thank You Cards Advice And Wishes Floral Elegant Table Decor For Party Event
$2.07
No MOQ
Red Heart Shaped Cardstock Paper Cutouts For Valentines Day Wedding Party Romantic Gift Decoration DIY Crafts
Red Heart Shaped Cardstock Paper Cutouts For Valentines Day Wedding Party Romantic Gift Decoration DIY Crafts
like
Find Similar
360 pieces of 2-inch red heart cardstock paper for Valentine's Day DIY crafts and decor - 360 Sheets + 400 Glue Dots
Red Heart Shaped Cardstock Paper Cutouts For Valentines Day Wedding Party Romantic Gift Decoration DIY Crafts
$6.34
No MOQ
Flower Meaning Cards Watercolor Floral Language Art Cards Botanical Illustration Greeting Cards For Scrapbooking DIY Decoration Gift
Flower Meaning Cards Watercolor Floral Language Art Cards Botanical Illustration Greeting Cards For Scrapbooking DIY Decoration Gift
like
Find Similar
Artistic watercolor flower card set featuring 18 botanical illustrations with floral meanings - Flower Language Cards (RXHA0013)
Flower Meaning Cards Watercolor Floral Language Art Cards Botanical Illustration Greeting Cards For Scrapbooking DIY Decoration Gift
$0.86
Mix MOQ : 5
 · 
11 views
Cartoon Birthday Greeting Cards Kids Happy Birthday Message Notes Assorted Patterns Hand Written Multi Design Stationery Gift Cards
Cartoon Birthday Greeting Cards Kids Happy Birthday Message Notes Assorted Patterns Hand Written Multi Design Stationery Gift Cards
like
Find Similar
Set of 36 colorful birthday cards with festive illustrations of cakes and balloons - Assorted Cartoon Styles (RXHB0097)
Cartoon Birthday Greeting Cards Kids Happy Birthday Message Notes Assorted Patterns Hand Written Multi Design Stationery Gift Cards
$1.44
Mix MOQ : 5
3D Pop Up Greeting Card Green Flower Box Paper Art Handmade Floral Gift For Birthday Wedding Mothers Day Anniversary
3D Pop Up Greeting Card Green Flower Box Paper Art Handmade Floral Gift For Birthday Wedding Mothers Day Anniversary
like
Find Similar
3D pop-up green flower greeting card set with envelopes and size dimensions - Green 3D Pop-up Greeting Card (S847)
3D Pop Up Greeting Card Green Flower Box Paper Art Handmade Floral Gift For Birthday Wedding Mothers Day Anniversary
$1.76
No MOQ
Christmas Advent Countdown Cards Bible Verse Scripture Cards Set With Botanical Holly Berries Design Inspirational Holiday Message Cards Gift
Christmas Advent Countdown Cards Bible Verse Scripture Cards Set With Botanical Holly Berries Design Inspirational Holiday Message Cards Gift
like
Find Similar
1 option
Christmas Advent Countdown Cards Bible Verse Scripture Cards Set With Botanical Holly Berries Design Inspirational Holiday Message Cards Gift
$1.21
Mix MOQ : 2
Elegant Laser Cut Butterfly Wedding Place Cards Pearlescent Paper Name Cards For Party Banquet Table Decoration
Elegant Laser Cut Butterfly Wedding Place Cards Pearlescent Paper Name Cards For Party Banquet Table Decoration
like
Find Similar
Elegant red laser-cut butterfly place card for wedding tables and banquet seating events - Pearlescent Red
Elegant laser-cut white butterfly place card with shimmering pearl paper finish - White
Elegant laser-cut butterfly place cards in pearlescent pink for wedding table seating - Pink
Elegant gold butterfly laser cut place cards in shimmering pearlescent paper for wedding decor - Gold
+2
Elegant Laser Cut Butterfly Wedding Place Cards Pearlescent Paper Name Cards For Party Banquet Table Decoration
$0.07
Mix MOQ : 50
3D Pop Up Christmas Greeting Card Artistic Cardboard Santa Snowman Xmas Holiday Invitation Handmade Holiday Stationery
3D Pop Up Christmas Greeting Card Artistic Cardboard Santa Snowman Xmas Holiday Invitation Handmade Holiday Stationery
