Everful

Wholesale toe rings

Factory-direct selection, vetted for quality and ready to order.

Sign Up
Toe Rings

Find the perfect pieces: stainless steel rings, copper rings, alloy rings and more

Popular collections in toe rings

All products in toe rings

filterShow Filters
Price Drop
Free Shipping
Best Seller
New Arrivals
Minimalist Titanium Steel Chain Connected Rings For Women Gold Silver Frosted Polished Gothic Stackable Finger Ring Jewelry
Minimalist Titanium Steel Chain Connected Rings For Women Gold Silver Frosted Polished Gothic Stackable Finger Ring Jewelry
like
Find Similar
Gold-plated stainless steel stacked ring set with glitter finish and chain detail - US 6 / Gold
Three-piece silver stainless steel ring set with a fine chain connector and glitter finish - US 6 / Silver
+10
Minimalist Titanium Steel Chain Connected Rings For Women Gold Silver Frosted Polished Gothic Stackable Finger Ring Jewelry
$0.92-1.05
No MOQ
Free Shipping
S925 Sterling Silver Moissanite Couple Rings Adjustable Opening Ring For Men And Women Minimalist Twisted Inlaid Finger Ring Jewelry
S925 Sterling Silver Moissanite Couple Rings Adjustable Opening Ring For Men And Women Minimalist Twisted Inlaid Finger Ring Jewelry
like
Find Similar
Adjustable 925 silver couple rings with twisted design and sparkling zircon stones - Adjustable Open / Drown In Love - Women's
Adjustable 925 sterling silver couple ring with a minimalist spiral twisted metal design - Adjustable Open / Drown In Love - Men's
Detailed view of adjustable S925 sterling silver couple rings with polished wave design - Adjustable Open / Drown In Love - Combo
Close-up of a silver adjustable ring featuring a refined row of pavé set round zircons - Adjustable Open / Rest Of Life - Women's
+8
S925 Sterling Silver Moissanite Couple Rings Adjustable Opening Ring For Men And Women Minimalist Twisted Inlaid Finger Ring Jewelry
$23.58-60.78
No MOQ
Free Shipping
Vintage Viking Celtic Knot Ring Men Titanium Steel Band Retro Nordic Hip Hop Stainless Steel Jewelry Gift Finger Ring
Vintage Viking Celtic Knot Ring Men Titanium Steel Band Retro Nordic Hip Hop Stainless Steel Jewelry Gift Finger Ring
like
Find Similar
Vintage stainless steel ring featuring silver Viking crow and Celtic knot relief patterns - US 7 / Scroll Celtic Knot Style (09308) / Steel
+6
Vintage Viking Celtic Knot Ring Men Titanium Steel Band Retro Nordic Hip Hop Stainless Steel Jewelry Gift Finger Ring
$2.83
No MOQ
 · 
18 sold recently
Free Shipping
Butterfly Flower Crown Heart Ring Brass 18K Gold Plated Zircon Inlaid Adjustable Open Finger Band Fairy Aesthetic Women
Butterfly Flower Crown Heart Ring Brass 18K Gold Plated Zircon Inlaid Adjustable Open Finger Band Fairy Aesthetic Women
like
Find Similar
Elegant gold crown ring with pink marquise zircon and sparkling white crystals - Gold / Crown V-Shape Style (Style 1)
Adjustable gold flower ring with sparkling pink and purple cubic zirconia stones - Gold / Triple Flower Style (Style 2)
Slim gold-plated ring with colorful pavé crystals in a grey velvet jewelry box - Gold / Colorful Eternity Style (Style 3)
Floral butterfly ring in gold finish with pink green and white zircon stones - Gold / Flower Cluster Style (Style 4)
+42
Butterfly Flower Crown Heart Ring Brass 18K Gold Plated Zircon Inlaid Adjustable Open Finger Band Fairy Aesthetic Women
$1.45-1.60
No MOQ
 · 
793 sold recently
Top 3% Best Sellers
in Rings
Free Shipping
Punk Rock Men's Stainless Steel Skull Ring Gothic Skeleton Head Finger Ring For Men Women Black Gold Silver Fashion Jewelry
Punk Rock Men's Stainless Steel Skull Ring Gothic Skeleton Head Finger Ring For Men Women Black Gold Silver Fashion Jewelry
like
Find Similar
Detailed macro view of silver stainless steel skull ring with gothic punk head engraving - US 7 / Steel
Polished gold skull ring for men in stainless steel with a high-shine mirror finish - US 7 / Gold
Gothic skull ring for men in matte black stainless steel with realistic carved details - US 7 / Black
+24
Punk Rock Men's Stainless Steel Skull Ring Gothic Skeleton Head Finger Ring For Men Women Black Gold Silver Fashion Jewelry
-4%
$2.91-3.16
No MOQ
Free Shipping
Men's Retro Stainless Steel Ring Tiger Eye Carved Celtic Knot Pattern Punk Gothic Domineering Band Rings Fashion Jewelry Gift
Men's Retro Stainless Steel Ring Tiger Eye Carved Celtic Knot Pattern Punk Gothic Domineering Band Rings Fashion Jewelry Gift
like
Find Similar
4PCS set of men's vintage titanium steel rings with tiger eye stone and punk engravings - US 7 / Vintage Black Stone Signet and Scroll Pattern Wide Ring Set (SMTZ716)
+6
Men's Retro Stainless Steel Ring Tiger Eye Carved Celtic Knot Pattern Punk Gothic Domineering Band Rings Fashion Jewelry Gift
$5.50
No MOQ
Free Shipping
Bohemian Stainless Steel Turquoise Open Ring For Women Vintage Evil Eye Mandala Sun Pattern Adjustable Retro Jewelry Ring
Bohemian Stainless Steel Turquoise Open Ring For Women Vintage Evil Eye Mandala Sun Pattern Adjustable Retro Jewelry Ring
like
Find Similar
Three-layer golden ring with turquoise stone, 1.3cm width and 3g weight specifications - Triple Layer Band Style (RC-1035G)
Macro shot of turquoise evil eye ring in gold showing diameter and weight measurements - Evil Eye Design Style (RC-1036G)
Detail view of gold turquoise ring with beadwork design showing 1.35cm size dimension - Sun Pattern Design Style (RC-1037G)
