Everful

Wholesale blanket

Factory-direct selection, vetted for quality and ready to order.

Sign Up
Blanket

Find the perfect pieces: home decor accents & accessories, artificial decorations, artificial flowers and more

CarPets, Floor Mats & Protectants

All products in blanket

filterShow Filters
Best Seller
New Arrivals
Price Drop
Free Shipping
Decorative Square Throw Pillow Case Super Soft Short Plush Cushion Cover Artistic Animal Cartoon Patterns For Sofa Home Decor
Decorative Square Throw Pillow Case Super Soft Short Plush Cushion Cover Artistic Animal Cartoon Patterns For Sofa Home Decor
like
Find Similar
Soft plush pillow cover featuring golden retriever swimming in blue ocean water - Ocean Golden Retriever (Style-1)
Detail of soft plush pillow cover featuring London winter night with red buses and Big Ben - London Snow Scene (Style-2)
Square soft plush pillow case featuring artistic anime boy playing guitar in bedroom - Guitar Boy (Style-3)
Cartoon mother and baby illustration pillow case in soft plush material with vibrant flowers - Mother and Baby Illustration (Style-4)
+4
Decorative Square Throw Pillow Case Super Soft Short Plush Cushion Cover Artistic Animal Cartoon Patterns For Sofa Home Decor
-4%
$1.10
No MOQ
Easter Linen Throw Pillow Case Farmhouse Retro Rabbit Egg Print Decorative Cushion Cover For Living Room Home Decor Watercolor Pattern
Easter Linen Throw Pillow Case Farmhouse Retro Rabbit Egg Print Decorative Cushion Cover For Living Room Home Decor Watercolor Pattern
like
Find Similar
Easter decorative bunny pillow cover with vintage watercolor rabbit and flower print - 45*45cm Linen Single-Sided No Insert / Cute Rabbit And Butterfly Style (DYM462-1)
Easter decorative throw pillow cover with farmhouse bunny and floral wreath print - 45*45cm Linen Single-Sided No Insert / Chick And House Wreath Style (DYM462-2)
Easter pillow cover with vintage bicycle, bunny and egg prints on linen fabric - 45*45cm Linen Single-Sided No Insert / Vintage Bicycle Rabbit Style (DYM462-3)
Easter pillow cover with vintage farm bunny eggs and floral print on linen texture - 45*45cm Linen Single-Sided No Insert / Eggs Butterfly And Floral Style (DYM462-4)
NewEaster Linen Throw Pillow Case Farmhouse Retro Rabbit Egg Print Decorative Cushion Cover For Living Room Home Decor Watercolor Pattern
$1.30
Mix MOQ : 2
Modern Polar Fleece Sofa Cover Leaf Jacquard Pattern High Elastic Universal Anti-Slip Slipcover Furniture Protector
Modern Polar Fleece Sofa Cover Leaf Jacquard Pattern High Elastic Universal Anti-Slip Slipcover Furniture Protector
like
Find Similar
Modern minimalist cream white sofa cover with textured leaf vein pattern polar fleece fabric - Single Seater / Off-white (Ruiye)
Grass green polar fleece sofa cover with textured leaf patterns and matching pillowcase - Single Seater / Green (Ruiye)
Modern light grey polar fleece sofa cover with embossed leaf patterns and matching pillows - Single Seater / Light Gray (Ruiye)
Gray polar fleece sofa cover with 3D leaf texture and matching pillowcase set - Single Seater / Dark Gray (Ruiye)
+24
Modern Polar Fleece Sofa Cover Leaf Jacquard Pattern High Elastic Universal Anti-Slip Slipcover Furniture Protector
$2.88-24.64
No MOQ
Patriotic Table Runner Stars And Stripes Independence Day July Fourth Decor Polyester Linen Look Vintage Farmhouse Dining
Patriotic Table Runner Stars And Stripes Independence Day July Fourth Decor Polyester Linen Look Vintage Farmhouse Dining
like
Find Similar
Vintage US Independence Day table runner with distressed American flag print on wood - Retro Stars and Stripes (ZQ24-1)
Vintage Independence Day table runner with American flag stars on rustic linen fabric - Vintage Pentagram Design (ZQ24-2)
Independence Day table runner with red plaid trim and patriotic star motifs - Berries and Stars Design (ZQ24-3)
Rustic Bless This Home table runner with American farmhouse Independence Day prints - Bless This Home Cabin Design (ZQ24-4)
+5
Patriotic Table Runner Stars And Stripes Independence Day July Fourth Decor Polyester Linen Look Vintage Farmhouse Dining
-4%
$2.88
No MOQ
 · 
35 sold recently
Round Sequin Tablecloth Shimmering Glitter Fabric For Wedding Banquet Party Hotel Home Decoration Elegant Solid Color
Round Sequin Tablecloth Shimmering Glitter Fabric For Wedding Banquet Party Hotel Home Decoration Elegant Solid Color
like
Find Similar
Sparkling silver sequin round tablecloth for wedding banquet and party decoration - 61cm / Silver
Sparkling black round sequin tablecloth for weddings and events on a white background - 61cm / Black
Sparkling gold sequin round tablecloth for wedding ceremonies and banquet events - 80cm / Gold
Elegant round pink sequin tablecloth for weddings and banquet table decoration - 80cm / Rose Pink
+36
Round Sequin Tablecloth Shimmering Glitter Fabric For Wedding Banquet Party Hotel Home Decoration Elegant Solid Color
$1.47-4.61
No MOQ
 · 
67 sold recently
Bohemian Ethnic Geometric Peach Skin Polyester Square Pillowcase Vintage Tribal Mandala Decorative Cushion Cover Sofa Decor
Bohemian Ethnic Geometric Peach Skin Polyester Square Pillowcase Vintage Tribal Mandala Decorative Cushion Cover Sofa Decor
like
Find Similar
Ethnic bohemian geometric pillowcase with colorful aztec patterns on white background - Aztec Geometric Multicolor Style (DRS16-1)
Square bohemian geometric throw pillow cover in warm orange and yellow woven pattern - Bohemian Southwestern Rhombus Pattern (DRS16-2) / Polyester Double Sided Without Core
Bohemian geometric square pillow cover in teal blue with ethnic patterns for home decor - Polyester Double Sided Without Core
Ethnic bohemian geometric pattern square pillowcase with red and black zigzag motifs - Polyester Double Sided Without Core
+30
NewBohemian Ethnic Geometric Peach Skin Polyester Square Pillowcase Vintage Tribal Mandala Decorative Cushion Cover Sofa Decor
$1.50
Mix MOQ : 2
Elastic Vertical Stripe Headboard Cover All-Inclusive Thickened Polar Fleece Dustproof Bed Back Protector For Home Hotel
Elastic Vertical Stripe Headboard Cover All-Inclusive Thickened Polar Fleece Dustproof Bed Back Protector For Home Hotel
like
Find Similar
Minimalist cream white elastic ribbed headboard cover with modern vertical texture - L260*H80*T5-28cm / Light Gray
Universal coffee brown elastic headboard cover with vertical ribbed knit pattern - L260*H80*T5-28cm / Coffee
Elastic deep grey headboard cover with vertical ribbed texture for modern beds - L260*H80*T5-28cm / Dark Gray
+18
Elastic Vertical Stripe Headboard Cover All-Inclusive Thickened Polar Fleece Dustproof Bed Back Protector For Home Hotel
$5.62-11.82
No MOQ
Christmas Gingerbread Man Pillowcase Faux Linen Cushion Cover For Sofa Car Office Decor Holiday Merry Christmas Print
