Everful

Wholesale art posters

Factory-direct selection, vetted for quality and ready to order.

Sign Up
Art Posters

Find the perfect pieces: wall stickers, window stickers, kitchen stickers and more

filterShow Filters
Best Seller
New Arrivals
Price Drop
Free Shipping
Watercolor Cartoon Castle Sun Moon Stars Wall Stickers For Kids Room Nursery Bedroom DIY Removable PVC Art Wall Decal
Watercolor Cartoon Castle Sun Moon Stars Wall Stickers For Kids Room Nursery Bedroom DIY Removable PVC Art Wall Decal
like
Find Similar
Detail view of watercolor castle, moon and stars wall stickers with dimensions - 30*90CM*2PCS Layout
NewWatercolor Cartoon Castle Sun Moon Stars Wall Stickers For Kids Room Nursery Bedroom DIY Removable PVC Art Wall Decal
$2.02
No MOQ
The Best Thing About Memories Is Making Them Wall Decal Creative Quote PVC Removable Home Decor Sticker For Bedroom Office
The Best Thing About Memories Is Making Them Wall Decal Creative Quote PVC Removable Home Decor Sticker For Bedroom Office
like
Find Similar
Detailed size specifications of FX-A181 The Best Memories PVC wall sticker, 58x20cm - Single Style
The Best Thing About Memories Is Making Them Wall Decal Creative Quote PVC Removable Home Decor Sticker For Bedroom Office
$0.84
No MOQ
Nordic Cartoon Deer Horns Flower Wall Sticker Kids Room Bedroom DIY PVC Waterproof Decorative Wall Decal Mural Home Art Decor
Nordic Cartoon Deer Horns Flower Wall Sticker Kids Room Bedroom DIY PVC Waterproof Decorative Wall Decal Mural Home Art Decor
like
Find Similar
1 option
NewNordic Cartoon Deer Horns Flower Wall Sticker Kids Room Bedroom DIY PVC Waterproof Decorative Wall Decal Mural Home Art Decor
$1.38
Mix MOQ : 2
Cartoon Blue Whale Ocean Life Wall Sticker Removable PVC Watercolor Animals Wall Decal For Kids Room Nursery Bedroom Decor
Cartoon Blue Whale Ocean Life Wall Sticker Removable PVC Watercolor Animals Wall Decal For Kids Room Nursery Bedroom Decor
like
Find Similar
Cartoon blue whale ocean wall decal with sea turtles and penguins for home decoration - 30x90cm
Cartoon Blue Whale Ocean Life Wall Sticker Removable PVC Watercolor Animals Wall Decal For Kids Room Nursery Bedroom Decor
$1.35
Mix MOQ : 4
Islamic Mosque Castle Style Light Switch Sticker PVC Waterproof Wall Decal For Living Room Bedroom Middle Eastern Decor
Islamic Mosque Castle Style Light Switch Sticker PVC Waterproof Wall Decal For Living Room Bedroom Middle Eastern Decor
like
Find Similar
Detailed dimension guide for KG428 Middle Eastern mosque wall sticker size 14x12.5cm - 12.5*14CM(KG428)
Islamic Mosque Castle Style Light Switch Sticker PVC Waterproof Wall Decal For Living Room Bedroom Middle Eastern Decor
$0.52
No MOQ
Cartoon Chef Kitchen Wall Sticker Waterproof PVC Bread Pizza Food Decal For Dining Room Restaurant Fridge Home Decor
Cartoon Chef Kitchen Wall Sticker Waterproof PVC Bread Pizza Food Decal For Dining Room Restaurant Fridge Home Decor
like
Find Similar
23pcs Modern PVC Kitchen Wall Stickers Featuring Cartoon Chefs and Food Designs for Decor - Cartoon Chef Style (UV8LCZ90087T_R) / 90*30cm*2pcs
Cartoon Chef Kitchen Wall Sticker Waterproof PVC Bread Pizza Food Decal For Dining Room Restaurant Fridge Home Decor
$3.03
Mix MOQ : 2
Removable PVC Music Notes Staff Pattern Wall Sticker Artistic Music Art Wall Decal For Piano Room Bedroom Living Room Home Decor
Removable PVC Music Notes Staff Pattern Wall Sticker Artistic Music Art Wall Decal For Piano Room Bedroom Living Room Home Decor
like
Find Similar
Detailed dimensions of self-adhesive music notes wall decal in 60x34cm layout - 34x60cm
Removable PVC Music Notes Staff Pattern Wall Sticker Artistic Music Art Wall Decal For Piano Room Bedroom Living Room Home Decor
$0.86
No MOQ
Pastoral Floral Butterfly Flower Basket Wall Stickers Waterproof Removable PVC Art Mural For Home Living Room Bedroom Decor
Pastoral Floral Butterfly Flower Basket Wall Stickers Waterproof Removable PVC Art Mural For Home Living Room Bedroom Decor
like
Find Similar
Detailed 3D rose vine wall stickers with colorful butterflies for living room decor - Ksg-59 (rose Hanging Basket Butterfly)