Bohemian Stainless Steel Turquoise Open Ring For Women Vintage Evil Eye Mandala Sun Pattern Adjustable Retro Jewelry Ring
$1.05-1.44
No MOQ
Free Shipping
Irregular Hollow Oval Ring Titanium Steel Minimalist Geometric Liquid Metal Style Jewelry For Women Men Unisex Aesthetic
Irregular Hollow Oval Ring Titanium Steel Minimalist Geometric Liquid Metal Style Jewelry For Women Men Unisex Aesthetic
like
Find Similar
Irregular oval geometric hollow ring in silver titanium steel finish for women - US 6 / Large / Steel
Irregular hollow geometric titanium steel ring in silver finish minimalist design - US 6 / Small / Steel
Irregular geometric hollow gold titanium steel ring with size and weight details - US 6 / Small / Gold
Minimalist irregular hollow geometric gold-plated titanium steel ring in 18g weight - US 8 / Large / Gold
+8
Irregular Hollow Oval Ring Titanium Steel Minimalist Geometric Liquid Metal Style Jewelry For Women Men Unisex Aesthetic
$3.94
No MOQ
 · 
667 sold recently
Top 3% Best Sellers
in Rings
Free Shipping
Stainless Steel Teardrop Stone Inlay Adjustable Open Ring For Men Women Minimalist Bohemian Style Retro Ethnic Fashion Jewelry
Stainless Steel Teardrop Stone Inlay Adjustable Open Ring For Men Women Minimalist Bohemian Style Retro Ethnic Fashion Jewelry
like
Find Similar
Detail of adjustable stainless steel ring featuring a pear-shaped turquoise stone - Silver Blue Stone Style (J524-S-DB)
Detail view of a 304 stainless steel ring with a teardrop malachite stone on fabric - Silver Green Stone Style (J524-S-G)
Close-up of adjustable stainless steel ring featuring a teardrop turquoise stone inlay - Silver Light Blue Stone Style (J524-S-LB)
Close-up of a 304 stainless steel ring featuring a teardrop white turquoise stone inlay - Silver White Stone Style (J524-S-W)
+4
Stainless Steel Teardrop Stone Inlay Adjustable Open Ring For Men Women Minimalist Bohemian Style Retro Ethnic Fashion Jewelry
$0.78-1.05
Mix MOQ : 2
Copper Infinity Cross Geometric Open Ring For Women Gold Silver Plated Rhinestone Inlaid Adjustable Fashion Jewelry Ring
Copper Infinity Cross Geometric Open Ring For Women Gold Silver Plated Rhinestone Inlaid Adjustable Fashion Jewelry Ring
like
Find Similar
Detailed close-up of gold-plated infinity cross ring with sparkling zircon stones - Adjustable Open / Gold
Adjustable silver crossover geometric ring with sparkling paved zircon stones - Adjustable Open / Silver
Copper Infinity Cross Geometric Open Ring For Women Gold Silver Plated Rhinestone Inlaid Adjustable Fashion Jewelry Ring
-4%
$1.42
No MOQ
Free Shipping
Multi Layer Spiral Ring Alloy Crystal Rhinestone Statement Jewelry Women Party Geometric Adjustable Finger Jewelry
Multi Layer Spiral Ring Alloy Crystal Rhinestone Statement Jewelry Women Party Geometric Adjustable Finger Jewelry
like
Find Similar
Exaggerated multi-layer gold ring featuring sparkling crystals and a coiled spring design - One Size / White (9805)
Chunky gold-plated multi-layer spiral ring featuring deep blue square and round crystals - One Size / Royal Blue (9805)
Detail of multi-layer gold spiral ring with square black gemstones and crystals - One Size / Black (9805)
Golden multi-layer spiral ring featuring colorful geometric gemstone inlays - One Size / Multicolor (9805)
+11
Multi Layer Spiral Ring Alloy Crystal Rhinestone Statement Jewelry Women Party Geometric Adjustable Finger Jewelry
$1.05
No MOQ
 · 
43 sold recently
Free Shipping
Men's Vintage Punk Wrench Shape Ring Stainless Steel Titanium Steel Industrial Style Rock Biker Polished Band Ring Jewelry
Men's Vintage Punk Wrench Shape Ring Stainless Steel Titanium Steel Industrial Style Rock Biker Polished Band Ring Jewelry
like
Find Similar
6 options
Men's Vintage Punk Wrench Shape Ring Stainless Steel Titanium Steel Industrial Style Rock Biker Polished Band Ring Jewelry
-4%
$2.49
No MOQ
Free Shipping
Minimalist Copper Zirconia Double Layer Wave Open Ring For Women Adjustable Rose Gold Silver Color Fashion Finger Jewelry Accessory Gift
Minimalist Copper Zirconia Double Layer Wave Open Ring For Women Adjustable Rose Gold Silver Color Fashion Finger Jewelry Accessory Gift
like
Find Similar
Macro shot of silver wave ring with pavé-set crystals and polished double layer - Double Layer Wave Geometric Style (J45) / Silver (J45)
Macro detail of silver double-layered crisscross ring with micro-pave white zircons - Intertwined Wrap Style (J287) / Silver (J287)
Macro shot of silver adjustable ring featuring geometric links and sparkling zircon stones - Geometric Rectangle Chain Style (J123) / Silver (J123)
Macro detail of rose gold double-layer chain ring with sparkling pave crystals - Chain Link Style (J123) / Rose Gold (J123)
+14
Minimalist Copper Zirconia Double Layer Wave Open Ring For Women Adjustable Rose Gold Silver Color Fashion Finger Jewelry Accessory Gift
-5%
$0.85-1.77
No MOQ
 · 
19 sold recently
Free Shipping
Vintage Stainless Steel Thorn Vine Branch Ring For Men Women Gothic Punk Style Oxidized Gold Silver Aesthetic Band Jewelry
Vintage Stainless Steel Thorn Vine Branch Ring For Men Women Gothic Punk Style Oxidized Gold Silver Aesthetic Band Jewelry
like
Find Similar
Gothic thorn vine entangled ring in oxidized silver finish with hollow design - US 6 / Steel
Vintage vine textured titanium steel ring in 18K gold finish with naturalist thorn design - US 6 / Gold
+12