like
Find Similar
3D pop-up Christmas card featuring Merry Christmas letters with Santa and tree motifs - Red Christmas
3D Pop Up Christmas Greeting Card Artistic Cardboard Santa Snowman Xmas Holiday Invitation Handmade Holiday Stationery
$2.16
No MOQ
Elegant Laser Cut Rose Flower Invitations With Envelopes And Floral Inner Sheets For Weddings Birthday Quinceanera Party Decor
Elegant Laser Cut Rose Flower Invitations With Envelopes And Floral Inner Sheets For Weddings Birthday Quinceanera Party Decor
like
Find Similar
Laser cut invitation card with rose hollow design and pink floral ballet dancer motif - Nude Pink
Detailed laser cut purple rose wedding invitation set with elegant floral cards - Lilac Purple
Detail of laser-cut rose invitation card with floral inserts and elegant hollow design - Beige Gold
Laser cut rose hollow wedding invitation in forest green with floral inner card set - Ink Green
+5
Elegant Laser Cut Rose Flower Invitations With Envelopes And Floral Inner Sheets For Weddings Birthday Quinceanera Party Decor
$0.68
Mix MOQ : 50
Eucalyptus Leaf Wreath Thank You Cards Minimalist White Coated Paper Botanical Stationery For Business Wedding Events
Eucalyptus Leaf Wreath Thank You Cards Minimalist White Coated Paper Botanical Stationery For Business Wedding Events
like
Find Similar
1 option
Eucalyptus Leaf Wreath Thank You Cards Minimalist White Coated Paper Botanical Stationery For Business Wedding Events
$0.72
Mix MOQ : 5
3D Pop Up Sunflower Greeting Card Handmade Cardboard Butterfly Flower Design For Birthday Mothers Day Wedding Anniversary
3D Pop Up Sunflower Greeting Card Handmade Cardboard Butterfly Flower Design For Birthday Mothers Day Wedding Anniversary
like
Find Similar
3D pop-up greeting card featuring vibrant sunflowers and butterflies on white background - Sunflower 3D Pop-up Card (S844)
3D Pop Up Sunflower Greeting Card Handmade Cardboard Butterfly Flower Design For Birthday Mothers Day Wedding Anniversary
$1.76
No MOQ
Laser Cut Ballerina Place Cards For Wedding Party Table Decoration Pearlescent Paper Hollow Name Cards Seating Cards
Laser Cut Ballerina Place Cards For Wedding Party Table Decoration Pearlescent Paper Hollow Name Cards Seating Cards
like
Find Similar
Macro detail of laser-cut ballerina wedding place card in shimmering pearlescent white paper - White
Elegant gold laser-cut ballet dancer table place card for weddings and events - Gold
Pink laser-cut ballerina place card made of pearlescent paper for wedding table seating - Pink
Teal laser-cut ballet dancer silhouette place cards for wedding table decorations - Tiffany Blue
+1
Laser Cut Ballerina Place Cards For Wedding Party Table Decoration Pearlescent Paper Hollow Name Cards Seating Cards
$0.07
Mix MOQ : 50
3D Pop Up Birthday Greeting Card Specialty Paper Laser Cut Cake Design Gift For Celebration Handcrafted Invitation
3D Pop Up Birthday Greeting Card Specialty Paper Laser Cut Cake Design Gift For Celebration Handcrafted Invitation
like
Find Similar
3D pop-up birthday card with a detailed paper cake design in brown and beige tones - Brown
3D Pop-up Strawberry Birthday Cake Card in Red and Cream with Candle Detail - Red
3D Pop-up birthday card featuring a yellow three-layer cake with strawberries and candles - Yellow
3D pop-up birthday card featuring a multi-layered cake design with strawberry details - Blue
3D Pop Up Birthday Greeting Card Specialty Paper Laser Cut Cake Design Gift For Celebration Handcrafted Invitation
-4%
$0.88
No MOQ
 · 
14 views
Crystal Diamond Shape Acrylic Business Card Holder Desk Place Card Stand For Wedding Party Office Table Name Memo Clip