Christmas Gingerbread Man Pillowcase Faux Linen Cushion Cover For Sofa Car Office Decor Holiday Merry Christmas Print
like
Find Similar
Christmas gingerbread man pillow case with festive print and cotton linen texture - Gingerbread Family Style (YMA25-1)
Rustic Christmas gingerbread man pillow cover with Merry Christmas text on striped linen - Striped Merry Christmas Style (YMA25-2)
Christmas pillowcase with red, grey, green stripes and Merry and Bright text print - Striped Merry And Bright Style (YMA25-3)
Gingerbread man and candy cane festive print on a textured cream linen cushion cover - Gingerbread Man All Over Print Style (YMA25-4)
Christmas Gingerbread Man Pillowcase Faux Linen Cushion Cover For Sofa Car Office Decor Holiday Merry Christmas Print
$1.15
Mix MOQ : 2
Bohemian Abstract Linen Cushion Cover Modern Minimalist Decorative Pillow Case For Sofa Living Room Earthy Tone Art
Bohemian Abstract Linen Cushion Cover Modern Minimalist Decorative Pillow Case For Sofa Living Room Earthy Tone Art
like
Find Similar
Bohemian abstract sun and wave pattern throw pillow cover in earthy brown tones - Single Sided Linen Without Core / Sunflower Wave Style (DYM32-1)
Abstract bohemian pillow case featuring botanical leaves and warm earthy tones in square design - Single Sided Linen Without Core / Abstract Leaf Color Block Style (DYM32-2)
Modern abstract pillow cover with brown floral lines and minimalist wave pattern - Single Sided Linen Without Core / Stylized Floral Polka Dot Style (DYM32-3)
Bohemian abstract leaf throw pillow cover with earthy tones on a white background - Single Sided Linen Without Core / Abstract Plant Leaf Style (DYM32-4)
Bohemian Abstract Linen Cushion Cover Modern Minimalist Decorative Pillow Case For Sofa Living Room Earthy Tone Art
$1.30
Mix MOQ : 2
Autumn Bird Floral Inspirational Quote Pillowcase Polyester Linen Look Square Throw Cushion Cover For Sofa Home Decor
Autumn Bird Floral Inspirational Quote Pillowcase Polyester Linen Look Square Throw Cushion Cover For Sofa Home Decor
like
Find Similar
Square linen pillow cover featuring a watercolor blue bird and autumn maple leaf design - Blue Bird Style (YMW16-1)
Linen autumn throw pillow cover featuring a bird, birdhouse, and fall maple leaves - Yellow Bird Style (YMW16-2)
Deep purple linen pillowcase with cardinal, birdhouse, and autumn maple leaf print - Red Cardinal Style (YMW16-3)
Square linen pillow cover with green base, birdhouse sunflower print and religious quote - Green Kingfisher Style (YMW16-4)
Autumn Bird Floral Inspirational Quote Pillowcase Polyester Linen Look Square Throw Cushion Cover For Sofa Home Decor
$1.33
Mix MOQ : 3
Dad's Spot Remote Control Pocket Throw Pillow Cover Linen Blend Pillowcase For Father's Day Gift Sofa Living Home Decor
Dad's Spot Remote Control Pocket Throw Pillow Cover Linen Blend Pillowcase For Father's Day Gift Sofa Living Home Decor
like
Find Similar
Linen pillowcase for dad with remote pockets and Dad's Spot text for Father's Day gift - 45*45mm / Letter Style
NewDad's Spot Remote Control Pocket Throw Pillow Cover Linen Blend Pillowcase For Father's Day Gift Sofa Living Home Decor
$2.02-4.90
Mix MOQ : 2
Linen Cushion Cover With Storage Pockets Remote Phone Holder For Sofa Living Room Funny Family Spot Novelty
Linen Cushion Cover With Storage Pockets Remote Phone Holder For Sofa Living Room Funny Family Spot Novelty
like
Find Similar
Grandpa's Spot linen pillowcase with storage pockets for remote and glasses - Style 2 (Beige-Grandpa's Spot)
Beige linen pillowcase with storage pockets and Teacher's Spot floral print - Style 3 (Beige-Teacher's Spot)
Detailed texture of beige linen pillowcase with storage pockets for remote and phone - Style 7 (Beige-Aunt's Spot)
Detail of linen pillow cover with pockets for remote controller and bottle storage - Style 8 (Black-Dad's Spot Controller)
+7
Linen Cushion Cover With Storage Pockets Remote Phone Holder For Sofa Living Room Funny Family Spot Novelty
-4%
$1.82
No MOQ
 · 
36 sold recently
Jacquard Lumbar Pillow Case With Tassels American Style Decorative Long Throw Cushion Cover For Sofa Living Room Bedroom
Jacquard Lumbar Pillow Case With Tassels American Style Decorative Long Throw Cushion Cover For Sofa Living Room Bedroom
like
Find Similar
Detail of bohemian red and white floral jacquard lumbar pillow with decorative tassels - Red Sunflower Lumbar Pillow Case (Without Core) / No Insert
Detail of bohemian rectangle lumbar pillow with mandala jacquard and tassel trim edges - Khaki Mandala Lumbar Pillow Case (Without Core) / No Insert
Gray and white bohemian lumbar pillow with geometric patterns and tassels on white sofa - Gray Mandala Lumbar Pillow Case (Without Core) / No Insert
Macro view of geometric jacquard fabric and tassel details on a long lumbar pillow - Gray Cloud Lumbar Pillow Case (Without Core) / No Insert
+30
Jacquard Lumbar Pillow Case With Tassels American Style Decorative Long Throw Cushion Cover For Sofa Living Room Bedroom
-5%
$6.02-10.13
No MOQ
Nordic Decorative Polyester Cushion Cover Watercolor Floral Botanical Letter Print Square Pillowcase For Sofa Living Room Decor
Nordic Decorative Polyester Cushion Cover Watercolor Floral Botanical Letter Print Square Pillowcase For Sofa Living Room Decor
like
Find Similar
Floral watercolor linen pillowcase featuring meadow flowers and butterfly patterns - Watercolor Floral Style (JYM583-1)
Square cushion cover with pink and blue gradient and white HOME text printed on fabric - HOME Letter Gradient Style (JYM583-2)
Floral square pillowcase with pink-purple gradient and 'BLESS our nest' printed art text - BLESS Art Font Gradient Style (JYM583-3)
Square polyester pillow cover with watercolor flower bouquet and 'bloom' text on white base - Jym583-4 / 45x45 Square (No Insert)
Nordic Decorative Polyester Cushion Cover Watercolor Floral Botanical Letter Print Square Pillowcase For Sofa Living Room Decor
$1.15
Mix MOQ : 2
Ocean Series Mermaid Whale Jellyfish Pattern Square Throw Cushion Covers Artistic Linen Blend Velvet Decor For Sofa Bed Car
Ocean Series Mermaid Whale Jellyfish Pattern Square Throw Cushion Covers Artistic Linen Blend Velvet Decor For Sofa Bed Car
like
Find Similar
Detail of artistic colorful fish print on a deep blue marine theme cotton linen pillowcase - Super Soft Velvet / 45x45cm / Pattern A
Close-up of artistic bioluminescent jellyfish print on black cotton linen cushion cover - Super Soft Velvet / 45x45cm / Pattern I
Artistic orange octopus ocean theme throw pillow cover made of linen cotton fabric - Super Soft Velvet / 45x45cm / Pattern R
Artistic seahorse print cushion cover with deep sea coral and bubbles on white background - Super Soft Velvet / 45x45cm / Pattern V
+60
Ocean Series Mermaid Whale Jellyfish Pattern Square Throw Cushion Covers Artistic Linen Blend Velvet Decor For Sofa Bed Car
$1.21