Vintage Stainless Steel Thorn Vine Branch Ring For Men Women Gothic Punk Style Oxidized Gold Silver Aesthetic Band Jewelry
-5%
$3.24-3.48
No MOQ
Free Shipping
Minimalist Geometric Heart Finger Rings For Women Trendy Metal Electroplated Accessory Jewelry Gift For Friends
Minimalist Geometric Heart Finger Rings For Women Trendy Metal Electroplated Accessory Jewelry Gift For Friends
like
Find Similar
Three-piece minimalist silver ring set featuring a wide band, thin band, and chain design - Triple Ring Set (J1) / Silver
Minimalist silver geometric rings with chain link and Roman numeral engraved details - Triple Ring Set (J15) / Silver
Set of eight silver minimalist rings featuring wave and bead designs on a white surface - Minimalist Eight Ring Collection (J56) / Silver
Close-up of minimalist silver V-shape and hollow heart ring set on model with soft lighting - Double Ring Set (J72) / Silver
+1
Minimalist Geometric Heart Finger Rings For Women Trendy Metal Electroplated Accessory Jewelry Gift For Friends
-16%
$0.05-0.75
Mix MOQ : 2
 · 
289 sold recently
Vintage Gold Irregular Geometric Lava Line Open Ring Set Minimalist Exaggerated Water Drop Smooth Surface Finger Rings For Women Jewelry
Vintage Gold Irregular Geometric Lava Line Open Ring Set Minimalist Exaggerated Water Drop Smooth Surface Finger Rings For Women Jewelry
like
Find Similar
Set of 6 gold rings featuring irregular lava lines and organic water drop shapes - Gold Lava Irregular Ring Set (XYJZ290)
Vintage Gold Irregular Geometric Lava Line Open Ring Set Minimalist Exaggerated Water Drop Smooth Surface Finger Rings For Women Jewelry
$0.73
No MOQ
Retro Stainless Steel Indian Chief Skull Ring For Men Punk Gothic Skeleton Feather Biker Jewelry Silver Gold Black Rainbow
Retro Stainless Steel Indian Chief Skull Ring For Men Punk Gothic Skeleton Feather Biker Jewelry Silver Gold Black Rainbow
like
Find Similar
Vintage stainless steel skull ring with Indian chief feather headdress in punk style - US 7 / Steel
Vintage gold stainless steel skull ring featuring a detailed Indian chief feather headdress - US 7 / Gold
Matte black gold-plated stainless steel Indian chief skull ring for men with feather details - US 7 / Black
Vintage Indian Chief skull ring in gold and silver punk style stainless steel jewelry - US 7 / Two-tone (Gold & Silver)
+36
Retro Stainless Steel Indian Chief Skull Ring For Men Punk Gothic Skeleton Feather Biker Jewelry Silver Gold Black Rainbow
$2.88-3.14
No MOQ
Free Shipping
Titanium Steel Band Ring For Men Women Beveled Edge Polished Brushed Minimalist Couple Ring Jewelry Gift Non-Fading
Titanium Steel Band Ring For Men Women Beveled Edge Polished Brushed Minimalist Couple Ring Jewelry Gift Non-Fading
like
Find Similar
Brushed stainless steel band ring in silver finish with polished bevelled edges - US 7 / 8mm / Steel Double Beveled Matte
Sleek minimalist purple stainless steel ring with a high-polished mirror finish - US 7 / 8mm / Purple Double Beveled Matte
Sleek 6mm blue polished stainless steel minimalist ring with beveled edges for men - US 7 / 8mm / Blue Double Beveled Matte
Macro view of a matte black smart health ring with sensor detail on satin - US 7 / 6mm / Black Beveled Polished
+154
Titanium Steel Band Ring For Men Women Beveled Edge Polished Brushed Minimalist Couple Ring Jewelry Gift Non-Fading
$0.08-0.50
No MOQ
 · 
177 sold recently
Vintage Stainless Steel Ring For Men Women Black Electroplated Laser Engraved Greek Key Skull Flame Paw Print Jewelry Ring Gift
Vintage Stainless Steel Ring For Men Women Black Electroplated Laser Engraved Greek Key Skull Flame Paw Print Jewelry Ring Gift
like
Find Similar
Macro view of 8mm black stainless steel ring featuring laser engraved grey checkered pattern - US 6 / Checkered Pattern
Detail view of 8mm black stainless steel ring featuring silver Greek meander pattern - US 6 / Greek Key Pattern
8mm black stainless steel ring for men with laser-etched silver paw prints and beveled edges - US 6 / Paw Prints
Macro view of 8mm black stainless steel ring featuring laser etched silver flame patterns - US 6 / Flame
+44
Vintage Stainless Steel Ring For Men Women Black Electroplated Laser Engraved Greek Key Skull Flame Paw Print Jewelry Ring Gift
$0.29
No MOQ
 · 
27 sold recently
Infinity Symbol Ring Sparkling Cubic Zirconia Adjustable Open Finger Ring Fashion Jewelry For Women
Infinity Symbol Ring Sparkling Cubic Zirconia Adjustable Open Finger Ring Fashion Jewelry For Women
like
Find Similar
Minimalist silver infinity ring with pavé set crystals on a sleek adjustable band - Adjustable Open / Silver
Polished S925 sterling silver infinity ring with sparkling pink cubic zirconia stones - Adjustable Open / Silver+Rose Gold
Infinity Symbol Ring Sparkling Cubic Zirconia Adjustable Open Finger Ring Fashion Jewelry For Women
$0.68
Mix MOQ : 2
 · 
516 sold recently
Free Shipping
Vintage Alloy Adjustable Open Ring With Shell Enamel Glaze Zircon For Women Retro INS Style Minimalist Jewelry
Vintage Alloy Adjustable Open Ring With Shell Enamel Glaze Zircon For Women Retro INS Style Minimalist Jewelry
like
Find Similar
Close-up of gold ring with blue and grey checkered enamel pattern on beige fabric - Adjustable Open / Blue Fine Grid Enamel Style
Detail of a gold-plated open ring featuring green and lavender square stones on a display card - Adjustable Open / Green Grey Enamel Style