Detail of floral basket wall decals with colorful roses and butterflies on white background - Flower Basket Grass Butterfly (KSG21)
Waterproof wall stickers featuring yellow rose bouquets and colorful butterflies - Ksy262 (yellow Rose Butterfly)
Detail of waterproof rose flower baskets and colorful butterflies wall decals for home decor - Flower Basket Rose Butterfly (KSG-16)
+9
Pastoral Floral Butterfly Flower Basket Wall Stickers Waterproof Removable PVC Art Mural For Home Living Room Bedroom Decor
-4%
$2.14
No MOQ
Removable PVC Wall Sticker With Blue Gold Moon And Stars Patterns Bohemian Style Artistic Home Decor Wall Decal For Living Room
Removable PVC Wall Sticker With Blue Gold Moon And Stars Patterns Bohemian Style Artistic Home Decor Wall Decal For Living Room
like
Find Similar
Blue moon and stars wall sticker layout showing product size 60cm by 40cm detail - 40*60CM (FX-E321)
Removable PVC Wall Sticker With Blue Gold Moon And Stars Patterns Bohemian Style Artistic Home Decor Wall Decal For Living Room
$1.44
No MOQ
Bohemian Jungle Animal Wall Stickers PVC Waterproof DIY Cartoon Giraffe Lion Decal For Kids Room Nursery Home Decor
Bohemian Jungle Animal Wall Stickers PVC Waterproof DIY Cartoon Giraffe Lion Decal For Kids Room Nursery Home Decor
like
Find Similar
Set of 4 sheets with 41 cartoon animal wall decals including giraffe and lion motifs - Jungle Animal Theme Style (UV24Y10868T_T)
Bohemian Jungle Animal Wall Stickers PVC Waterproof DIY Cartoon Giraffe Lion Decal For Kids Room Nursery Home Decor
$1.79
Mix MOQ : 2
Modern Minimalist Motivational Quote Smile English Slogan Heart Wall Sticker PVC Decorative Decal For Bedroom Office
Modern Minimalist Motivational Quote Smile English Slogan Heart Wall Sticker PVC Decorative Decal For Bedroom Office
like
Find Similar
Detailed dimension layout for WZ9021 inspirational wall sticker with quotes and hearts - 30x59cm/WZ9021
Modern Minimalist Motivational Quote Smile English Slogan Heart Wall Sticker PVC Decorative Decal For Bedroom Office
$1.21
No MOQ
Stay Home Drink Coffee Wall Sticker Removable PVC Coffee Cup Silhouette Art Decal For Kitchen Dining Room Home Decor
Stay Home Drink Coffee Wall Sticker Removable PVC Coffee Cup Silhouette Art Decal For Kitchen Dining Room Home Decor
like
Find Similar
Creative coffee cup wall sticker with Stay Home and Drink Coffee text for home kitchen decor - 25*30cm
Stay Home Drink Coffee Wall Sticker Removable PVC Coffee Cup Silhouette Art Decal For Kitchen Dining Room Home Decor
$0.92
Mix MOQ : 2
Watercolor Cloud Rainbow Wall Sticker Removable PVC Decal For Kids Room Nursery Bedroom Home Decor Minimalist Wall Art
Watercolor Cloud Rainbow Wall Sticker Removable PVC Decal For Kids Room Nursery Bedroom Home Decor Minimalist Wall Art
like
Find Similar
Dreamy watercolor rainbow wall sticker set with clouds and stars for kids rooms - Cloud Rainbow / 30x90 Size
Watercolor Cloud Rainbow Wall Sticker Removable PVC Decal For Kids Room Nursery Bedroom Home Decor Minimalist Wall Art
$1.44
Mix MOQ : 4
Bohemian Large Tree Wall Sticker Watercolor Forest Birds PVC Decal For Living Room Bedroom Removable Botanical Mural Decor
Bohemian Large Tree Wall Sticker Watercolor Forest Birds PVC Decal For Living Room Bedroom Removable Botanical Mural Decor
like
Find Similar
Detailed dimensions of a 125cm watercolor tree wall sticker set with birds and leaves - 90*30cm*3 Sheets / Watercolor Large Tree Style (UV24Y12824T_R)
NewBohemian Large Tree Wall Sticker Watercolor Forest Birds PVC Decal For Living Room Bedroom Removable Botanical Mural Decor
$4.18
Mix MOQ : 2
Creative Multicolored Owl Wall Sticker Mandala Geometric Pattern Flying Owl PVC Wall Decal For Living Room Bedroom Decor
Creative Multicolored Owl Wall Sticker Mandala Geometric Pattern Flying Owl PVC Wall Decal For Living Room Bedroom Decor
like
Find Similar
Colorful owl wall sticker in artistic mosaic style for creative living room decoration - Colorful Flying Owl Style (PH_QTB147)
NewCreative Multicolored Owl Wall Sticker Mandala Geometric Pattern Flying Owl PVC Wall Decal For Living Room Bedroom Decor
$0.72
No MOQ