Crystal Diamond Shape Acrylic Business Card Holder Desk Place Card Stand For Wedding Party Office Table Name Memo Clip
like
Find Similar
Clear faceted crystal diamond paperweight decor in a round brilliant cut style - 4x2.3cm / Clear
Faceted round yellow crystal place card holder with a bright golden diamond cut finish - 4x2.3cm / Champagne
Elegant champagne crystal diamond card holder with round multifaceted cut design - 4x2.3cm / Rose Gold
Crystal Diamond Shape Acrylic Business Card Holder Desk Place Card Stand For Wedding Party Office Table Name Memo Clip
$0.32
No MOQ
Christmas Greeting Cards Gift Tags Vintage Style Specialty Paper For Holiday Decoration Floral Gift Wrap
Christmas Greeting Cards Gift Tags Vintage Style Specialty Paper For Holiday Decoration Floral Gift Wrap
like
Find Similar
60-piece Christmas greeting card set with Santa, tree, and snowman designs, 7x10.8cm - Atmospheric Large Cards (60 Sheets/Pack)
Christmas greeting card set with 6 creative red and green festive apple designs - Merry Christmas Cards (12 Sheets/Set)
Set of 16 vintage Christmas gift cards featuring Santa, trees, and bells on white background - American Vintage Cards (16 Sheets/Set)
Set of 12 Christmas theme cards featuring Santa, Reindeer and Snowman illustrations - Fun Christmas Cards (12 Sheets/Set)
Christmas Greeting Cards Gift Tags Vintage Style Specialty Paper For Holiday Decoration Floral Gift Wrap
$1.44-2.54
Mix MOQ : 2
European Style Laser Cut Hollow Invitations Card Pearl Paper Floral Lace Greeting Card For Wedding Birthday Party Ceremony
European Style Laser Cut Hollow Invitations Card Pearl Paper Floral Lace Greeting Card For Wedding Birthday Party Ceremony
like
Find Similar
Close-up of laser-cut lily patterns on white invitation card with printing insert - White
Laser cut floral lace wedding invitation in gold with elegant white inner card insert - Champagne Gold
European Style Laser Cut Hollow Invitations Card Pearl Paper Floral Lace Greeting Card For Wedding Birthday Party Ceremony
$0.61
Mix MOQ : 50
Happy Easter Greeting Cards Cartoon Animal Multi Pattern Coated Paper Blessing Cards For Kids Family Holiday Gift
Happy Easter Greeting Cards Cartoon Animal Multi Pattern Coated Paper Blessing Cards For Kids Family Holiday Gift
like
Find Similar
Detail view of colorful Easter greeting cards set with cartoon animals and eggs - Cartoon Animal Style (RXHB0148)
NewHappy Easter Greeting Cards Cartoon Animal Multi Pattern Coated Paper Blessing Cards For Kids Family Holiday Gift
$1.44
Mix MOQ : 5
Snowflake Laser Cut Wedding Invitation Card European Style Pearl Paper Card With Ribbon For Christmas Banquet Party
Snowflake Laser Cut Wedding Invitation Card European Style Pearl Paper Card With Ribbon For Christmas Banquet Party
like
Find Similar
Elegant white laser cut snowflake wedding invitation with a cream satin bow on dark mirror - White
Elegant laser-cut black snowflake wedding invitation with white floral card and satin ribbon - Black
Elegant emerald green laser-cut snowflake wedding invitation with white floral insert - Dark Green
Laser cut burgundy snowflake wedding invitation card with ribbon and floral inner sheet - Dark Red
+4
Snowflake Laser Cut Wedding Invitation Card European Style Pearl Paper Card With Ribbon For Christmas Banquet Party
-4%
$0.41
Mix MOQ : 50
Christmas New Year Greeting Cards Black Cardboard Gold Foil Hand Drawn Reindeer Tree Patterns Holiday Blessing Message Cards
Christmas New Year Greeting Cards Black Cardboard Gold Foil Hand Drawn Reindeer Tree Patterns Holiday Blessing Message Cards
like
Find Similar