Close-up of a gold adjustable ring featuring an irregular white gemstone on a card - Adjustable Open / Irregular White Shell Style
Detailed shot of golden open ring with white inlay and sparkling stones on beige fabric - Adjustable Open / Shell Zircon Style
+2
Vintage Alloy Adjustable Open Ring With Shell Enamel Glaze Zircon For Women Retro INS Style Minimalist Jewelry
$0.18-0.29
No MOQ
 · 
542 sold recently
Vintage Stainless Steel Cuban Link Chain Ring For Men Women Antique Silver Distressed Woven Hollow Band Ring Punk Jewelry
Vintage Stainless Steel Cuban Link Chain Ring For Men Women Antique Silver Distressed Woven Hollow Band Ring Punk Jewelry
like
Find Similar
Cuban link chain ring in silver stainless steel with vintage oxidation on black reflection - US 7 / Thin Cuban Link (A款戒指)
Minimalist vintage Cuban link chain ring in oxidized stainless steel with shadow reflection - US 7 / Thick Cuban Link (B款戒指)
+10
NewVintage Stainless Steel Cuban Link Chain Ring For Men Women Antique Silver Distressed Woven Hollow Band Ring Punk Jewelry
-4%
$2.99
No MOQ
 · 
30 sold recently
Free Shipping
Vintage Stainless Steel Bohemian Sunburst Finger Ring Adjustable Open Hammered Texture Inlaid Artificial Stone Jewelry For Men Women
Vintage Stainless Steel Bohemian Sunburst Finger Ring Adjustable Open Hammered Texture Inlaid Artificial Stone Jewelry For Men Women
like
Find Similar
Detailed macro of adjustable silver steel ring featuring turquoise stone and sunburst pattern - Silver Base Turquoise Color Stone (J527-S-DB)
Macro detail of retro stainless steel ring with green malachite and sunburst texture - Silver Base Malachite Green Stone (J527-S-G)
Detailed close-up of adjustable stainless steel ring with turquoise stone and sunburst pattern - Silver Base Light Blue Stone (J527-S-LB)
Detailed macro view of silver steel ring with starburst pattern and marble stone inlay - Silver Base White Marble Texture Stone (J527-S-W)
+6
Vintage Stainless Steel Bohemian Sunburst Finger Ring Adjustable Open Hammered Texture Inlaid Artificial Stone Jewelry For Men Women
$0.78-1.05
Mix MOQ : 2
 · 
46 sold recently
Bohemian Evil Eye Heart Signet Ring Titanium Steel Gold Plated White Enamel Vintage Band For Women Fashion Accessories
Bohemian Evil Eye Heart Signet Ring Titanium Steel Gold Plated White Enamel Vintage Band For Women Fashion Accessories
like
Find Similar
Bohemian heart evil eye ring in 18k gold plated titanium steel with white enamel - US 6 / Gold
Bohemian 18k gold plated heart ring with white oil drip and evil eye motif - US 6 / Steel
+4
Bohemian Evil Eye Heart Signet Ring Titanium Steel Gold Plated White Enamel Vintage Band For Women Fashion Accessories
-5%
$3.43
No MOQ
Free Shipping
Men Stainless Steel Signet Ring Retro Punk Marijuana Leaf Pattern Polished Hip Hop Finger Ring Gold Silver Jewelry Gift
Men Stainless Steel Signet Ring Retro Punk Marijuana Leaf Pattern Polished Hip Hop Finger Ring Gold Silver Jewelry Gift
like
Find Similar
Polished stainless steel men's ring with golden maple leaf relief on black base - US 7 / Two-tone (Gold & Silver)
Polished stainless steel maple leaf ring for men with vintage embossed geometric pattern - US 7 / Steel
+12
Men Stainless Steel Signet Ring Retro Punk Marijuana Leaf Pattern Polished Hip Hop Finger Ring Gold Silver Jewelry Gift
$2.88-3.14
No MOQ
 · 
41 sold recently
Free Shipping
Vintage Owl Head Ring Titanium Stainless Steel Retro Punk Gothic Hip Hop Animal Band Rings For Men Party Jewelry
Vintage Owl Head Ring Titanium Stainless Steel Retro Punk Gothic Hip Hop Animal Band Rings For Men Party Jewelry
like
Find Similar
Vintage punk eagle head ring made of stainless steel with gothic owl feather details - US 7 / Steel
+6
Vintage Owl Head Ring Titanium Stainless Steel Retro Punk Gothic Hip Hop Animal Band Rings For Men Party Jewelry
$2.62
Mix MOQ : 3
Free Shipping
Minimalist Stainless Steel Chain Link Open Ring For Men Women Adjustable Punk Industrial Style Band Finger Ring Jewelry Gift
Minimalist Stainless Steel Chain Link Open Ring For Men Women Adjustable Punk Industrial Style Band Finger Ring Jewelry Gift
like
Find Similar
Polished silver cuban chain style adjustable open ring with a minimalist metallic finish - Steel
Detail view of the interlocking chain link design on the golden adjustable ring - Gold
Macro detail of rainbow iridescent chain link design on an adjustable steel open ring - Colorful
Minimalist Stainless Steel Chain Link Open Ring For Men Women Adjustable Punk Industrial Style Band Finger Ring Jewelry Gift
$0.50-0.78
Mix MOQ : 2
Free Shipping
Fashion Stainless Steel Open Ring For Women Irregular Line Gold Silver Two Tone Metal Ball Geometric Finger Ring Jewelry
Fashion Stainless Steel Open Ring For Women Irregular Line Gold Silver Two Tone Metal Ball Geometric Finger Ring Jewelry
like
Find Similar
Detail shot showing a 1.8cm gold irregular ring with silver bead and 5g weight specs - RC-930GS Style (RC-930GS)
Irregular gold-plated stainless steel open ring with a silver ball detail, weight 5g - RC-931GS Style (RC-931GS)
Detailed view of gold irregular open ring with large silver bead and size specs - RC-862G Style (RC-862G)
Fashion Stainless Steel Open Ring For Women Irregular Line Gold Silver Two Tone Metal Ball Geometric Finger Ring Jewelry
$2.37
No MOQ
 · 
17 sold recently
Free Shipping