Romantic I Love You Kissing Couple Silhouette Wall Sticker PVC Waterproof Art Decal For Bedroom Living Room Home Decor
Romantic I Love You Kissing Couple Silhouette Wall Sticker PVC Waterproof Art Decal For Bedroom Living Room Home Decor
like
Find Similar
1 option
Romantic I Love You Kissing Couple Silhouette Wall Sticker PVC Waterproof Art Decal For Bedroom Living Room Home Decor
-4%
$1.37
No MOQ
Watercolor Pink Heart Wall Stickers PVC Self Adhesive Love Heart Decals For Valentine's Day Bedroom Nursery Home Decoration
Watercolor Pink Heart Wall Stickers PVC Self Adhesive Love Heart Decals For Valentine's Day Bedroom Nursery Home Decoration
like
Find Similar
Watercolor pink heart wall decals sheet showing various sizes and dimensions for home decor - 29x29cm
Watercolor Pink Heart Wall Stickers PVC Self Adhesive Love Heart Decals For Valentine's Day Bedroom Nursery Home Decoration
$0.86
No MOQ
Pink Flower Petal Girl Butterfly Wall Sticker Aesthetic Fairy Illustration PVC Self-Adhesive Wall Decal For Kids Room Decor
Pink Flower Petal Girl Butterfly Wall Sticker Aesthetic Fairy Illustration PVC Self-Adhesive Wall Decal For Kids Room Decor
like
Find Similar
Pink floral girl and butterflies wall sticker set showing layout and paste size - Pink Fairy (RA554) / 30-90 (Without Bag)
Pink Flower Petal Girl Butterfly Wall Sticker Aesthetic Fairy Illustration PVC Self-Adhesive Wall Decal For Kids Room Decor
$1.44
Mix MOQ : 4
Motivational Quote Wall Stickers Hope Is Stronger Than Fear PVC Rainbow Decal For Home Bedroom Living Room Decor
Motivational Quote Wall Stickers Hope Is Stronger Than Fear PVC Rainbow Decal For Home Bedroom Living Room Decor
like
Find Similar
Inspirational Hope stronger than fear wall sticker with rainbow and sun design - Motivational Quote Style (HMP6-1632) / Orange
Motivational Quote Wall Stickers Hope Is Stronger Than Fear PVC Rainbow Decal For Home Bedroom Living Room Decor
$1.38
No MOQ
I Love Coffee Heart Pattern Coffee Cup Wall Sticker PVC Waterproof Removable DIY Art Decal For Kitchen Cafe Dining Room
I Love Coffee Heart Pattern Coffee Cup Wall Sticker PVC Waterproof Removable DIY Art Decal For Kitchen Cafe Dining Room
like
Find Similar
1 option
NewI Love Coffee Heart Pattern Coffee Cup Wall Sticker PVC Waterproof Removable DIY Art Decal For Kitchen Cafe Dining Room
-4%
$1.37
No MOQ
Watercolor Cartoon Animal Parachute Wall Stickers Removable PVC Panda Bunny Balloons Kids Room Nursery Decor Kindergarten Decal
Watercolor Cartoon Animal Parachute Wall Stickers Removable PVC Panda Bunny Balloons Kids Room Nursery Decor Kindergarten Decal
like
Find Similar
Detail of cartoon animals on parachutes wall decal with 90x30cm size measurement - 30x90cm / Parachute Bear Bunny (FX-D471)
Watercolor Cartoon Animal Parachute Wall Stickers Removable PVC Panda Bunny Balloons Kids Room Nursery Decor Kindergarten Decal
$1.44
No MOQ
Coffee Theme Creative Wall Sticker Removable PVC Decal Coffee Is Always A Good Idea Lettering Decor For Kitchen Cafe Shop Home
Coffee Theme Creative Wall Sticker Removable PVC Decal Coffee Is Always A Good Idea Lettering Decor For Kitchen Cafe Shop Home
like
Find Similar
Detailed 60x30cm PVC layout of black self-adhesive coffee theme wall sticker with dimensions - 30*60cm Layout
Coffee Theme Creative Wall Sticker Removable PVC Decal Coffee Is Always A Good Idea Lettering Decor For Kitchen Cafe Shop Home
$1.21
No MOQ
Motivational Quote Wall Stickers Colorful Be Kind Alphabet Decals For Kids Room Classroom PVC Waterproof Home Wall Decor
Motivational Quote Wall Stickers Colorful Be Kind Alphabet Decals For Kids Room Classroom PVC Waterproof Home Wall Decor
like
Find Similar
Colorful PVC self-adhesive wall decal with Be Kind quote and cartoon pencil heart icons - Colorful Letter Style (ZC729)
Motivational Quote Wall Stickers Colorful Be Kind Alphabet Decals For Kids Room Classroom PVC Waterproof Home Wall Decor
$1.44
Mix MOQ : 4
Halloween St Patrick's Day Cartoon Animal Wall Stickers Removable PVC Pumpkin Teddy Bear Poodle Wall Decals For Living Room Decor
Halloween St Patrick's Day Cartoon Animal Wall Stickers Removable PVC Pumpkin Teddy Bear Poodle Wall Decals For Living Room Decor
