Everful

Wholesale toe rings

Factory-direct selection, vetted for quality and ready to order.

Sign Up
Toe Rings

Find the perfect pieces: stainless steel rings, copper rings, alloy rings and more

Popular collections in toe rings

All products in toe rings

filterShow Filters
Price Drop
Free Shipping
Best Seller
New Arrivals
Vintage 925 Sterling Silver Open Adjustable Rings For Women Niche Design Minimalist Retro Elegant Jewelry Gift
Vintage 925 Sterling Silver Open Adjustable Rings For Women Niche Design Minimalist Retro Elegant Jewelry Gift
like
Find Similar
S925 sterling silver open ring with octagonal star engraving and white crystal - JZ0046 Wide-Star
Adjustable S925 sterling silver open ring in brushed metallic finish for women - JZ0146-Frosted Adjustable
Handcrafted 925 silver ring with hammered texture and a round blue gemstone inlay - JZ0273-Hammered Blue Gem
Vintage S925 sterling silver open ring featuring a brushed metallic silver finish for women - JZ1073-Brushed Matte
+112
Vintage 925 Sterling Silver Open Adjustable Rings For Women Niche Design Minimalist Retro Elegant Jewelry Gift
$0.63-2.14
No MOQ
 · 
1K+ sold recently
Top 1% Best Sellers
in Rings
Free Shipping
Vintage Titanium Steel Dice Hexagon Ring For Men Women INS Style Creative Polished Gold Silver Finger Ring Jewelry Gift
Vintage Titanium Steel Dice Hexagon Ring For Men Women INS Style Creative Polished Gold Silver Finger Ring Jewelry Gift
like
Find Similar
Silver hexagonal dice-themed men's titanium steel ring with dot patterns - US 7 / Steel
Gold-plated titanium steel dice ring for men with hexagonal band design - US 7 / Gold
+8
Vintage Titanium Steel Dice Hexagon Ring For Men Women INS Style Creative Polished Gold Silver Finger Ring Jewelry Gift
$3.62-3.88
No MOQ
Free Shipping
Vintage Stainless Steel Lion Head Ring For Men Punk Gothic Animal Relief Biker Ring Hip Hop Domineering Jewelry Accessories
Vintage Stainless Steel Lion Head Ring For Men Punk Gothic Animal Relief Biker Ring Hip Hop Domineering Jewelry Accessories
like
Find Similar
Vintage silver lion head ring in stainless steel with detailed punk gothic relief design - US 8 / Antique Silver
Macro shot of detailed lion head engraving on vintage golden stainless steel ring - US 8 / Gold
+12
Vintage Stainless Steel Lion Head Ring For Men Punk Gothic Animal Relief Biker Ring Hip Hop Domineering Jewelry Accessories
-4%
$2.87-3.24
No MOQ
 · 
12 sold recently
Free Shipping
Irregular Wave Line Stainless Steel Open Ring For Women Gold Plated Two Tone Minimalist Adjustable Fashion Finger Jewelry
Irregular Wave Line Stainless Steel Open Ring For Women Gold Plated Two Tone Minimalist Adjustable Fashion Finger Jewelry
like
Find Similar
Detailed view of gold wavy stainless steel ring with dimensions and material specs - Gold Wave Style (YYR025316-G)
Macro view of two-tone irregular wavy ring showing textured gold and silver finishes - Two-Tone Mixed Wave Style (YYR025316-M)
Irregular Wave Line Stainless Steel Open Ring For Women Gold Plated Two Tone Minimalist Adjustable Fashion Finger Jewelry
$1.41-1.53
No MOQ
 · 
30 sold recently
Free Shipping
Cute Cat Paw Adjustable Open Ring Animal Design Silver Gold Color Fashion Jewelry Accessory For Women Girls
Cute Cat Paw Adjustable Open Ring Animal Design Silver Gold Color Fashion Jewelry Accessory For Women Girls
like
Find Similar
Macro detail of golden brushed cat head ring with green gemstone eyes and tiny diamonds - Adjustable Open / Style 4-Brushed Gold Cat Head with Green Eyes