Men Retro Punk Titanium Steel Ring With Rectangle Iridescent Rhinestone Polished Gothic Biker Finger Ring Jewelry Gift
Men Retro Punk Titanium Steel Ring With Rectangle Iridescent Rhinestone Polished Gothic Biker Finger Ring Jewelry Gift
like
Find Similar
Vintage punk silver ring for men with a large rectangular colorful gem and zircons - US 7 / Vintage Steel Silver
+6
Men Retro Punk Titanium Steel Ring With Rectangle Iridescent Rhinestone Polished Gothic Biker Finger Ring Jewelry Gift
$3.93
No MOQ
Free Shipping
Vintage Stainless Steel Skull Ring For Men Punk Gothic Rock Biker Jewelry Antique Silver Finished Skeleton Finger Ring
Vintage Stainless Steel Skull Ring For Men Punk Gothic Rock Biker Jewelry Antique Silver Finished Skeleton Finger Ring
like
Find Similar
4 options
Vintage Stainless Steel Skull Ring For Men Punk Gothic Rock Biker Jewelry Antique Silver Finished Skeleton Finger Ring
$2.88
No MOQ
 · 
13 sold recently
Free Shipping
Minimalist Stainless Steel Open Ring Geometric Bypass Design Plain Band Adjustable Fashion Jewelry Finger Ring For Men Women
Minimalist Stainless Steel Open Ring Geometric Bypass Design Plain Band Adjustable Fashion Jewelry Finger Ring For Men Women
like
Find Similar
Minimalist silver geometric open ring with polished finish and adjustable band design - US7 / Steel
Minimalist gold plated stainless steel open ring with flat geometric polished finish - US7 / Gold
Minimalist Stainless Steel Open Ring Geometric Bypass Design Plain Band Adjustable Fashion Jewelry Finger Ring For Men Women
$1.12-1.33
No MOQ
Free Shipping
Minimalist 925 Sterling Silver Irregular Geometric Hollow Open Ring Adjustable Fashion Finger Ring Jewelry For Women
Minimalist 925 Sterling Silver Irregular Geometric Hollow Open Ring Adjustable Fashion Finger Ring Jewelry For Women
like
Find Similar
2 options
Minimalist 925 Sterling Silver Irregular Geometric Hollow Open Ring Adjustable Fashion Finger Ring Jewelry For Women
$29.34
No MOQ
Free Shipping
925 Sterling Silver Royal Blue Pear Cut Water Drop Rhinestone Ring For Women Luxury Wedding Party Fashion Jewelry
925 Sterling Silver Royal Blue Pear Cut Water Drop Rhinestone Ring For Women Luxury Wedding Party Fashion Jewelry
like
Find Similar
925 sterling silver pear cut royal blue ring with marquise halo on blue silk background - US 5 / Royal Blue
+4
925 Sterling Silver Royal Blue Pear Cut Water Drop Rhinestone Ring For Women Luxury Wedding Party Fashion Jewelry
-5%
$52.02
No MOQ
 · 
21 views
Free Shipping
Vintage Punk Gothic Stainless Steel Rings Biker Skull Cross Animal Pattern Heavy Metal Jewelry For Men Women
Vintage Punk Gothic Stainless Steel Rings Biker Skull Cross Animal Pattern Heavy Metal Jewelry For Men Women
like
Find Similar
Macro shot of silver stainless steel ring with radial geometric striped pattern - 25106 / Size 14
Macro view of square signet ring showing black embossed Sons text on a silver gothic band - 24308 / US Size 8
Men's gold stainless steel ring with matte brushed texture and geometric triangle design - 25105 Gold / US Size 8
Close-up of a vintage punk ring featuring a red diamond-shaped face with gold number 13 - 24204-2 Gold / US Size 7
+126
Vintage Punk Gothic Stainless Steel Rings Biker Skull Cross Animal Pattern Heavy Metal Jewelry For Men Women
$3.54-4.16
Mix MOQ : 3
 · 
87 sold recently
Free Shipping
Vintage Distressed Titanium Steel Cross Ring With Celtic Knot Pattern Antique Silver Finish Unisex Gothic Punk Band Jewelry
Vintage Distressed Titanium Steel Cross Ring With Celtic Knot Pattern Antique Silver Finish Unisex Gothic Punk Band Jewelry
like
Find Similar
Macro shot of vintage 304 stainless steel ring with Celtic knot and cross engravings - US 7 / 8mm Cross
Detail of vintage 304 stainless steel cross ring with celtic knot and distressed finish - US 7 / 6mm Cross
+14
Vintage Distressed Titanium Steel Cross Ring With Celtic Knot Pattern Antique Silver Finish Unisex Gothic Punk Band Jewelry
$0.92
No MOQ
 · 
21 sold recently
Free Shipping
Trendy Stainless Steel Cross Signet Ring For Men Women Gothic Punk Rhinestone Inlaid Gold Silver Black Plated Fashion Jewelry Band Ring
Trendy Stainless Steel Cross Signet Ring For Men Women Gothic Punk Rhinestone Inlaid Gold Silver Black Plated Fashion Jewelry Band Ring
like
Find Similar
Men's silver stainless steel signet ring with inlaid cross and white stones on white background - US 6 / Silver
Polished gold signet ring with recessed cross and sparkling white cubic zirconia stones - US 6 / Gold
Men's black stainless steel ring with crystal cross pattern in minimalist matte finish - US 6 / Black
+21
Trendy Stainless Steel Cross Signet Ring For Men Women Gothic Punk Rhinestone Inlaid Gold Silver Black Plated Fashion Jewelry Band Ring
-4%
$2.74-3.24
No MOQ
Free Shipping
Retro Dragon Head Ring Men Titanium Steel Vintage Punk Gothic Biker Ring Antique Silver Tone Animal Jewelry For Men
Retro Dragon Head Ring Men Titanium Steel Vintage Punk Gothic Biker Ring Antique Silver Tone Animal Jewelry For Men
like
Find Similar
7 options
Retro Dragon Head Ring Men Titanium Steel Vintage Punk Gothic Biker Ring Antique Silver Tone Animal Jewelry For Men
-4%
$3.24
No MOQ
Free Shipping
DIY Stainless Steel Ring Blanks With Groove For Inlay Handmade Jewelry Making Grooved Band Rings Unisex Polished Fashion Rings
DIY Stainless Steel Ring Blanks With Groove For Inlay Handmade Jewelry Making Grooved Band Rings Unisex Polished Fashion Rings