like
Find Similar
Cartoon autumn teddy bear wall sticker in a pumpkin chest for cozy home decoration - Autumn Teddy Bear Treasure Box Style (13P44-C20) / 40cm x 40cm
Halloween wall sticker featuring a brown poodle in a witch basket with pumpkin and bats - Halloween Poodle in Basket Style (13P44-C21) / 40cm x 40cm
Halloween wall sticker featuring a French Bulldog in a suitcase with pumpkins and stars - Halloween French Bulldog Suitcase Style (13P44-C22) / 40cm x 40cm
St. Patrick's Day Bulldog wall decal with green clover basket and hat design - St. Patrick's Day Bulldog in Basket Style (13P44-C23) / 40cm x 40cm
Halloween St Patrick's Day Cartoon Animal Wall Stickers Removable PVC Pumpkin Teddy Bear Poodle Wall Decals For Living Room Decor
$1.01
Mix MOQ : 3
Inspirational Unicorn Quote Wall Decal Removable Black PVC Sticker For Kids Room Bedroom Home Decor Modern Minimalist Art Mural
Inspirational Unicorn Quote Wall Decal Removable Black PVC Sticker For Kids Room Bedroom Home Decor Modern Minimalist Art Mural
like
Find Similar
Unicorn wall decal with inspirational quote in black PVC, size 23x55cm for kids bedroom - KSD8850 (No Bag)
NewInspirational Unicorn Quote Wall Decal Removable Black PVC Sticker For Kids Room Bedroom Home Decor Modern Minimalist Art Mural
$0.86
Mix MOQ : 2
Inspirational English Words Colorful Watercolor Splash Removable PVC Wall Stickers For Kids Room Classroom School Art Wall Decor
Inspirational English Words Colorful Watercolor Splash Removable PVC Wall Stickers For Kids Room Classroom School Art Wall Decor
like
Find Similar
Macro detail of 16 colorful watercolor splash wall stickers with English motivational words - 60*40cm
NewInspirational English Words Colorful Watercolor Splash Removable PVC Wall Stickers For Kids Room Classroom School Art Wall Decor
$1.44
No MOQ
Cartoon Girl And Animals Swing Wall Sticker PVC Self-adhesive Watercolor Sunflower Tree Decals For Kids Bedroom Nursery Decor
Cartoon Girl And Animals Swing Wall Sticker PVC Self-adhesive Watercolor Sunflower Tree Decals For Kids Bedroom Nursery Decor
like
Find Similar
Cartoon girl and animals on swing wall sticker with sunflowers and Happy Time text - 30*90cm (Without Bag)
Cartoon Girl And Animals Swing Wall Sticker PVC Self-adhesive Watercolor Sunflower Tree Decals For Kids Bedroom Nursery Decor
$1.38
Mix MOQ : 4
Starry Sky Flower Fairy Plum Blossom Tree Elk Silhouette Wall Stickers PVC DIY Vinyl Decals For Home Living Room Decor
Starry Sky Flower Fairy Plum Blossom Tree Elk Silhouette Wall Stickers PVC DIY Vinyl Decals For Home Living Room Decor
like
Find Similar
Detailed sheet showing starry deer and cherry blossom tree wall sticker measurements - Flower Fairy Plum Blossom Style (ZY110) / 30*90CM 2 Sheets In Bag
Starry Sky Flower Fairy Plum Blossom Tree Elk Silhouette Wall Stickers PVC DIY Vinyl Decals For Home Living Room Decor
-5%
$1.64
No MOQ
Cartoon Bear With Daisy Wall Sticker For Kids Room Removable PVC Forest Animal Wall Decal For Nursery Bedroom Decoration
Cartoon Bear With Daisy Wall Sticker For Kids Room Removable PVC Forest Animal Wall Decal For Nursery Bedroom Decoration
like
Find Similar
Cartoon brown bear and daisy wall sticker for kids room wall art home decoration - Bear Holding Daisy / 30x90cm (Layout Size)
Cartoon Bear With Daisy Wall Sticker For Kids Room Removable PVC Forest Animal Wall Decal For Nursery Bedroom Decoration
$1.44
Mix MOQ : 4
Romantic Valentine's Day Heart Wall Stickers Red Heart Decals For Bedroom Living Room PVC Self Adhesive DIY Wall Art Decor
Romantic Valentine's Day Heart Wall Stickers Red Heart Decals For Bedroom Living Room PVC Self Adhesive DIY Wall Art Decor
like
Find Similar
Detailed dimensions of red heart wall stickers set for bedroom and home decor - Red Heart Shape (PH_QTB307)
Romantic Valentine's Day Heart Wall Stickers Red Heart Decals For Bedroom Living Room PVC Self Adhesive DIY Wall Art Decor
$0.89
No MOQ
Cute Cartoon Giraffe Wall Stickers PVC Self Adhesive Animal Mural Decal For Kids Room Nursery Bedroom Home Decoration