Set of 6 black Merry Christmas cards with gold illustrations and matching envelopes - 425# Christmas Cards (Set)
Christmas New Year Greeting Cards Black Cardboard Gold Foil Hand Drawn Reindeer Tree Patterns Holiday Blessing Message Cards
$0.98
Mix MOQ : 2
Women Retro Floral Print Card Holder Wallet PU Leather Multi Slot Accordion Style Organizer With Snap Button
Women Retro Floral Print Card Holder Wallet PU Leather Multi Slot Accordion Style Organizer With Snap Button
like
Find Similar
Retro oil painting floral card holder in PU leather with silver snap button and 11x7.5x2cm size - Summer Promise
Vintage floral card holder in light green PU leather with secure snap button closure - Eden Flower Mirror
Floral retro card holder with yellow daisy print and snap closure, size 11x7.5x2cm - Fresh Daisy
Floral oil painting credit card holder with vintage patterns and secure snap button closure - Camellia Bloom
+4
Women Retro Floral Print Card Holder Wallet PU Leather Multi Slot Accordion Style Organizer With Snap Button
-5%
$0.94
No MOQ
 · 
160 sold recently
Top 10% Best Sellers
in Wallets & Cardholders
Minimalist Aluminum Alloy RFID Blocking Card Holder Metal Money Clip Ultra Thin Business Slim Wallet For Men Women
Minimalist Aluminum Alloy RFID Blocking Card Holder Metal Money Clip Ultra Thin Business Slim Wallet For Men Women
like
Find Similar
Minimalist carbon fiber RFID blocking wallet in matte green with black money clip - Army Green
Detail view of carbon fiber credit card holder with RFID blocking and money clip feature - Gray
Minimalist silver aluminum RFID blocking card holder with carbon fiber and metal money clip - Silver
Blue matte aluminum RFID blocking wallet with carbon fiber texture and metal money clip - Light Blue
+12
Minimalist Aluminum Alloy RFID Blocking Card Holder Metal Money Clip Ultra Thin Business Slim Wallet For Men Women
-4%
$3.89
No MOQ
 · 
12K+ sold recently
Top 1% Best Sellers
in Wallets & Cardholders
Ultra Slim Card Holder PU Leather Minimalist Multi Slot Business Card Case Solid Color Lightweight For Men Women
Ultra Slim Card Holder PU Leather Minimalist Multi Slot Business Card Case Solid Color Lightweight For Men Women
like
Find Similar
Red PU leather card holder with four card slots and white stitched edges finish - Red
Morandi light blue PU leather card holder with 4 card slots and stitched edges - Light Blue
Premium black PU leather card holder with four slots and durable stitched edges - Black
Khaki leather card holder with 4 slots and refined stitched edges on white background - Khaki
+4
Ultra Slim Card Holder PU Leather Minimalist Multi Slot Business Card Case Solid Color Lightweight For Men Women
$0.57
Mix MOQ : 3
 · 
541 sold recently
250G Wedding Party Place Cards Blank Folding Table Name Cards Pearlescent Cardstock Seat Cards For Banquets Events White
250G Wedding Party Place Cards Blank Folding Table Name Cards Pearlescent Cardstock Seat Cards For Banquets Events White
like
Find Similar
Minimalist white foldable place cards for wedding seating and elegant party table settings - White 250G
250G Wedding Party Place Cards Blank Folding Table Name Cards Pearlescent Cardstock Seat Cards For Banquets Events White
$0.10
Mix MOQ : 50
DIY Paper Bouquet Greeting Cards Autumn Harvest Sunflower Thanksgiving Handmade Cardstock Gift Decoration
DIY Paper Bouquet Greeting Cards Autumn Harvest Sunflower Thanksgiving Handmade Cardstock Gift Decoration
like
Find Similar
24 sets of DIY floral greeting cards with colorful paper flowers and green support stems - 24 Pieces Per Set
DIY Paper Bouquet Greeting Cards Autumn Harvest Sunflower Thanksgiving Handmade Cardstock Gift Decoration