like
Find Similar
96 options
DIY Stainless Steel Ring Blanks With Groove For Inlay Handmade Jewelry Making Grooved Band Rings Unisex Polished Fashion Rings
$2.23
No MOQ
 · 
27 sold recently
Free Shipping
Fashion Zinc Alloy Rhinestone Geometric Circle Open Ring Adjustable Gold Plated Statement Rings For Women Jewelry Party
Fashion Zinc Alloy Rhinestone Geometric Circle Open Ring Adjustable Gold Plated Statement Rings For Women Jewelry Party
like
Find Similar
Elegant gold-plated adjustable ring with asymmetric white rhinestones on white background - Adjustable Open / Gold
Fashion Zinc Alloy Rhinestone Geometric Circle Open Ring Adjustable Gold Plated Statement Rings For Women Jewelry Party
$0.65
Mix MOQ : 2
Free Shipping
304 Stainless Steel Ocean Theme Adjustable Ring Minimalist Starfish Seahorse Crab Shell Conch Finger Ring Beach Jewelry
304 Stainless Steel Ocean Theme Adjustable Ring Minimalist Starfish Seahorse Crab Shell Conch Finger Ring Beach Jewelry
like
Find Similar
Silver starfish open ring featuring triple textured starfish with size and weight info - Starfish (J1018-S) / Silver
Adjustable silver seahorse open ring with realistic scale texture and ocean beach style - Seahorse (J1019-S) / Silver
Silver starfish adjustable open ring with textured finish and sea-inspired design - Starfish (J1020-S) / Silver
Silver ocean crab open ring with hollow side patterns and dimensions on white background - Crab (J1021-S) / Silver
+14
304 Stainless Steel Ocean Theme Adjustable Ring Minimalist Starfish Seahorse Crab Shell Conch Finger Ring Beach Jewelry
$0.39-0.68
Mix MOQ : 2
 · 
10 views
Free Shipping
Cute Cat Head Shaped Open Adjustable Ring Alloy Cubic Zirconia Minimalist Finger Jewelry For Women Daily Dating Accessories
Cute Cat Head Shaped Open Adjustable Ring Alloy Cubic Zirconia Minimalist Finger Jewelry For Women Daily Dating Accessories
like
Find Similar
Golden cat-shaped open ring with sparkling white zirconia crystals on soft fabric - Gold
Adjustable silver tone open ring with hollow cat head design and sparkling cubic zirconia - Silver
Cute Cat Head Shaped Open Adjustable Ring Alloy Cubic Zirconia Minimalist Finger Jewelry For Women Daily Dating Accessories
$0.89
Mix MOQ : 2
Free Shipping
Gothic Punk Skull Ring For Men Vintage Titanium Stainless Steel Grim Reaper Rose Octopus Embossed Distressed Jewelry
Gothic Punk Skull Ring For Men Vintage Titanium Stainless Steel Grim Reaper Rose Octopus Embossed Distressed Jewelry
like
Find Similar
Macro detail of Gothic skull and rose relief on vintage silver titanium steel ring - US 10 / Rose Skull
Detailed relief of skull and snake design on a vintage gothic titanium steel ring - US 9 / Octopus Skeleton
Macro shot of gothic reaper and angel embossing on vintage silver steel ring - US 7 / Grim Reaper Skeleton
+15
Gothic Punk Skull Ring For Men Vintage Titanium Stainless Steel Grim Reaper Rose Octopus Embossed Distressed Jewelry
$2.62
No MOQ
 · 
109 sold recently
Top 10% Best Sellers
in Rings
Free Shipping
Minimalist Titanium Steel Ring For Men Women Silver Black Double Groove Stripes Band Ring Wedding Fashion Jewelry
Minimalist Titanium Steel Ring For Men Women Silver Black Double Groove Stripes Band Ring Wedding Fashion Jewelry
like
Find Similar
8mm silver stainless steel men's ring with double black enamel stripes on white background - US 7 / Silver
+7
Minimalist Titanium Steel Ring For Men Women Silver Black Double Groove Stripes Band Ring Wedding Fashion Jewelry
-4%
$0.62
No MOQ
 · 
11 sold recently
Free Shipping
Vintage Octopus Tentacle Dragon Snake Open Adjustable Rings Alloy Gothic Punk Rock Jewelry For Men Women
Vintage Octopus Tentacle Dragon Snake Open Adjustable Rings Alloy Gothic Punk Rock Jewelry For Men Women
like
Find Similar
Close-up of vintage silver ring with engraved auspicious cloud patterns and open band - Golden Hoop Staff
Vintage silver octopus tentacle open ring with detailed suckers in steampunk style - Octopus
Detailed close-up of retro silver dragon claw ring showing scale texture and open band - Eagle Claw
Vintage punk dragon claw ring in silver finish with adjustable open band for men - Four Prong
+14
Vintage Octopus Tentacle Dragon Snake Open Adjustable Rings Alloy Gothic Punk Rock Jewelry For Men Women
$0.05-0.58
No MOQ
 · 
407 sold recently
Top 10% Best Sellers
in Rings
Vintage Stainless Steel Octopus Tentacle Open Ring For Men Retro Punk Gothic Bio Design Polished Antiqued Finish Jewelry Gift
Vintage Stainless Steel Octopus Tentacle Open Ring For Men Retro Punk Gothic Bio Design Polished Antiqued Finish Jewelry Gift
like
Find Similar
Detailed close-up of vintage octopus tentacle ring with realistic suction cup textures - US 7 / Steel
Vintage octopus tentacle open ring in antique gold finish for men with punk style details - US 7 / Gold
+12
Vintage Stainless Steel Octopus Tentacle Open Ring For Men Retro Punk Gothic Bio Design Polished Antiqued Finish Jewelry Gift
$3.80-4.06
Mix MOQ : 3
Free Shipping
S925 Sterling Silver Gradient Pink Heart Eternity Ring For Women Elegant Gold Plated Rhinestone Inlaid Band Finger Ring Jewelry
S925 Sterling Silver Gradient Pink Heart Eternity Ring For Women Elegant Gold Plated Rhinestone Inlaid Band Finger Ring Jewelry
like
Find Similar
Minimalist S925 sterling silver ring with gradient pink heart-shaped gemstones - US Size 6 / Gold