Cute Cartoon Giraffe Wall Stickers PVC Self Adhesive Animal Mural Decal For Kids Room Nursery Bedroom Home Decoration
like
Find Similar
Detailed view of watercolor giraffe wall sticker set with precise dimension markings - Cartoon Giraffe Style (CT24Y12825T_R) / 60x30cmx2 Sheets
NewCute Cartoon Giraffe Wall Stickers PVC Self Adhesive Animal Mural Decal For Kids Room Nursery Bedroom Home Decoration
$2.26
Mix MOQ : 2
Cute Watercolor Cartoon Animal Wall Stickers For Kids Room Bedroom Decor Lion Elephant Giraffe Star Moon PVC Removable Wall Decals
Cute Watercolor Cartoon Animal Wall Stickers For Kids Room Bedroom Decor Lion Elephant Giraffe Star Moon PVC Removable Wall Decals
like
Find Similar
Detailed view of kids wall stickers showing watercolor animals and layout dimensions - 30x90cm (FX-C379)
NewCute Watercolor Cartoon Animal Wall Stickers For Kids Room Bedroom Decor Lion Elephant Giraffe Star Moon PVC Removable Wall Decals
$2.02
No MOQ
Cartoon Lion Elephant Animal Watercolor Wall Stickers For Kids Room Bedroom Living Room Removable PVC Decorative Mural Art
Cartoon Lion Elephant Animal Watercolor Wall Stickers For Kids Room Bedroom Living Room Removable PVC Decorative Mural Art
like
Find Similar
Received layout size 30x60cm showing wild animal lion and elephant wall stickers - Two Sheets (FX-B386)
Cartoon Lion Elephant Animal Watercolor Wall Stickers For Kids Room Bedroom Living Room Removable PVC Decorative Mural Art
$1.73
No MOQ
Watercolor Sun Wall Sticker Removable PVC Decorative Sun Decal For Kids Bedroom Living Room Modern Minimalist Home Decoration
Watercolor Sun Wall Sticker Removable PVC Decorative Sun Decal For Kids Bedroom Living Room Modern Minimalist Home Decoration
like
Find Similar
Detailed size chart showing product dimensions and paste results for golden sun wall decal - 27*29CM/HY-F421
NewWatercolor Sun Wall Sticker Removable PVC Decorative Sun Decal For Kids Bedroom Living Room Modern Minimalist Home Decoration
$0.92
No MOQ
Romantic Red Rose Wall Sticker PVC Floral Pattern Removable Self Adhesive Wall Decal For Living Room Bedroom Decoration
Romantic Red Rose Wall Sticker PVC Floral Pattern Removable Self Adhesive Wall Decal For Living Room Bedroom Decoration
like
Find Similar
Romantic red rose wall decal stickers for bedroom decor with realistic floral petals - Red Rose (PH-QT867)
Romantic Red Rose Wall Sticker PVC Floral Pattern Removable Self Adhesive Wall Decal For Living Room Bedroom Decoration
-11%
$0.99
No MOQ
Fairy Silhouette Starry Sky Wall Sticker Moon Stars Decor For Bedroom Light Switch Self-Adhesive PVC Decal Home Decoration
Fairy Silhouette Starry Sky Wall Sticker Moon Stars Decor For Bedroom Light Switch Self-Adhesive PVC Decal Home Decoration
like
Find Similar
Blue fairy silhouette starry wall sticker showing paste effect and layout dimensions - 10*15cm*1 Sheet (Without Bag) (HMP6-1615) / Black
NewFairy Silhouette Starry Sky Wall Sticker Moon Stars Decor For Bedroom Light Switch Self-Adhesive PVC Decal Home Decoration
$0.55
Mix MOQ : 12
Creative Girl Back View With Flowers Tutu Dress Wall Sticker Removable PVC Queen Crown Star Decal For Bedroom Decor
Creative Girl Back View With Flowers Tutu Dress Wall Sticker Removable PVC Queen Crown Star Decal For Bedroom Decor
like
Find Similar
Self-adhesive wall sticker product layout showing dimensions 30x90cm with a girl motif - Girl With Bouquet Style (LD93050)
NewCreative Girl Back View With Flowers Tutu Dress Wall Sticker Removable PVC Queen Crown Star Decal For Bedroom Decor
$1.30
No MOQ
Abstract Human Brain Tree Silhouette Wall Sticker Creative Colorful Splatter Art PVC Waterproof Self Adhesive Decal For Home Decor
Abstract Human Brain Tree Silhouette Wall Sticker Creative Colorful Splatter Art PVC Waterproof Self Adhesive Decal For Home Decor
like
Find Similar
Creative abstract brain tree wall sticker with colorful splatter art design for home decor - 30x40cm / Colorful
Abstract Human Brain Tree Silhouette Wall Sticker Creative Colorful Splatter Art PVC Waterproof Self Adhesive Decal For Home Decor
$0.63
Mix MOQ : 4
Boho Rainbow Heart Wall Stickers Removable PVC Morandi Earth Tone Decals For Kids Room Nursery Bedroom Home Wall Decor