Polished silver cat-shaped open ring featuring a cute head and tail on wood surface - Adjustable Open / Style 3-Shiny Silver Hugging Cat
Macro shot of polished silver cat paw open ring on finger showing fine detail - Adjustable Open / Style 1-Shiny Silver Cat Paw
Detailed close-up of matte silver open ring featuring a cute cat paw design element - Adjustable Open / Style 2-Matte Silver Cat Paw
+1
Cute Cat Paw Adjustable Open Ring Animal Design Silver Gold Color Fashion Jewelry Accessory For Women Girls
$0.18-0.42
No MOQ
 · 
64 sold recently
Free Shipping
Vintage Alloy Peacock Hollow Adjustable Open Ring For Women Retro Distressed Animal Feather Design Rhinestone Jewelry
Vintage Alloy Peacock Hollow Adjustable Open Ring For Women Retro Distressed Animal Feather Design Rhinestone Jewelry
like
Find Similar
Vintage hollow peacock open ring in retro silver alloy finish with adjustable band size - Silver
Vintage Alloy Peacock Hollow Adjustable Open Ring For Women Retro Distressed Animal Feather Design Rhinestone Jewelry
$0.73
Mix MOQ : 2
 · 
14 sold recently
Gothic Viking Crow Skull Ring For Men Stainless Steel Celtic Knot Raven Head Bone Punk Biker Finger Ring Jewelry Gift
Gothic Viking Crow Skull Ring For Men Stainless Steel Celtic Knot Raven Head Bone Punk Biker Finger Ring Jewelry Gift
like
Find Similar
Vintage silver Viking bird skull ring with Celtic knot patterns in stainless steel - US 7 / Silver
Retro golden viking bird skull ring with intricate celtic knot carvings in punk style - US 7 / Gold
Retro Viking crow skull ring in black stainless steel with Celtic knot engravings - US 7 / Black
+18
Gothic Viking Crow Skull Ring For Men Stainless Steel Celtic Knot Raven Head Bone Punk Biker Finger Ring Jewelry Gift
$3.41-3.67
No MOQ
 · 
14 sold recently
Free Shipping
Vintage Stainless Steel Skull Ring Men Carved Sugar Skull Gothic Punk Jewelry Gift Rock Biker Band Finger Accessories
Vintage Stainless Steel Skull Ring Men Carved Sugar Skull Gothic Punk Jewelry Gift Rock Biker Band Finger Accessories
like
Find Similar
7 options
Vintage Stainless Steel Skull Ring Men Carved Sugar Skull Gothic Punk Jewelry Gift Rock Biker Band Finger Accessories
$2.83
No MOQ
 · 
11 sold recently
Free Shipping
Devil Eye Ring Stainless Steel Gothic Punk Claw Design For Men Evil Eyeball Jewelry Trendy Cool Gift Accessory
Devil Eye Ring Stainless Steel Gothic Punk Claw Design For Men Evil Eyeball Jewelry Trendy Cool Gift Accessory
like
Find Similar
Gothic punk devil eye ring with green eyeball and silver stainless steel claw band - US 7 / Light Green
Gothic silver stainless steel claw ring with a realistic red devil eye on white background - US 13 / Orange Red
Men's titanium steel ring featuring a blue evil eye design with sharp claw accents - US 9 / Steel Base Blue
Pink evil eye stainless steel ring with gothic claw setting design on white background - US 7 / Steel Base Pink
+24
Devil Eye Ring Stainless Steel Gothic Punk Claw Design For Men Evil Eyeball Jewelry Trendy Cool Gift Accessory
-4%
$3.24
No MOQ
 · 
78 sold recently
Free Shipping
Punk Men Titanium Steel Spike Rivet Ring Gothic Hip Hop Conical Spike Polished Band Ring Minimalist Black Silver Jewelry
Punk Men Titanium Steel Spike Rivet Ring Gothic Hip Hop Conical Spike Polished Band Ring Minimalist Black Silver Jewelry
like
Find Similar
Close-up of polished silver titanium steel ring featuring a single sharp punk style spike - US 6 / Silver