S925 Sterling Silver Gradient Pink Heart Eternity Ring For Women Elegant Gold Plated Rhinestone Inlaid Band Finger Ring Jewelry
$13.05
No MOQ
 · 
13 sold recently
Free Shipping
Minimalist Stainless Steel Multi Layer Open Ring For Women Gold Silver Tone Shell Adjustable Finger Ring Fashion Jewelry
Minimalist Stainless Steel Multi Layer Open Ring For Women Gold Silver Tone Shell Adjustable Finger Ring Fashion Jewelry
like
Find Similar
1 option
Minimalist Stainless Steel Multi Layer Open Ring For Women Gold Silver Tone Shell Adjustable Finger Ring Fashion Jewelry
-5%
$1.44
No MOQ
 · 
12 sold recently
Free Shipping
Stainless Steel Spiral Vortex Ring For Women Minimalist Geometric Adjustable Open Finger Jewelry Gold Silver Plated
Stainless Steel Spiral Vortex Ring For Women Minimalist Geometric Adjustable Open Finger Jewelry Gold Silver Plated
like
Find Similar
Minimalist spiral swirl ring in gold stainless steel finish for a sleek geometric look - Gold Vortex Ring
Silver stainless steel minimalist geometric vortex ring with multiple oval spiral lines - Steel Color Vortex Ring
Stainless Steel Spiral Vortex Ring For Women Minimalist Geometric Adjustable Open Finger Jewelry Gold Silver Plated
$0.45-0.68
No MOQ
 · 
300 sold recently
Top 10% Best Sellers
in Rings
Free Shipping
Women's Korean Style Minimalist Elastic Beaded Ring Silver Color Plastic Beads Blue Rhinestone Pendant Ring For Daily Dating Jewelry
Women's Korean Style Minimalist Elastic Beaded Ring Silver Color Plastic Beads Blue Rhinestone Pendant Ring For Daily Dating Jewelry
like
Find Similar
Blue crystal beaded stretch ring with silver beads and round gemstone pendant for women - Blue Stone Pendant (Silver Beads)
Women's Korean Style Minimalist Elastic Beaded Ring Silver Color Plastic Beads Blue Rhinestone Pendant Ring For Daily Dating Jewelry
-4%
$1.17
No MOQ
Free Shipping
Minimalist Brass Gold Plated Ring For Women Inlaid Round Natural Stone Agate Amethyst Lapis Lazuli Thin Stackable Finger Ring
Minimalist Brass Gold Plated Ring For Women Inlaid Round Natural Stone Agate Amethyst Lapis Lazuli Thin Stackable Finger Ring
like
Find Similar
Close-up of a minimalist gold ring featuring a small round black stone on grey background - US 6 / Black Agate
Close-up of gold plated brass ring featuring a green gemstone in a bezel setting - US 6 / Green Agate
Minimalist gold brass ring with a round purple stone inlay on a grey textured surface - US 7 / Purple Crystal
Close-up of minimalist thin gold-plated ring featuring a small round red agate gemstone - US 7 / Red Agate
+2
Minimalist Brass Gold Plated Ring For Women Inlaid Round Natural Stone Agate Amethyst Lapis Lazuli Thin Stackable Finger Ring
-5%
$2.44
No MOQ
Free Shipping
925 Sterling Silver Minimalist Thin Band Ring For Women Polished Stackable Knuckle Finger Ring Fashion Daily Jewelry
925 Sterling Silver Minimalist Thin Band Ring For Women Polished Stackable Knuckle Finger Ring Fashion Daily Jewelry
like
Find Similar
Minimalist stackable knuckle rings in silver, gold and rose gold with thin smooth bands - US 5 / Gold (1.0)
+31
925 Sterling Silver Minimalist Thin Band Ring For Women Polished Stackable Knuckle Finger Ring Fashion Daily Jewelry
-13%
$3.73-5.23
No MOQ
Free Shipping
Minimalist 925 Sterling Silver Tassel Ring For Women Geometric Bell Beads Dangle Ring Adjustable Fashion Jewelry Daily Accessory Gift
Minimalist 925 Sterling Silver Tassel Ring For Women Geometric Bell Beads Dangle Ring Adjustable Fashion Jewelry Daily Accessory Gift
like
Find Similar
Minimalist S925 sterling silver ring with five dangling bell tassels on blue velvet - US 5 / Silver
S925 sterling silver gold ring featuring textured band and five dangling bell charms - US 5 / Gold
+8
Minimalist 925 Sterling Silver Tassel Ring For Women Geometric Bell Beads Dangle Ring Adjustable Fashion Jewelry Daily Accessory Gift
$29.87
No MOQ
Free Shipping
Retro Biker Skull Ring Stainless Steel Motorcycle Helmet Ride Life Engraved Vintage Punk Jewelry For Men Rock Accessory
Retro Biker Skull Ring Stainless Steel Motorcycle Helmet Ride Life Engraved Vintage Punk Jewelry For Men Rock Accessory
like
Find Similar
Macro detail of vintage skull biker ring with Ride Life engraving and polished steel finish - US Size 8 / Steel
+5
Retro Biker Skull Ring Stainless Steel Motorcycle Helmet Ride Life Engraved Vintage Punk Jewelry For Men Rock Accessory
$3.62
No MOQ
 · 
26 sold recently
Free Shipping
Adjustable Copper Ring Micro Pave Baguette Zirconia Open Finger Ring Luxury Gold Silver Plated Jewelry For Women Party Gift
Adjustable Copper Ring Micro Pave Baguette Zirconia Open Finger Ring Luxury Gold Silver Plated Jewelry For Women Party Gift
like
Find Similar
Adjustable golden open ring with emerald green rectangular zirconia stones inlay - Gold/Green (1)
Gold plated adjustable open ring featuring radiant rectangle purple zircon stones - Gold/Purple (2)
Adjustable gold ring featuring rectangular deep blue zircon stones in a row - Gold/Blue (3)
Adjustable gold open ring featuring a row of emerald green baguette-cut zircons - Gold/Light Green (4)
+18
Adjustable Copper Ring Micro Pave Baguette Zirconia Open Finger Ring Luxury Gold Silver Plated Jewelry For Women Party Gift
$1.39-1.49
No MOQ
 · 
16 sold recently
Free Shipping
Dolphin Pattern Stainless Steel Ring Personalized Animal Band Ring Enamel Drip Oil Fashion Jewelry For Men Women Gift