Boho Rainbow Heart Wall Stickers Removable PVC Morandi Earth Tone Decals For Kids Room Nursery Bedroom Home Wall Decor
like
Find Similar
Rainbow heart wall decal detail showing finished size and received layout sheet - 37*60cm
Boho Rainbow Heart Wall Stickers Removable PVC Morandi Earth Tone Decals For Kids Room Nursery Bedroom Home Wall Decor
$1.01
No MOQ
Highland Cow Wildflower Wall Sticker PVC Self Adhesive Decor For Dishwasher Kitchen Living Room Bedroom 34x34cm Decor
Highland Cow Wildflower Wall Sticker PVC Self Adhesive Decor For Dishwasher Kitchen Living Room Bedroom 34x34cm Decor
like
Find Similar
Detail view of cartoon highland cow wall sticker showing finished size 34x34cm - 34x34cm (HY-F445)
NewHighland Cow Wildflower Wall Sticker PVC Self Adhesive Decor For Dishwasher Kitchen Living Room Bedroom 34x34cm Decor
$0.86
No MOQ
Cartoon Panda Acrylic Mirror Wall Sticker DIY Self Adhesive Mirror Decorative Decal For Kids Room Bedroom Home Decor
Cartoon Panda Acrylic Mirror Wall Sticker DIY Self Adhesive Mirror Decorative Decal For Kids Room Bedroom Home Decor
like
Find Similar
Cartoon panda acrylic mirror wall sticker in yellow for children's room home decor - Gold (JM555)
Cartoon panda acrylic mirror wall sticker on modern living room wall above a sofa - Silver (JM555)
Cartoon panda DIY acrylic mirror wall sticker in bright red for home decoration - Red (JM555)
Cartoon panda blue acrylic mirror wall sticker for DIY kids room home decoration - Blue (JM555)
+1
Cartoon Panda Acrylic Mirror Wall Sticker DIY Self Adhesive Mirror Decorative Decal For Kids Room Bedroom Home Decor
$1.01
No MOQ
Industrial Retro Chandelier Wall Sticker Removable PVC Waterproof Lamp Pattern Decal For Living Room Bedroom Home Decoration
Industrial Retro Chandelier Wall Sticker Removable PVC Waterproof Lamp Pattern Decal For Living Room Bedroom Home Decoration
like
Find Similar
1 option
NewIndustrial Retro Chandelier Wall Sticker Removable PVC Waterproof Lamp Pattern Decal For Living Room Bedroom Home Decoration
$1.30
No MOQ
Coffee Yes You Maybe English Slogan PVC Wall Sticker Modern Minimalist Humorous Quote Vinyl Wall Decal For Cafe Kitchen Decor
Coffee Yes You Maybe English Slogan PVC Wall Sticker Modern Minimalist Humorous Quote Vinyl Wall Decal For Cafe Kitchen Decor
like
Find Similar
Detailed size chart for Coffee Yes You Maybe self-adhesive minimalist wall sticker - 60cmx20cm (fun-a011)
Coffee Yes You Maybe English Slogan PVC Wall Sticker Modern Minimalist Humorous Quote Vinyl Wall Decal For Cafe Kitchen Decor
$1.01
No MOQ
Watercolor Kitchen Shelf Wall Stickers Herbs Spices Jars Pumpkin Pattern Removable PVC Wall Decal For Restaurant Dining Room
Watercolor Kitchen Shelf Wall Stickers Herbs Spices Jars Pumpkin Pattern Removable PVC Wall Decal For Restaurant Dining Room
like
Find Similar
Kitchen wall decals set with watercolor pumpkins and jars showing paste and layout effect - Watercolor Kitchen Shelf Style (FX7590)
Watercolor Kitchen Shelf Wall Stickers Herbs Spices Jars Pumpkin Pattern Removable PVC Wall Decal For Restaurant Dining Room
$1.59
Mix MOQ : 2
European Style Cartoon Giraffe Wall Stickers Waterproof PVC Removable Rock Cool Animal DIY Wall Decals For Living Room Bedroom Decoration
European Style Cartoon Giraffe Wall Stickers Waterproof PVC Removable Rock Cool Animal DIY Wall Decals For Living Room Bedroom Decoration
like
Find Similar
1 option
European Style Cartoon Giraffe Wall Stickers Waterproof PVC Removable Rock Cool Animal DIY Wall Decals For Living Room Bedroom Decoration
$1.44
No MOQ
Creative Coffee Cup Wall Stickers PVC Wood Grain Lettering Latte Love Coffee Decals For Kitchen Cafe Bar Home Decor
Creative Coffee Cup Wall Stickers PVC Wood Grain Lettering Latte Love Coffee Decals For Kitchen Cafe Bar Home Decor
like
Find Similar
Modern coffee wall stickers with quote lettering and cups for cafe and kitchen decor - 30x30cm
Creative Coffee Cup Wall Stickers PVC Wood Grain Lettering Latte Love Coffee Decals For Kitchen Cafe Bar Home Decor
$0.86
Mix MOQ : 2