Mix MOQ : 2
 · 
27 views
Nordic Quilted Dutch Velvet Lumbar Pillow Rectangular Decorative Throw Pillow With Insert For Sofa Bed Waist Cushion
Nordic Quilted Dutch Velvet Lumbar Pillow Rectangular Decorative Throw Pillow With Insert For Sofa Bed Waist Cushion
like
Find Similar
Red rectangular velvet pillow with hand-made pleated diamond pattern and soft texture - 30x50 with 350g Core / Red
Dutch velvet lumbar pillow with quilted diamond pattern in deep coffee brown finish - 30x50 with 350g Core / Coffee
Blue velvet rectangular lumbar pillow with elegant diamond quilted pattern and soft sheen - 30x50 with 350g Core / Dark Blue
Rectangle beige velvet throw pillow with decorative diamond pleated texture and insert - 30x50 with 350g Core / Beige
+35
Nordic Quilted Dutch Velvet Lumbar Pillow Rectangular Decorative Throw Pillow With Insert For Sofa Bed Waist Cushion
-5%
$2.19-4.38
Mix MOQ : 2
Pastoral Floral Cotton Linen Tablecloth Rectangular Printed Dustproof Table Cover For Home Kitchen Dining Room Decoration
Pastoral Floral Cotton Linen Tablecloth Rectangular Printed Dustproof Table Cover For Home Kitchen Dining Room Decoration
like
Find Similar
Rectangle rustic cotton linen tablecloth with white floral pattern on brown fabric - 140cmx220cm / Orange Background Curved Flower
Green linen tablecloth with white floral pattern and natural texture for home dining decor - 140cmx220cm / Green Background Curved Flower
Black cotton linen tablecloth featuring white floral patterns and wavy vine texture - 140cmx180cm / Black Background Curved Flower
+30
NewPastoral Floral Cotton Linen Tablecloth Rectangular Printed Dustproof Table Cover For Home Kitchen Dining Room Decoration
-5%
$1.37-11.22
No MOQ
Festive Chinese Style Fruit Pattern Printed Cushion Cover Soft Polyester Decorative Pillow Case For Sofa Home Decor
Festive Chinese Style Fruit Pattern Printed Cushion Cover Soft Polyester Decorative Pillow Case For Sofa Home Decor
like
Find Similar
Square beige cushion cover with orange energy design and Chinese characters motif - 45x45CM (No Core) / Beige Orange Pattern (CRS09-7)
Traditional Chinese festive red and cream square pillow cover with persimmon patterns - 45x45CM (No Core) / Red Persimmon Pattern (CRS09-6)
Chinese New Year festive cushion cover with orange illustration and lucky symbols - Double Sided Print Without Core
Square cushion cover featuring minimalist yellow pear patterns on a beige background - Double Sided Print Without Core / Full Pear Print(CRS09-4)
+68
Festive Chinese Style Fruit Pattern Printed Cushion Cover Soft Polyester Decorative Pillow Case For Sofa Home Decor
-4%
$2.44-4.08
Mix MOQ : 2
Modern Thick Milk Velvet Sofa Cushion Cover Non-Slip Quilted Geometric Sofa Protector For Living Room Solid Color Furniture Cover
Modern Thick Milk Velvet Sofa Cushion Cover Non-Slip Quilted Geometric Sofa Protector For Living Room Solid Color Furniture Cover
like
Find Similar
Thick milk velvet quilted sofa cover in cream white and grey with 3D honeycomb texture - 70x70cm / Off-white
Quilted milk velvet sofa cushion in warm cream white with decorative throw pillows - 70x70cm / Brown
Mint green plush milk fleece sofa cushion with geometric embossed square pattern - 70x70cm / Green
Thick grey milk velvet sofa cover with square quilting and matching pillows set - 70x70cm / Light Gray
+86
Modern Thick Milk Velvet Sofa Cushion Cover Non-Slip Quilted Geometric Sofa Protector For Living Room Solid Color Furniture Cover
$3.75-14.41
No MOQ
Retro Checkerboard Thickened Flannel Chair Cushion Vintage Plaid Seat Pad For Office Dining Room Home Decor Soft Quilted Mat
Retro Checkerboard Thickened Flannel Chair Cushion Vintage Plaid Seat Pad For Office Dining Room Home Decor Soft Quilted Mat
like
Find Similar
Thick checkered flannel seat cushion with brown and white plush quilted finish - 18x18 Inch / Orange White
Plush black and white checkerboard flannel chair cushion with soft ribbed velvet texture - 18x18 Inch / Black & White
Red and white checkered heavy flannel chair cushion on a white metal folding chair - 18x18 Inch / Red & White
Grey and white checkered flannel chair cushion with soft non-slip velvet texture - 18x18 Inch / Off-White
+26
NewRetro Checkerboard Thickened Flannel Chair Cushion Vintage Plaid Seat Pad For Office Dining Room Home Decor Soft Quilted Mat
$7.78-33.14
No MOQ
 · 
14 views
Linen Cushion Cover Ocean Nautical Starfish Shell Theme Decorative Pillow Case For Sofa Home Living Room Digital Print
Linen Cushion Cover Ocean Nautical Starfish Shell Theme Decorative Pillow Case For Sofa Home Living Room Digital Print
like
Find Similar
Set of four nautical linen cushion covers with starfish, shells and beach themed prints - Marine Coastal 4-Piece Set (Style-1)
Coastal linen pillow cover featuring starfish and 'Seas THE Day' nautical design - Seas THE Day Starfish (Style-2)
Linen ocean cushion cover with starfish and Home Sweet Home print for sofa decor - Home Sweet Home Starfish (Style-3)
Linen beach cushion cover with printed sea shells, starfish, and coral on white background - Beach Shell Coral (Style-4)
+1
Linen Cushion Cover Ocean Nautical Starfish Shell Theme Decorative Pillow Case For Sofa Home Living Room Digital Print
$1.15-4.61
Mix MOQ : 2
 · 
22 sold recently
Nordic Orange Geometric Abstract Lumbar Pillow Cover Cat Floral Print Rectangle Soft Cushion Case For Sofa Car Home Decor
Nordic Orange Geometric Abstract Lumbar Pillow Cover Cat Floral Print Rectangle Soft Cushion Case For Sofa Car Home Decor
like
Find Similar
Nordic orange geometric lumbar pillow cover with abstract print for home car decor - 30cm x 50cm / Abstract Art Patchwork Style (CRD62-1)
Minimalist rectangular orange lumbar pillow cover in solid terracotta fabric texture - 30cm x 50cm / Solid Burnt Orange Style (CRD62-2)
Nordic abstract geometric lumbar pillow cover with artistic orange and grey brush strokes - 30cm x 50cm / Paint Brush Stroke Design (CRD62-3)
Nordic orange geometric abstract pillow case with modern desert mountain landscape print - 30cm x 50cm / Desert Mountain Imagery (CRD62-4)
+19
NewNordic Orange Geometric Abstract Lumbar Pillow Cover Cat Floral Print Rectangle Soft Cushion Case For Sofa Car Home Decor
$1.33
Mix MOQ : 2
Christmas Cardinal Poinsettia Linen Throw Pillow Cover Winter Bird Decorative Cushion Case For Sofa Home Decor Holiday Gift
Christmas Cardinal Poinsettia Linen Throw Pillow Cover Winter Bird Decorative Cushion Case For Sofa Home Decor Holiday Gift
like
Find Similar
Linen pillow cover with Christmas cardinal bird and red poinsettia floral print on gray sofa - Realistic Cardinal And Poinsettia Hand-Drawn Design (1)
Linen pillow cover with festive red cardinal and poinsettia flower for Christmas decor - Cardinal Perched In Poinsettia Flowers Design (2)