Dolphin Pattern Stainless Steel Ring Personalized Animal Band Ring Enamel Drip Oil Fashion Jewelry For Men Women Gift
like
Find Similar
Detail of two-tone steel ring featuring a gold leaf pattern and glitter finish - US 7 / Gold with Gold Gear
Polished silver stainless steel ring featuring a dark grey frosted dolphin pattern inlay - US 7 / Silver Base Silver Plate
Silver stainless steel ring with blue glitter inlay and golden dolphin patterns - US 7 / Blue with Gold Gear
Polished stainless steel wide ring with black enamel band and golden dolphin pattern - US 7 / Black Gold
+36
Dolphin Pattern Stainless Steel Ring Personalized Animal Band Ring Enamel Drip Oil Fashion Jewelry For Men Women Gift
-5%
$1.12
Mix MOQ : 10
Free Shipping
Stainless Steel Rotating Spinner Ring With Cuban Chain And Roman Numerals Punk Hip Hop Band For Men Women Fashion Jewelry
Stainless Steel Rotating Spinner Ring With Cuban Chain And Roman Numerals Punk Hip Hop Band For Men Women Fashion Jewelry
like
Find Similar
Gold stainless steel spinner ring with rotatable cuban chain inlay for men - US 5 / Gold Chain Embossed
Polished silver spinner ring with a rotating stainless steel chain and Roman numerals - US 5 / Silver Chain Embossed
Men's matte black rotatable chain ring in stainless steel with knurled edges - US 5 / Black Chain Embossed
Polished stainless steel spinner ring featuring a central rotating Cuban link chain design - US 5 / Steel Color Chain Ring
+193
Stainless Steel Rotating Spinner Ring With Cuban Chain And Roman Numerals Punk Hip Hop Band For Men Women Fashion Jewelry
$0.16-0.49
No MOQ
 · 
44 sold recently
Stainless Steel Ring Patterned Spider Dragon Celtic Knot Punk Band Fashion Jewelry For Men Women Polished
Stainless Steel Ring Patterned Spider Dragon Celtic Knot Punk Band Fashion Jewelry For Men Women Polished
like
Find Similar
Polished silver stainless steel ring with intricate hollowed-out geometric pattern - Silver Base Silver Pattern Celtic Knot / US 6
Golden dragon pattern titanium steel ring with Celtic knot motif and polished finish - Gold Plated Gold Base Gold Dragon / US 6
Polished black stainless steel ring for men featuring a red and black dragon inlay - Black Plated Red Base Black Dragon / US 6
Men's silver titanium steel ring featuring blue stone inlay and gold Celtic dragon pattern - Blue Base Gold Celtic Dragon / US 6
+124
Stainless Steel Ring Patterned Spider Dragon Celtic Knot Punk Band Fashion Jewelry For Men Women Polished
$0.34-0.43
No MOQ
 · 
516 sold recently
Elegant Zircon Butterfly Adjustable Open Rings Copper Luxury Fashion Jewelry Accessories Minimalist Gifts For Women
Elegant Zircon Butterfly Adjustable Open Rings Copper Luxury Fashion Jewelry Accessories Minimalist Gifts For Women
like
Find Similar
Chic 3-piece gold geometric ring set with black square stone on champagne silk fabric - Gold - 3pcs Set Black Gem
Detail of gold double-layer open ring featuring micro-pave cubic zirconia and chain link design - Adjustable Open / Gold - Double Layer Chain Zirconia
Detailed macro view of silver butterfly ring with micro-set zircon on twisted rope band - Adjustable Open / Silver - Bowknot Zirconia
Detailed shot of two gold-plated rings with micro-set zircons and a twisted texture - Adjustable Open Ring Set / Gold - 2pcs Set Pave CZ
+32
Elegant Zircon Butterfly Adjustable Open Rings Copper Luxury Fashion Jewelry Accessories Minimalist Gifts For Women
-86%
$0.35-1.39
No MOQ
 · 
177 sold recently
Free Shipping
Vintage Masonic Freemasonry Stainless Steel Ring For Men Women Square Compass Letter G Band Fashion Religious Jewelry
Vintage Masonic Freemasonry Stainless Steel Ring For Men Women Square Compass Letter G Band Fashion Religious Jewelry
like
Find Similar
Silver stainless steel Freemason ring with gold inlay and G symbol pattern - US 7 / Gold with Gold Gear
Silver stainless steel Freemason ring featuring blue galaxy glitter inlay and golden G symbols - US 7 / Blue with Gold Gear
Men's silver stainless steel Masonic ring with black enamel band and golden G symbols - US 7 / Black Gold
Silver stainless steel Freemason ring with black enamel and G symbol emblem - US 7 / Black with Silver Gear
+28
Vintage Masonic Freemasonry Stainless Steel Ring For Men Women Square Compass Letter G Band Fashion Religious Jewelry
-3%
$0.50
No MOQ
 · 
52 sold recently
Free Shipping
316L Stainless Steel Razor Blade Ring For Men Women Punk Gothic Hollow Out Sawtooth Band Ring Vintage Industrial Jewelry
316L Stainless Steel Razor Blade Ring For Men Women Punk Gothic Hollow Out Sawtooth Band Ring Vintage Industrial Jewelry
like
Find Similar
Gothic silver stainless steel ring featuring unique serrated blade edge design and mirror polish - US 7 / Steel
+6
316L Stainless Steel Razor Blade Ring For Men Women Punk Gothic Hollow Out Sawtooth Band Ring Vintage Industrial Jewelry
-5%
$3.43
No MOQ
Free Shipping
Go to

More in jewelry

Lab-Created Gemstone Jewelry

Explore more in toe rings

openfoot jewelryfingersimplewhiteplasticinlaiddesignbodyplated stainless steel
footgold platedsteelartificialpolishedgirlsgold plated adjustableturquoise18k gold platedcolor ring

Ready to source like an insider

Get a direct line to the factory floor — no minimums, no middlemen, no guesswork.
iconReal factory pricing, no markup in betweeniconEvery order hand-inspected before it shipsicon5,000+ new products added daily
Get Inside Access