Bohemian Watercolor Balloon Wall Stickers PVC Self Adhesive Polka Dots Geometric Nursery Decals For Kids Room Home Decor
Bohemian Watercolor Balloon Wall Stickers PVC Self Adhesive Polka Dots Geometric Nursery Decals For Kids Room Home Decor
like
Find Similar
Detailed set of 4 watercolor hot air balloon and polka dot wall stickers for kids' rooms - Watercolor Balloon Style (CT24Y11666T_T) / 20*30cm*4 Sheets
Modern abstract watercolor PVC wall stickers with geometric shapes for nursery decor - Watercolor Geometric Style (UV24Y12335T_T) / 20*30cm*4 Sheets
Bohemian Watercolor Balloon Wall Stickers PVC Self Adhesive Polka Dots Geometric Nursery Decals For Kids Room Home Decor
$1.73
Mix MOQ : 2
Round Mystical Black Cat Wall Sticker Celestial Gold Geometry PVC Self Adhesive Home Decor Decal For Living Room Bedroom
Round Mystical Black Cat Wall Sticker Celestial Gold Geometry PVC Self Adhesive Home Decor Decal For Living Room Bedroom
like
Find Similar
Detail showing sheet size 29x29cm and finish size of the black cat wall sticker - Mysterious Astrology Black Cat (fun-f500) / 29x29cm
Round Mystical Black Cat Wall Sticker Celestial Gold Geometry PVC Self Adhesive Home Decor Decal For Living Room Bedroom
$0.86
No MOQ
Coffee Time Wall Stickers PVC Waterproof Removable Coffee Cup Decal For Kitchen Dining Room Cafe Home Decor Mural
Coffee Time Wall Stickers PVC Waterproof Removable Coffee Cup Decal For Kitchen Dining Room Cafe Home Decor Mural
like
Find Similar
Minimalist coffee cup wall sticker with flower patterns, 40x30cm DIY kitchen wall decal - Style MS6433
30x30cm PVC wall sticker featuring Time Coffee text and coffee cup icons for kitchen decor - Style MS7602
Coffee Time Wall Stickers PVC Waterproof Removable Coffee Cup Decal For Kitchen Dining Room Cafe Home Decor Mural
$0.95-1.01
Mix MOQ : 2
Inspirational Bible Verse Wall Stickers Butterfly Book Flower Wall Decals For Kids Study Room Bedroom Home Decor Stickers
Inspirational Bible Verse Wall Stickers Butterfly Book Flower Wall Decals For Kids Study Room Bedroom Home Decor Stickers
like
Find Similar
Detail view of floral book and butterfly wall decals with inspirational Bible quotes - 30*90cm*2pcs
NewInspirational Bible Verse Wall Stickers Butterfly Book Flower Wall Decals For Kids Study Room Bedroom Home Decor Stickers
-4%
$1.92
No MOQ
Happy Thanksgiving Day Pumpkin Harvest Basket Wall Sticker PVC Decorative Decal For Kitchen Living Room Home Wall Decor
Happy Thanksgiving Day Pumpkin Harvest Basket Wall Sticker PVC Decorative Decal For Kitchen Living Room Home Wall Decor
like
Find Similar
Thanksgiving harvest wall sticker set with pumpkins and corn in hand-drawn style - Thanksgiving Harvest Basket Style (PH_QTA156)
Happy Thanksgiving Day Pumpkin Harvest Basket Wall Sticker PVC Decorative Decal For Kitchen Living Room Home Wall Decor
$1.07
No MOQ
Halloween Bat Gothic Castle Wall Sticker Removable Black PVC Silhouette Decal For Living Room Home Halloween Party Decorations
Halloween Bat Gothic Castle Wall Sticker Removable Black PVC Silhouette Decal For Living Room Home Halloween Party Decorations
like
Find Similar
1 option
NewHalloween Bat Gothic Castle Wall Sticker Removable Black PVC Silhouette Decal For Living Room Home Halloween Party Decorations
$2.59
No MOQ
Watercolor Colorful Tulip Flower Butterfly Wall Stickers With English Quote Waterproof PVC Wall Decals For Home Decor
Watercolor Colorful Tulip Flower Butterfly Wall Stickers With English Quote Waterproof PVC Wall Decals For Home Decor
like
Find Similar
Detailed size chart for watercolor tulip flower wall stickers measuring 60x40cm - 40*60CM/FX-E239
Watercolor Colorful Tulip Flower Butterfly Wall Stickers With English Quote Waterproof PVC Wall Decals For Home Decor
$1.44
No MOQ
Watercolor Kitchen Utensils Vegetable Wall Sticker PVC Self Adhesive Removable Home Decor For Dining Room Restaurant Wall
Watercolor Kitchen Utensils Vegetable Wall Sticker PVC Self Adhesive Removable Home Decor For Dining Room Restaurant Wall
like
Find Similar
Kitchen wall sticker layout showing sheet size 30x50cm and finished size for home decor - 30*50cm (Item: fun-f927)