Linen Christmas pillow cover with red cardinals and poinsettia on a grey sofa - Cardinal With Pine Cones And Branches Festive Design (3)
Detailed macro view of linen texture and cardinal bird floral print on cushion cover - Two Cardinals On Berry Branches Design (4)
+8
Christmas Cardinal Poinsettia Linen Throw Pillow Cover Winter Bird Decorative Cushion Case For Sofa Home Decor Holiday Gift
-4%
$1.18
No MOQ
Nordic Modern Minimalist Cotton Linen Checkered Tablecloth Rectangular Gray White Black Grid Plaid Dining Table Cover Home Decor
Nordic Modern Minimalist Cotton Linen Checkered Tablecloth Rectangular Gray White Black Grid Plaid Dining Table Cover Home Decor
like
Find Similar
Minimalist black and white grid pattern cotton linen tablecloth in a cozy home setting - 140*220cm / White Plaid
Modern minimalist black and white checkered linen tablecloth with a high-quality thick texture - 140*220cm / Black Plaid
Modern grey plaid linen tablecloth with elegant texture for minimalist dining room decor - 60*60cm / Grey Plaid
+45
Nordic Modern Minimalist Cotton Linen Checkered Tablecloth Rectangular Gray White Black Grid Plaid Dining Table Cover Home Decor
-5%
$1.37-8.21
No MOQ
Christmas Buffalo Plaid Linen Pillowcase Farmhouse Red Truck Reindeer Decorative Throw Cushion Cover For Xmas Home Decor
Christmas Buffalo Plaid Linen Pillowcase Farmhouse Red Truck Reindeer Decorative Throw Cushion Cover For Xmas Home Decor
like
Find Similar
Christmas buffalo check linen pillow cover with red truck and farm fresh tree design - Farm Fresh Christmas Trees Truck Style
Christmas buffalo plaid linen pillow cover with black cat silhouette and festive quote - Christmas Cat Style
Christmas buffalo plaid linen pillowcase with Santa Claus sleigh and reindeer silhouette - Santa Claus Is Coming To Town Sleigh Style
Christmas buffalo plaid linen pillowcase with reindeer silhouette and name list print - Reindeer Names List Style
+11
Christmas Buffalo Plaid Linen Pillowcase Farmhouse Red Truck Reindeer Decorative Throw Cushion Cover For Xmas Home Decor
-4%
$1.18
No MOQ
Summer Watermelon Gnome Sunflower Truck Pattern Polyester Cushion Cover Linen Texture Decorative Square Pillowcase For Sofa Home
Summer Watermelon Gnome Sunflower Truck Pattern Polyester Cushion Cover Linen Texture Decorative Square Pillowcase For Sofa Home
like
Find Similar
Detail of linen pillowcase with red truck carrying watermelons and printed text - Red Truck Watermelon Style (23YM15-1)
Detail of green wavy striped linen pillowcase with high-quality fabric texture - Green Wavy Stripes Style (23YM15-2)
Detailed macro view of linen texture and watermelon seed print on the red cushion cover - Red Base Black Seeds Style (23YM15-3)
Detail of linen pillowcase with sweet summer watermelon print and ladybug pattern - Ladybug Watermelon Sweet Summer Style (23YM15-4)
+8
Summer Watermelon Gnome Sunflower Truck Pattern Polyester Cushion Cover Linen Texture Decorative Square Pillowcase For Sofa Home
$1.15
Mix MOQ : 2
Bohemian Chenille Sofa Cushion Thick Non-Slip Geometric Pattern Ethnic Furniture Protector Slipcover For Living Room Home
Bohemian Chenille Sofa Cushion Thick Non-Slip Geometric Pattern Ethnic Furniture Protector Slipcover For Living Room Home
like
Find Similar
Bohemian chenille sofa cover with geometric patterns in beige, blue, and red tones - 70x70 / Beige
Bohemian red chenille sofa cover with geometric patterns and anti-slip thick weave - 70x70 / Red
Bohemian chenille sofa cover with blue geometric patterns and matching pillows - 70x70 / Black
Bohemian chenille sofa cover set with orange and blue geometric patterns for decor - 110x210 / Gray
+154
Bohemian Chenille Sofa Cushion Thick Non-Slip Geometric Pattern Ethnic Furniture Protector Slipcover For Living Room Home
$4.90-28.82
Mix MOQ : 2
Christmas Pillow Covers Linen Decorative Cushion Cases For Sofa Home Decor Winter Snowman Tree Pattern Blue White
Christmas Pillow Covers Linen Decorative Cushion Cases For Sofa Home Decor Winter Snowman Tree Pattern Blue White
like
Find Similar
Linen Christmas pillowcase featuring a cute snowman with blue hat and scarf decor - TQYM41-1 Snowman Scarf / 45*45cm Single-sided Linen
Close-up of linen pillow cover with three blue Christmas trees and striped background - TQYM41-2 Christmas Tree Stripes / 45*45cm Single-sided Linen
Close-up of blue plaid linen pillowcase with white Believe text and snowflake patterns - TQYM41-3 Blue Plaid Believe / 45*45cm Single-sided Linen
Linen Christmas pillow cover featuring a blue joy bauble design on cream background - TQYM41-4 Christmas Ball Joy / 45*45cm Single-sided Linen
+4
Christmas Pillow Covers Linen Decorative Cushion Cases For Sofa Home Decor Winter Snowman Tree Pattern Blue White
$1.30
Mix MOQ : 2
Thickened Chenille Geometric Line Sofa Towel Slip Resistant Universal Sofa Furniture Protector With Lace Trim Home Decor
Thickened Chenille Geometric Line Sofa Towel Slip Resistant Universal Sofa Furniture Protector With Lace Trim Home Decor
like
Find Similar
Champagne gold chenille sofa cover with geometric pattern and white lace trim - 180x150 / Coffee
Detail of blue geometric chenille sofa cover with golden patterns and lace edges - 180x150 / Geometric Blue
Thick chenille sofa cover with brown geometric diamond patterns and lace edges - 180x150 / Beige
Thick chenille grey sofa cover with golden geometric patterns and white lace edges - 180x150 / Gray
+20
Thickened Chenille Geometric Line Sofa Towel Slip Resistant Universal Sofa Furniture Protector With Lace Trim Home Decor
-5%
$18.89-35.59
No MOQ
Thanksgiving Autumn Maple Leaf Pumpkin Print Throw Pillowcase Soft Short Plush Square Cushion Cover For Sofa Couch Home Decor
Thanksgiving Autumn Maple Leaf Pumpkin Print Throw Pillowcase Soft Short Plush Square Cushion Cover For Sofa Couch Home Decor
like
Find Similar
Square fall pillow cover featuring gnomes, pumpkins, and Happy Fall Y'all typography - 45x45cm Single Sided Printing
White Thanksgiving pillow cover featuring Love text with leopard print and orange pumpkin - 45x45cm Single Sided Printing
Square fall pillow case with pumpkin spice latte print and autumn leaves on white fabric - 45x45cm Single Sided Printing
White Thanksgiving pillow cover with Autumn Girly text and orange bow illustration - 45x45cm Single Sided Printing
+18
Thanksgiving Autumn Maple Leaf Pumpkin Print Throw Pillowcase Soft Short Plush Square Cushion Cover For Sofa Couch Home Decor
$1.30
Mix MOQ : 2
Autumn Pumpkin Throw Pillow Covers Thanksgiving Decorative Linen Look Cushion Case For Sofa Couch Bedroom Living Room Home Decor
Autumn Pumpkin Throw Pillow Covers Thanksgiving Decorative Linen Look Cushion Case For Sofa Couch Bedroom Living Room Home Decor
like
Find Similar
Linen pumpkin pillowcase with blessed print for autumn farmhouse home decoration - Watercolor Pumpkin Blessed (FP001-1)