$4.32
Mix MOQ : 3
Laser Cut Just For You Greeting Card Hollow Floral Daisy Invitation Card With Inner Page For Wedding Party Birthday
Laser Cut Just For You Greeting Card Hollow Floral Daisy Invitation Card With Inner Page For Wedding Party Birthday
like
Find Similar
Square greeting card with Just for You text and pink floral laser-cut daisy design - White Shell With Pink Inner Card
Square white greeting card with laser-cut pink daisy pattern and Just for You text - White Outer Shell with Kraft Paper Inner Card
Just for You hollow out greeting card with pink daisies and elegant paper textures - White Card + Purple Inner Page
Laser Cut Just For You Greeting Card Hollow Floral Daisy Invitation Card With Inner Page For Wedding Party Birthday
$0.75
Mix MOQ : 50
Floral Wedding Place Cards Paper Foldable Seat Name Card For Table Decoration European Style Romantic Party Event
Floral Wedding Place Cards Paper Foldable Seat Name Card For Table Decoration European Style Romantic Party Event
like
Find Similar
1 option
Floral Wedding Place Cards Paper Foldable Seat Name Card For Table Decoration European Style Romantic Party Event
$0.03
Mix MOQ : 50
Bad Parking Warning Cards Prank Checklist Novelty Humor Gift Double Sided Paper For Car Drivers Adults
Bad Parking Warning Cards Prank Checklist Novelty Humor Gift Double Sided Paper For Car Drivers Adults
like
Find Similar
50-pack bad parking cards set with funny violation reasons and double-sided design - Double-Sided Warning Cards (57D)
Bad Parking Warning Cards Prank Checklist Novelty Humor Gift Double Sided Paper For Car Drivers Adults
$0.61
Mix MOQ : 2
Infinity Shape Place Card Holder Metal Table Number Stand Memo Clip Desktop Wedding Restaurant Decoration Romantic
Infinity Shape Place Card Holder Metal Table Number Stand Memo Clip Desktop Wedding Restaurant Decoration Romantic
like
Find Similar
Rose gold infinity shape table card holder dimensions 68mm x 26mm with 2mm wire diameter - Infinity 8 Shape Regular Style / Silver
Rose gold figure-8 metal table number holder with detailed dimension markings - Water Lily Style / Gold
Polished golden infinity-shaped wedding place card holder with a reflective mirror base - New Infinity 8 Style with Round Tail / Gold
Treble clef metal place card holders in black, silver, rose gold, and gold finishes - 97mm Musical Note Style / Gold
+9
Infinity Shape Place Card Holder Metal Table Number Stand Memo Clip Desktop Wedding Restaurant Decoration Romantic
$0.33
Mix MOQ : 10
 · 
58 views
Laser Cut Pearl Paper Hollow Lace Decorative Card For Wedding Invitation Greeting Card Scrapbooking Ornament European Court Style
Laser Cut Pearl Paper Hollow Lace Decorative Card For Wedding Invitation Greeting Card Scrapbooking Ornament European Court Style
like
Find Similar
Intricate white lace laser-cut hollow card with elegant vine patterns on dark background - White
Elegant black laser-cut lace card with intricate floral patterns for wedding invitations - Black
Laser Cut Pearl Paper Hollow Lace Decorative Card For Wedding Invitation Greeting Card Scrapbooking Ornament European Court Style
$0.26
Mix MOQ : 100
Laser Cut Reindeer Wine Glass Place Cards Pearlescent Paper Christmas Party Wedding Table Name Cards For Guest Decoration
Laser Cut Reindeer Wine Glass Place Cards Pearlescent Paper Christmas Party Wedding Table Name Cards For Guest Decoration
like
Find Similar
Elegant laser cut white reindeer glass cards for wedding and Christmas party decorations - White
Brown laser-cut reindeer place cards for Christmas wine glass rim decorations - Coffee
Elegant laser-cut black reindeer cup card for Christmas party table decoration - Charcoal Silver