Watercolor Kitchen Utensils Vegetable Wall Sticker PVC Self Adhesive Removable Home Decor For Dining Room Restaurant Wall
$1.15
No MOQ
Cartoon Girl Unicorn PVC Wall Sticker Nursery Pink Princess Theme Removable Self Adhesive Decal For Kids Bedroom Decor
Cartoon Girl Unicorn PVC Wall Sticker Nursery Pink Princess Theme Removable Self Adhesive Decal For Kids Bedroom Decor
like
Find Similar
Princess and unicorn wall decal sheet with stars and size dimensions 30x60cm for kids - 30*60cm Layout
Cartoon Girl Unicorn PVC Wall Sticker Nursery Pink Princess Theme Removable Self Adhesive Decal For Kids Bedroom Decor
-4%
$1.15
No MOQ
Cartoon Lucky Cat DIY Wall Stickers PVC Self Adhesive Decals For Shop Window Home Living Room Bedroom Festive Decoration
Cartoon Lucky Cat DIY Wall Stickers PVC Self Adhesive Decals For Shop Window Home Living Room Bedroom Festive Decoration
like
Find Similar
Lucky cat wall decals with traditional kimono styles and Fortune blessing words - Drumming Cat Style (MG6008)
Cartoon lucky cat wall stickers featuring traditional festive clothing and koi flags - Fortune God Cat Style (MG6009)
Chinese New Year cat wall sticker featuring lucky cats and lion dance motifs for windows - Lion Dance Cat Style (MG6010)
Cartoon lucky cat wall sticker with GET RICH text and traditional festive patterns - Auspicious Cloud Cat Style (MG6011)
Cartoon Lucky Cat DIY Wall Stickers PVC Self Adhesive Decals For Shop Window Home Living Room Bedroom Festive Decoration
$1.44
No MOQ
Queen Birthday Wall Sticker Waterproof PVC Fashion Eyelashes Red Lips Gold Crown Art Decal For Bedroom Party Women Decoration
Queen Birthday Wall Sticker Waterproof PVC Fashion Eyelashes Red Lips Gold Crown Art Decal For Bedroom Party Women Decoration
like
Find Similar
Birthday queen wall stickers with crown and red lips design for home decoration - KSC-30 Queen Birthday (30x60cm)
Queen Birthday Wall Sticker Waterproof PVC Fashion Eyelashes Red Lips Gold Crown Art Decal For Bedroom Party Women Decoration
$1.10
No MOQ
Chinese Ink Wash Style Wall Sticker Plum Blossom Sunset Flying Cranes PVC Removable Wall Decal For Living Room Bedroom Home Decor
Chinese Ink Wash Style Wall Sticker Plum Blossom Sunset Flying Cranes PVC Removable Wall Decal For Living Room Bedroom Home Decor
like
Find Similar
Detail showing wall sticker sheet dimensions and finished size for Chinese plum blossom art - 30*90cm(fun-c105)
Chinese Ink Wash Style Wall Sticker Plum Blossom Sunset Flying Cranes PVC Removable Wall Decal For Living Room Bedroom Home Decor
$2.02
No MOQ
Colorful Flower Butterfly Wall Sticker Removable PVC Self Adhesive Floral Decal For Bedroom Living Room Home Decoration
Colorful Flower Butterfly Wall Sticker Removable PVC Self Adhesive Floral Decal For Bedroom Living Room Home Decoration
like
Find Similar
Detail of floral butterfly wall stickers with size layout and application dimensions - 40*100cm(HY-L048)
Colorful Flower Butterfly Wall Sticker Removable PVC Self Adhesive Floral Decal For Bedroom Living Room Home Decoration
$4.61
No MOQ
 · 
10 sold recently
Creative Arch Wall Stickers Bohemian Abstract Geometric Plant Vase Removable PVC Decal For Living Room Home Decoration
Creative Arch Wall Stickers Bohemian Abstract Geometric Plant Vase Removable PVC Decal For Living Room Home Decoration
like
Find Similar
Minimalist plant wall decal with golden arch frame and palm leaf for home decoration - Golden Arch Vase Style (B18603) / 100x45cm
Modern abstract arch wall sticker with sun and green plants for living room decor - Abstract Geometric Bohemian Style (B18613) / 60x30cm
Creative Arch Wall Stickers Bohemian Abstract Geometric Plant Vase Removable PVC Decal For Living Room Home Decoration
$1.18-2.22
Mix MOQ : 2
Go to

More in home & kitchen

Explore more in art posters

wallkidshangingcardsdisplaydesigntasselfacewomanbottle
roomdecorativestylepolyesterheartframelessmagneticsunpartygirl

Ready to source like an insider

Get a direct line to the factory floor — no minimums, no middlemen, no guesswork.
iconReal factory pricing, no markup in betweeniconEvery order hand-inspected before it shipsicon5,000+ new products added daily
Get Inside Access