Linen autumn pillowcase with orange maple leaf and Autumn is Here text print - Autumn Maple Leaf (Autumn is Here) (FP001-2)
Linen autumn pumpkin pillow cover with Welcome to our Patch print for home decor - Pumpkin Welcome (Welcome to our Patch) (FP001-3)
Linen square pillowcase with watercolor pumpkin print and hello Pumpkin artistic text - Tricolor Pumpkins (Hello Pumpkin) (FP001-4)
+12
Autumn Pumpkin Throw Pillow Covers Thanksgiving Decorative Linen Look Cushion Case For Sofa Couch Bedroom Living Room Home Decor
-5%
$1.09
Mix MOQ : 2
Festive Pink Christmas Pillow Case Polyester Decorative Cushion Cover With Santa Claus Nutcracker Print For Home Sofa Decor
Festive Pink Christmas Pillow Case Polyester Decorative Cushion Cover With Santa Claus Nutcracker Print For Home Sofa Decor
like
Find Similar
Pink Merry Christmas pillow cover in linen with festive tree and bell patterns - Merry Christmas Bubble Font (YMD402-1) / 18x18 Inch
Pink Merry Christmas linen pillow cover with snowman print for festive sofa decor - Merry Christmas Snowman Bow (YMD402-2) / 18x18 Inch
Pink Christmas linen pillowcase with Ho Ho Ho Santa Claus print for home sofa decor - Skateboarding Santa Claus (YMD402-3) / 18x18 Inch
Pink Nutcracker Christmas linen pillow cover with festive cartoon soldier patterns - Nutcracker Soldiers (YMD402-4) / 18x18 Inch
NewFestive Pink Christmas Pillow Case Polyester Decorative Cushion Cover With Santa Claus Nutcracker Print For Home Sofa Decor
$1.21
No MOQ
Cartoon Fox Cushion Cover Linen Square Nordic Illustration Style Pillowcase Home Decor Autumn Fairytale Theme
Cartoon Fox Cushion Cover Linen Square Nordic Illustration Style Pillowcase Home Decor Autumn Fairytale Theme
like
Find Similar
Detailed close-up of a fox camping illustration printed on a linen square pillowcase - Fox Lakeside Campfire Style (1)
Detailed close-up of linen fabric texture on fox and rabbit fairy tale pillow cover - Starry Sky Moon White Rabbit Style (2)
Detailed texture of linen cushion cover with cartoon orange fox and hot air balloon design - Orange Fox Hot Air Balloon Style (3)
Detail of linen pillowcase featuring cute sleeping pandas on a branch for sofa decor - Little Panda on Branch Style (4)
+16
Cartoon Fox Cushion Cover Linen Square Nordic Illustration Style Pillowcase Home Decor Autumn Fairytale Theme
$1.24
No MOQ
Japanese Style Tufted Chair Cushion Thickened Cotton Linen Square Round Floor Pillow For Dining Office Tatami Home Decor
Japanese Style Tufted Chair Cushion Thickened Cotton Linen Square Round Floor Pillow For Dining Office Tatami Home Decor
like
Find Similar
Quilted round tatami chair cushion in off-white linen with 40cm diameter and 6cm thickness - Diameter 15.7*2.4in / Round
Cream tufted square seat cushion with 9-grid quilting for minimalist home decor - 15.7*15.7*2.4in / Square
Japanese Style Tufted Chair Cushion Thickened Cotton Linen Square Round Floor Pillow For Dining Office Tatami Home Decor
$5.76
No MOQ
 · 
67 sold recently
Cartoon Dinosaur Series Decorative Throw Pillow Cover Soft Short Plush Square Cushion Case For Sofa Living Room Decor Pillowcase
Cartoon Dinosaur Series Decorative Throw Pillow Cover Soft Short Plush Square Cushion Case For Sofa Living Room Decor Pillowcase
like
Find Similar
Cartoon green dinosaur pillowcase in soft plush fabric with blue striped background - Cartoon Green Dino Blue Gray Stripes (款式-1) / 45*45cm Pillowcase
Cartoon dinosaur sofa cushion cover with soft plush fabric and light blue stripes - Red Dino Light Blue Stripes (款式-2) / 45*45cm Pillowcase
Square cartoon dinosaur throw pillow with green dino print on striped plush fabric - Green Dino Star Spots (款式-3) / 45*45cm Pillowcase
Cartoon dinosaur sofa cushion cover in short plush with a cute green crowned dinosaur - Green Dino Crown Gift Box (款式-4) / 45*45cm Pillowcase
+6
NewCartoon Dinosaur Series Decorative Throw Pillow Cover Soft Short Plush Square Cushion Case For Sofa Living Room Decor Pillowcase
$1.15
Mix MOQ : 2
Thickened Flannel Sofa Cushion Anti-Slip Striped Checkerboard Sofa Cover Warm Seat Pad For Living Room Leather Sofa Protector
Thickened Flannel Sofa Cushion Anti-Slip Striped Checkerboard Sofa Cover Warm Seat Pad For Living Room Leather Sofa Protector
like
Find Similar
Thick black corduroy flannel sofa cushion with anti-slip texture on black leather sofa - 60*130CM / Black
Grey striped flannel sofa cushion with quilted square pattern on black leather sofa - 60*130CM / Gray
Thickened brown corduroy sofa cushion with non-slip quilted stripes for living room - 70*210cm / Dark Coffee
+9
NewThickened Flannel Sofa Cushion Anti-Slip Striped Checkerboard Sofa Cover Warm Seat Pad For Living Room Leather Sofa Protector
$23.34-37.03
No MOQ
Retro American Country Linen Cushion Cover Deer Bear Forest Pattern Decorative Pillowcase For Home Sofa Christmas Decor
Retro American Country Linen Cushion Cover Deer Bear Forest Pattern Decorative Pillowcase For Home Sofa Christmas Decor
like
Find Similar
Linen couch cushion cover featuring a vintage deer silhouette and woodland forest theme - Elk Arrow Fresh Air Style
Linen square pillow with black bear silhouette and Great Outdoors text on a gray sofa - Black Bear Plaid Great Outdoors Style
Rustic linen cushion cover with moose silhouette and Seek Wildlife text for home decor - Moose Forest Plaid Seek Wildlife Style
Close-up of linen pillowcase with deer print, plaid patterns, and This is the Life text - Deer Plaid Patchwork This Is The Life Style
+4
Retro American Country Linen Cushion Cover Deer Bear Forest Pattern Decorative Pillowcase For Home Sofa Christmas Decor
$1.24
No MOQ
Autumn Thanksgiving Harvest Linen Pillowcase Pumpkin Truck Maple Leaf Decorative Cushion Cover For Home Decor Living Room
Autumn Thanksgiving Harvest Linen Pillowcase Pumpkin Truck Maple Leaf Decorative Cushion Cover For Home Decor Living Room
like
Find Similar
Fall harvest linen pillow cover featuring Thankful Blessed Grateful pumpkin design - Thankful Blessed Style (YMD207-1)
Linen Autumn Harvest pillowcase featuring pumpkins and gourds for fall home decor - Autumn Harvest Corner Style (YMD207-2)
Linen autumn throw pillow cover with vintage truck pumpkin design and Happy Harvest text - Vintage Truck Pumpkin Style (YMD207-3)
Linen autumn throw pillow cover featuring hello FALL text and maple leaf silhouettes - Hello Fall Style (YMD207-4)
+12
Autumn Thanksgiving Harvest Linen Pillowcase Pumpkin Truck Maple Leaf Decorative Cushion Cover For Home Decor Living Room
-5%
$1.31
Mix MOQ : 2
Easter Linen Cushion Cover Square Decorative Pillowcase Bunny Chick Egg Flower Print Throw Pillow Case For Sofa Home Decor
Easter Linen Cushion Cover Square Decorative Pillowcase Bunny Chick Egg Flower Print Throw Pillow Case For Sofa Home Decor
like
Find Similar