Laser Cut Reindeer Wine Glass Place Cards Pearlescent Paper Christmas Party Wedding Table Name Cards For Guest Decoration
$0.07
Mix MOQ : 50
Carbon Fiber RFID Blocking Card Holder Slim Minimalist Metal Money Clip Wallet Anti Theft Business Case Gift For Men
Carbon Fiber RFID Blocking Card Holder Slim Minimalist Metal Money Clip Wallet Anti Theft Business Case Gift For Men
like
Find Similar
Minimalist blue carbon fiber RFID wallet with integrated black metal money clip - Blue
Minimalist carbon fiber RFID wallet in bright yellow finish with matte black money clip - Gold
Minimalist RFID blocking card holder in rose pink carbon fiber with metal money clip - Red
Minimalist carbon fiber credit card holder with RFID blocking and black metal clip - Silver
+1
Carbon Fiber RFID Blocking Card Holder Slim Minimalist Metal Money Clip Wallet Anti Theft Business Case Gift For Men
-5%
$4.65
No MOQ
 · 
120 sold recently
Top 5% Best Sellers
in Wallets & Cardholders
RFID Blocking Credit Card Holder Aluminum Alloy Metal Hard Shell Wallet Waterproof Anti-Magnetic Multi-Slot Travel Case
RFID Blocking Credit Card Holder Aluminum Alloy Metal Hard Shell Wallet Waterproof Anti-Magnetic Multi-Slot Travel Case
like
Find Similar
Glossy red aluminum card holder with anti-magnetic hard shell and secure black lock - Red
Green aluminum card holder with RFID protection and a sleek brushed metal finish - Green
Top view of a purple metallic card holder with a secure black push-button closure - Purple
White aluminum card holder with striped grooves and RFID protection in suitcase style - White
+2
RFID Blocking Credit Card Holder Aluminum Alloy Metal Hard Shell Wallet Waterproof Anti-Magnetic Multi-Slot Travel Case
$0.60
Mix MOQ : 3
 · 
581 sold recently
Laser Cut Pearl Paper Lace Rose Flower Decorative Card For Wedding Scrapbooking DIY European Royal Style Hollow Card
Laser Cut Pearl Paper Lace Rose Flower Decorative Card For Wedding Scrapbooking DIY European Royal Style Hollow Card
like
Find Similar
Elegant white laser-cut floral rectangular frame with rose and daisy patterns for wedding DIY - White
Intricate laser-cut floral lace decorative frame with roses and leaves in black pearl paper - Black
Laser Cut Pearl Paper Lace Rose Flower Decorative Card For Wedding Scrapbooking DIY European Royal Style Hollow Card
$0.29
Mix MOQ : 50
RFID Blocking Card Holder Automatic Pop Up Aluminum Alloy Slim Credit Card Case Minimalist Matte Business Wallet
RFID Blocking Card Holder Automatic Pop Up Aluminum Alloy Slim Credit Card Case Minimalist Matte Business Wallet
like
Find Similar
Macro shot of red aluminum RFID blocking wallet showing the pop-up mechanism and matte finish - Red
Slim black RFID blocking aluminum card holder with automatic pop-up mechanism - Black
Macro view of light blue RFID aluminum card holder with automatic pop-up sliding mechanism - Blue
Detailed macro view of the silver aluminum RFID blocking card holder with pop-up mechanism - Silver
+4
RFID Blocking Card Holder Automatic Pop Up Aluminum Alloy Slim Credit Card Case Minimalist Matte Business Wallet
-5%
$1.37-1.70
Mix MOQ : 3
 · 
292 sold recently
Go to

More in party supplies

Explore more in card envelopes

cardsholderheartgoldholidayalloyshoulderlettercolorssmall wallet
partyhollowhandmadesmalldiycakemetalgift wrappingheart shapefestival

Ready to source like an insider

Get a direct line to the factory floor — no minimums, no middlemen, no guesswork.
iconReal factory pricing, no markup in betweeniconEvery order hand-inspected before it shipsicon5,000+ new products added daily
Get Inside Access