Easter decorative linen pillowcase featuring vintage cross floral pattern and Happy Easter text - Floral Cross Style (1)
Happy Easter linen pillow cover with watercolor bunny and yellow daffodil floral print - Rabbit with Blue Bow & Narcissus Style (2)
Easter decorative linen pillowcase featuring yellow ducks and Happy Easter text on white background - Duckling and Floral Style (3)
Easter flax pillow cover featuring yellow chicks and colorful eggs on white background - Easter Egg and Chick Nest Style (4)
+11
Easter Linen Cushion Cover Square Decorative Pillowcase Bunny Chick Egg Flower Print Throw Pillow Case For Sofa Home Decor
$1.24
No MOQ
Valentine's Day Heart Pattern Cotton Linen Lumbar Pillowcase Romantic Love XOXO Rectangular Cushion Cover For Home Sofa Decor
Valentine's Day Heart Pattern Cotton Linen Lumbar Pillowcase Romantic Love XOXO Rectangular Cushion Cover For Home Sofa Decor
like
Find Similar
Lumbar pillow case with red and black hearts tree design and love xoxo text print - Heart Tree Style (JYZ028-1) / Rectangle
Rectangular linen waist pillowcase featuring red polka dot and plaid heart patterns - Heart Collage Style (JYZ028-2) / Rectangle
Rectangular cream linen lumbar pillow case with romantic multi-style heart love prints - Mixed Hearts Style (JYZ028-3) / Rectangle
Polka dot lumbar pillow cover with red heart and plaid bow for Valentine's Day decor - Bowknot Heart Style (JYZ028-4) / Rectangle
+5
NewValentine's Day Heart Pattern Cotton Linen Lumbar Pillowcase Romantic Love XOXO Rectangular Cushion Cover For Home Sofa Decor
-5%
$1.20
Mix MOQ : 2
Vintage Ethnic Style Short Plush Cushion Cover Village House Floral Pattern Square Decorative Pillowcase For Home Living Room Couch
Vintage Ethnic Style Short Plush Cushion Cover Village House Floral Pattern Square Decorative Pillowcase For Home Living Room Couch
like
Find Similar
Ethnic style cushion cover featuring folk house and floral patterns on a dark blue base - Cover Only
Ethnic vintage style pillowcase featuring 3D textured mountain village landscape design - Colorful Mountain Village Style (CDR06-2) / Cover Only
Ethnic style cushion cover with colorful mountain landscape illustration on white background - Snowy Mountain Landscape Style (CDR06-3) / Cover Only
Ethnic embroidered square pillow case featuring colorful fairy tale garden and cottage design - Blue Cottage Fairy Tale Garden Style (CDR06-4) / Cover Only
+11
Vintage Ethnic Style Short Plush Cushion Cover Village House Floral Pattern Square Decorative Pillowcase For Home Living Room Couch
$1.59
Mix MOQ : 2
Vintage Linen Pillowcase Artistic Pig Pattern Oil Painting Style Square Cushion Cover For Home Sofa Decor Living Room
Vintage Linen Pillowcase Artistic Pig Pattern Oil Painting Style Square Cushion Cover For Home Sofa Decor Living Room
like
Find Similar
Artistic pig oil painting throw pillow with flower crown on a modern gray sofa - Pig with Flower Crown Oil Painting (1)
Artistic oil painting style colorful pig portrait cushion on a modern grey fabric sofa - Vibrant Abstract Pig (2)
Vintage watercolor pig pattern throw pillow in linen fabric on a soft grey sofa - Colorful Watercolor Splatter Pig (3)
Linen cushion cover featuring a colorful artistic graffiti pig print on a beige background - Artistic Graffiti Colorful Pig (4)
+14
Vintage Linen Pillowcase Artistic Pig Pattern Oil Painting Style Square Cushion Cover For Home Sofa Decor Living Room
$1.24
No MOQ
Spring Summer Floral Print Cushion Cover Peach Skin Polyester Square Pillowcase For Sofa Home Decor Modern Minimalist Floral Pattern
Spring Summer Floral Print Cushion Cover Peach Skin Polyester Square Pillowcase For Sofa Home Decor Modern Minimalist Floral Pattern
like
Find Similar
Floral peach skin pillowcase with 'Bless OUR Home' text and colorful striped borders - Drd481-1 / 45*45cm (No Insert)
Floral peach skin pillowcase with colorful stripes and Home Sweet Home print for sofa - Home Sweet Home Style (DRD481-2)
Floral peach skin throw pillow cover with Just Bloom watercolor print for home sofa decor - Drd481-3 / 45*45cm (No Insert)
Floral watercolor peach skin pillowcase with vintage truck design for sofa decor - Retro Truck Floral Style (DRD481-4)
+20
Spring Summer Floral Print Cushion Cover Peach Skin Polyester Square Pillowcase For Sofa Home Decor Modern Minimalist Floral Pattern
$1.27
Mix MOQ : 2
Maneki-neko Lucky Cat Red Pillowcase Soft Short Plush Cushion Cover For New Year Home Decor Square Cushion Cover Case
Maneki-neko Lucky Cat Red Pillowcase Soft Short Plush Cushion Cover For New Year Home Decor Square Cushion Cover Case
like
Find Similar
Red festive pillowcase featuring traditional lucky cat and Daruma dolls patterns - All-over Japanese Print Style / Pillowcase Only
Red square cushion cover with cute lucky cat pattern and New Year traditional symbols - Get Rich Fast Auspicious Style / Pillowcase Only
Square red cushion cover with lucky cat illustration and traditional Chinese patterns - Ten Thousand Blessings Koi Style / Pillowcase Only
Red square Maneki Neko lucky cat throw pillow cover with traditional Chinese New Year motifs - Lucky Cat Cherry Blossom Style / Pillowcase Only
+10
Maneki-neko Lucky Cat Red Pillowcase Soft Short Plush Cushion Cover For New Year Home Decor Square Cushion Cover Case
-4%
$1.62-2.96
Mix MOQ : 2
Bohemian Tufted Cushion Cover With Tassels Geometric Rhombus Sun Pattern Polyester Cotton Throw Pillow Case For Sofa Home
Bohemian Tufted Cushion Cover With Tassels Geometric Rhombus Sun Pattern Polyester Cotton Throw Pillow Case For Sofa Home
like
Find Similar
Rectangular boho pillowcase with mustard yellow tufted sun pattern and fringe tassels - Cushion With Insert
Bohemian cream tufted pillow cover with pink diamond patterns and yellow tassels - Square Yellow Pink Dots (With Insert) / Cushion With Insert
Bohemian off-white pillow cover with yellow tufted geometric patterns and tassels - Cushion With Insert
Nordic tufted throw pillow with grey geometric patterns and tassels in cream beige - Cushion With Insert
+8
Bohemian Tufted Cushion Cover With Tassels Geometric Rhombus Sun Pattern Polyester Cotton Throw Pillow Case For Sofa Home
-5%
$5.20-7.67
Mix MOQ : 2
Modern Peach Skin Decorative Pillowcase Rose Gold Pink Geometric Marble Pattern Square Cushion Cover For Sofa Living Room
Modern Peach Skin Decorative Pillowcase Rose Gold Pink Geometric Marble Pattern Square Cushion Cover For Sofa Living Room
like
Find Similar
Detail of rose gold world map print on pink peach skin fabric decorative pillowcase - Vintage World Map Style (款式-1)
Detailed view of pink geometric peach skin fabric with elegant rose gold metallic lines - Pink Geometric Patchwork Style (款式-2)
Detailed close-up of soft pink peach skin cushion cover with white geometric star patterns - Pink Hand-drawn Lines Style (款式-3)
Detail of square pillowcase with white marble texture and rose gold geometric pattern - Marble Pattern Geometric Line Style (款式-4)
+6
Modern Peach Skin Decorative Pillowcase Rose Gold Pink Geometric Marble Pattern Square Cushion Cover For Sofa Living Room
-5%
$1.04
No MOQ
Modern Abstract Oil Painting Linen Cushion Cover Decorative Square Pillow Case For Sofa Home Decor Floral Cat Pattern
Modern Abstract Oil Painting Linen Cushion Cover Decorative Square Pillow Case For Sofa Home Decor Floral Cat Pattern
like
Find Similar
Detailed texture of linen cushion cover with oil painting floral and vase pattern - Artistic Floral Illustration (YMD48-1) / 45x45cm
Detailed view of square linen pillowcase with tropical flora and fauna art illustration - Tropical Vegetation Bird Illustration (YMD48-2) / 45x45cm
Detailed close-up of linen cushion cover with modern abstract art print of a cat on a chair - Cat Resting on Pink Chair Illustration (YMD48-3) / 45x45cm
Artistic linen pillowcase showing a blue striped vase with orange lilies and floral patterns - Vase Lily and Orange Illustration (YMD48-4) / 45x45cm
+8
Modern Abstract Oil Painting Linen Cushion Cover Decorative Square Pillow Case For Sofa Home Decor Floral Cat Pattern
$1.41
Mix MOQ : 2
Marine Life Ocean Theme Peach Skin Pillow Cover Coastal Nautical Shell Whale Decorative Cushion Case For Sofa Home Decor
Marine Life Ocean Theme Peach Skin Pillow Cover Coastal Nautical Shell Whale Decorative Cushion Case For Sofa Home Decor
like
Find Similar
Blue ocean shell and coral print pillowcase with teal wood grain texture and geometric patterns - Shell Pattern (1)
Blue ocean seashell and starfish theme pillowcase with thick peach skin fabric texture - Starfish Pattern (2)
Blue ocean nautilus nautical decorative pillowcase made of premium peach skin fabric - Nautilus Pattern (3)
Nautical peach skin pillowcase with whale, coral, and teal wood grain background - Whale Pattern (4)
+4
Marine Life Ocean Theme Peach Skin Pillow Cover Coastal Nautical Shell Whale Decorative Cushion Case For Sofa Home Decor
$1.09
No MOQ
Valentine's Day Gnome Heart Pattern Throw Pillow Cover Linen Look Polyester Square Decorative Cushion Case For Sofa Home Decor
Valentine's Day Gnome Heart Pattern Throw Pillow Cover Linen Look Polyester Square Decorative Cushion Case For Sofa Home Decor
like
Find Similar
Linen LOVE Valentine cushion cover with cartoon gnome rainbow and heart pattern - Gnome Rainbow Illustration (YMV19-1)
Macro detail of red linen pillowcase with white FOREVER and black love printed text - Red Heart Forever Love (YMV19-2)
Close-up of red linen Valentine pillow cover with happy valentine art text and heart - Ymv19-3 / 45*45cm (Cover Only)
Linen pillowcase detail featuring a cute gnome with Love You More print and fabric texture - Ymv19-4 / 45*45cm (Cover Only)
Valentine's Day Gnome Heart Pattern Throw Pillow Cover Linen Look Polyester Square Decorative Cushion Case For Sofa Home Decor
$1.38
Mix MOQ : 2
Corduroy Waterproof Sofa Cover Anti-Slip Cushion Protector For Pets Geometric Patchwork Couch Slipcover For Living Room
Corduroy Waterproof Sofa Cover Anti-Slip Cushion Protector For Pets Geometric Patchwork Couch Slipcover For Living Room
like
Find Similar
Waterproof off-white textured sofa cover with durable fabric and dotted edge finish - 70x70 / Beige
Waterproof non-stick cat scratch couch cover in dark brown and beige geometric pattern - 70x70 / Brown
Waterproof gray-white chenille sofa cover with non-slip texture and woven edge trim - 110x210 / Dark Gray
+68
NewCorduroy Waterproof Sofa Cover Anti-Slip Cushion Protector For Pets Geometric Patchwork Couch Slipcover For Living Room
$3.89-25.94
Mix MOQ : 2
Free Shipping
Bohemian Tufted Tassel Cushion Cover Cotton Geometric Pattern Throw Pillowcase Home Sofa Living Room Decor
Bohemian Tufted Tassel Cushion Cover Cotton Geometric Pattern Throw Pillowcase Home Sofa Living Room Decor
like
Find Similar
Bohemian tufted cushion cover with colorful tassels on a woven chair in a cozy home setting - Colorful Geometric Style (2) / With High Elastic Cotton Insert
Boho tufted cotton pillow cover with colorful tassels on a woven seat cushion - Colorful Tassel Style (4) / With High Elastic Cotton Insert
Bohemian tufted cushion cover with red and blue embroidery and colorful corner tassels - Square Tufted Style (1) / With High Elastic Cotton Insert
Bohemian cushion cover featuring colorful geometric tufting and tassel accents - Rhombus Geometric Style (3) / With High Elastic Cotton Insert
+11
Bohemian Tufted Tassel Cushion Cover Cotton Geometric Pattern Throw Pillowcase Home Sofa Living Room Decor
-5%
$9.03-11.64
Mix MOQ : 2
Free Shipping
Checkered Cotton Linen Tablecloth With Tassels Red Blue Striped Rectangle Square Table Cover For Dining Room Kitchen Decor
Checkered Cotton Linen Tablecloth With Tassels Red Blue Striped Rectangle Square Table Cover For Dining Room Kitchen Decor
like
Find Similar
Japanese style red and white striped linen tablecloth with decorative beige tassels - 60*60cm / Red Fine Stripe Linen With Tassel Edge
Nordic navy blue and white striped tablecloth with beige pom pom fringe decoration - 60*60cm / Navy Fine Stripe Linen With Tassel Edge
Classic red and white checkered table cloth with elegant tassel fringe in a home setting - Red Plaid With Tassel Edge / 140*220cm
+24
Checkered Cotton Linen Tablecloth With Tassels Red Blue Striped Rectangle Square Table Cover For Dining Room Kitchen Decor
-5%
$1.37-9.31
No MOQ
Watercolor Floral Landscape Pillowcase Modern Short Plush Cushion Cover For Living Room Sofa Home Decor Square Throw Pillow Case
Watercolor Floral Landscape Pillowcase Modern Short Plush Cushion Cover For Living Room Sofa Home Decor Square Throw Pillow Case
like
Find Similar
Modern square cushion cover featuring artistic watercolor meadow landscape and flowers - 45*45cm Short Plush Single Sided Without Core / Watercolor Meadow Landscape (CDR243-1)
Modern minimalist square throw pillow cover featuring a classic landscape oil painting print - 45*45cm Short Plush Single Sided Without Core / Classic Country House Landscape (CDR243-2)
Modern square pillowcase with green floral pattern and yellow daisies for sofa decor - 45*45cm Short Plush Single Sided Without Core / Field Daisy Pattern (CDR243-3)
Modern minimalist decorative pillow case with watercolor green mountains and yellow wild flowers - 45*45cm Short Plush Single Sided Without Core / Watercolor Mountain Wildflowers (CDR243-4)
+6
Watercolor Floral Landscape Pillowcase Modern Short Plush Cushion Cover For Living Room Sofa Home Decor Square Throw Pillow Case
$1.21
Mix MOQ : 2
Succulent Cactus Pattern Linen Cushion Cover Watercolor Plant Pillowcase For Sofa Home Decor Modern Nordic Decorative Square Throw Pillowcase
Succulent Cactus Pattern Linen Cushion Cover Watercolor Plant Pillowcase For Sofa Home Decor Modern Nordic Decorative Square Throw Pillowcase
like
Find Similar
Close-up of succulent and crystal watercolor print on textured linen pillow cover - Watercolor Succulent Crystal Style (1)
Detail of succulent plant watercolor print on square beige cotton linen pillow cover - Fresh Watercolor Succulent Style (2)
Detail of succulent pattern on beige cotton linen pillowcase placed on a grey sofa - Purple Echeveria Succulent Style (3)
Close-up of linen cushion cover featuring watercolor succulents and pebbles on gray sofa - Succulent Pebble Combo Style (4)
+12
Succulent Cactus Pattern Linen Cushion Cover Watercolor Plant Pillowcase For Sofa Home Decor Modern Nordic Decorative Square Throw Pillowcase
-4%
$1.18
No MOQ
Thanksgiving Pumpkin Maple Leaf Linen Pillowcase Autumn Decorative Cushion Cover For Sofa Living Room Home Decor
Thanksgiving Pumpkin Maple Leaf Linen Pillowcase Autumn Decorative Cushion Cover For Sofa Living Room Home Decor
like
Find Similar
Detail of gather harvest pillow case with pumpkins and maple leaves on leather sofa - 45*45cm Linen Single-Sided No Insert / Pumpkin Puzzle Style (DYM383-1)
Close-up of hello AUTUMN lettering and maple leaf on caramel linen pillow cover - 45*45cm Linen Single-Sided No Insert / Hello Autumn Script (DYM383-2)
Detail of hello FALL orange pillow case texture on white sofa with autumn blanket - 45*45cm Linen Single-Sided No Insert / Hello Fall Pumpkin (DYM383-3)
Detail of Thanksgiving pillow cover with pumpkin and maple leaf patterns on sofa - 45*45cm Linen Single-Sided No Insert / Happy Thanksgiving Design (DYM383-4)
Thanksgiving Pumpkin Maple Leaf Linen Pillowcase Autumn Decorative Cushion Cover For Sofa Living Room Home Decor
$1.21
Mix MOQ : 2
Valentine's Day Buffalo Plaid Pillow Case Polyester Peach Skin Cushion Cover Love Heart Pattern For Sofa Home Decor
Valentine's Day Buffalo Plaid Pillow Case Polyester Peach Skin Cushion Cover Love Heart Pattern For Sofa Home Decor
like
Find Similar
Buffalo plaid pillowcase with Kiss me under the stars text and gold star details - Star Kiss Style (1)
Red and black buffalo plaid pillow cover with I LOVE YOU forever print for Valentine - Love You Forever Style (2)
Red and black buffalo plaid pillow cover with white heart and LOVE never fails print - Love Never Fails Style (3)
Buffalo plaid square pillowcase with I Still Fall For You Everyday print and heart - Fall For You Everyday Style (4)
+26
Valentine's Day Buffalo Plaid Pillow Case Polyester Peach Skin Cushion Cover Love Heart Pattern For Sofa Home Decor
-4%
$1.04
No MOQ
Abstract Fish Pattern Linen Decorative Throw Pillow Case Nordic Style Home Decor Square Cushion Cover For Sofa Couch
Abstract Fish Pattern Linen Decorative Throw Pillow Case Nordic Style Home Decor Square Cushion Cover For Sofa Couch
like
Find Similar
Detailed macro view of green linen cushion cover featuring decorative fish patterns - Green Background Abstract Fish (YMD119-1)
Nordic cartoon hand-painted fish linen square pillow case for sofa and car decor - Off-white Geometric Fish (YMD119-2)
Close-up of linen pillowcase showing natural texture and artistic colorful fish print - Ginger Yellow Artistic Fish (YMD119-3)
Linen decorative pillow cover with stylized fish pattern and More Fish text - Polka Dot Printed Fish (YMD119-4)
Abstract Fish Pattern Linen Decorative Throw Pillow Case Nordic Style Home Decor Square Cushion Cover For Sofa Couch
-4%
$1.34
Mix MOQ : 2
Pastoral Retro Botanical Plant Pattern Rectangular Tablecloth Blended Fabric Dustproof Decorative Table Cover Home Decor
Pastoral Retro Botanical Plant Pattern Rectangular Tablecloth Blended Fabric Dustproof Decorative Table Cover Home Decor
like
Find Similar
French vintage black chenille tablecloth featuring detailed white floral leaf patterns - Black Without Lace Edge / 60x60cm
French vintage dark green tablecloth with white floral patterns for rectangular dining tables - Dark Green Without Lace Edge / 60x60cm
French vintage floral tablecloth in warm brown cotton linen with white floral pattern - Khaki Without Lace Edge / 60x60cm
Modern black and white floral chenille tablecloth with elegant tropical palm leaf pattern - Island Black Without Lace Edge / 60x60cm
+62
Pastoral Retro Botanical Plant Pattern Rectangular Tablecloth Blended Fabric Dustproof Decorative Table Cover Home Decor
-5%
$3.01-18.62
No MOQ
Autumn Harvest Throw Pillow Cover Faux Linen Decorative Cushion Case With Pumpkin Maple Leaf Embroidery Style For Thanksgiving Home Decor Sofa
Autumn Harvest Throw Pillow Cover Faux Linen Decorative Cushion Case With Pumpkin Maple Leaf Embroidery Style For Thanksgiving Home Decor Sofa
like
Find Similar
Linen autumn pillow cover with pumpkin embroidery and Happy Fall text for farmhouse decor - Thanksgiving Pumpkin Style (FP002-1)
Caramel velvet autumn throw pillow cover with maple leaf and acorn embroidery - Caramel Maple Leaf Style (FP002-2)
Caramel linen pillow cover with embroidered squirrel and autumn leaves design - Embroidered Squirrel Style (FP002-3)
Linen pumpkin spice embroidered autumn throw pillow cover for thanksgiving home decor - Fp002-4 / 45*45cm (Single Pillowcase)
+12
Autumn Harvest Throw Pillow Cover Faux Linen Decorative Cushion Case With Pumpkin Maple Leaf Embroidery Style For Thanksgiving Home Decor Sofa
-5%
$1.09
Mix MOQ : 2
Modern Minimalist Geometric Marble Wave Print Pillowcase Peach Skin Polyester Sofa Cushion Cover For Living Room Home Decor
Modern Minimalist Geometric Marble Wave Print Pillowcase Peach Skin Polyester Sofa Cushion Cover For Living Room Home Decor
like
Find Similar
Modern geometric pillow cover with gold gray and black mosaic patterns for sofa - Abstract Geometric Style (DRD43-9) / 45x45CM No Pillow Core
Modern geometric pillowcase featuring black white stripes and bright yellow color block - Striped Color Block Style (DRD43-8) / 45x45CM No Pillow Core
Modern geometric pillow cover with sage green marble pattern and gold accents - Marble Texture Style (DRD43-3) / 45x45CM No Pillow Core
Modern geometric cotton pillow cover with yellow and white panels and chair line art - Modern Chair Line Art Style (DRD43-2) / 45x45CM No Pillow Core
+6
NewModern Minimalist Geometric Marble Wave Print Pillowcase Peach Skin Polyester Sofa Cushion Cover For Living Room Home Decor
-4%
$1.07
Mix MOQ : 2
Go to

More in home & kitchen

Explore more in blanket

sofahomedoubletasselsstarwovengirlslayeredwoolhand
warmdecorativelayerpetholidayshapekidshandmadestylewhite

Ready to source like an insider

Get a direct line to the factory floor — no minimums, no middlemen, no guesswork.
iconReal factory pricing, no markup in betweeniconEvery order hand-inspected before it shipsicon5,000+ new products added daily
Get Inside Access