Polished black titanium steel ring featuring a punk style spike stud on white background - US 6 / Black
+12
Punk Men Titanium Steel Spike Rivet Ring Gothic Hip Hop Conical Spike Polished Band Ring Minimalist Black Silver Jewelry
-5%
$1.74-1.99
No MOQ
Free Shipping
Minimalist Titanium Steel Geometric Signet Ring For Men Women Polished Plain Square Heart Arched Band Ring Jewelry Accessory
Minimalist Titanium Steel Geometric Signet Ring For Men Women Polished Plain Square Heart Arched Band Ring Jewelry Accessory
like
Find Similar
Polished 18K gold stainless steel signet ring with a geometric 3D V-shaped ridge pattern - US 6 / V-Ridge Square Style (13-B-4) / Gold
Minimalist silver stainless steel ring with 15mm square flat top and diagonal embossed line - US 6 / V-Ridge Square Style (13-B-5) / Silver
Men's matte black stainless steel square signet ring with geometric V-shape design 15mm - US 6 / V-Ridge Square Style (13-B-6) / Black
Minimalist stainless steel signet ring with a polished deep black finish for women - US 6 / Minimalist Smooth Square Style (13-C-7) / Black
+210
Minimalist Titanium Steel Geometric Signet Ring For Men Women Polished Plain Square Heart Arched Band Ring Jewelry Accessory
$1.02-1.40
No MOQ
 · 
16 sold recently
Free Shipping
Vintage Luminous Crown Stainless Steel Ring Glow In The Dark Punk Jewelry Fashion Band For Men Women Daily Accessories
Vintage Luminous Crown Stainless Steel Ring Glow In The Dark Punk Jewelry Fashion Band For Men Women Daily Accessories
like
Find Similar
Close-up of luminous crown pattern embossed on a vintage stainless steel band ring - US 6 / Silver + Luminous Gold
Detailed side view of glowing crown ring in silver stainless steel with luminous inlay - US 6 / Silver + Luminous Silver
Detailed macro view of a luminous crown ring with black and gold stainless steel finish - US 6 / Black Plated + Luminous Gold
Detailed close-up of crown pattern on stainless steel ring with black enamel finish - US 6 / Silver + Black Inlay
+28
Vintage Luminous Crown Stainless Steel Ring Glow In The Dark Punk Jewelry Fashion Band For Men Women Daily Accessories
$0.65
No MOQ
 · 
28 sold recently
Free Shipping
Minimalist Titanium Steel Band Ring For Men Women High Polished Contrast Color Epoxy Inlay Trendy Party Jewelry Finger Ring
Minimalist Titanium Steel Band Ring For Men Women High Polished Contrast Color Epoxy Inlay Trendy Party Jewelry Finger Ring
like
Find Similar
14 options
Minimalist Titanium Steel Band Ring For Men Women High Polished Contrast Color Epoxy Inlay Trendy Party Jewelry Finger Ring
$1.83
No MOQ
 · 
24 sold recently
Free Shipping
Handmade Dried Flower Resin Adjustable Ring For Women Silver Plated Shell Fragment Vintage Style Jewelry Botanical Gift
Handmade Dried Flower Resin Adjustable Ring For Women Silver Plated Shell Fragment Vintage Style Jewelry Botanical Gift
like
Find Similar
Handmade adjustable ring with colorful dried flower resin cabochon and silver metal base - Yellow and Red Dried Flowers (Type A)
Detailed macro view of handmade resin ring with white dried flowers and blue oval center - Blue and White Dried Flowers (Type B)
Detailed close-up of a handmade adjustable resin ring with purple dried flowers - Purple Pink and White Dried Flowers (Type C)
Macro shot of handmade resin ring with real green dried flowers and silver band - Green Dried Flowers (Type D)
+2
Handmade Dried Flower Resin Adjustable Ring For Women Silver Plated Shell Fragment Vintage Style Jewelry Botanical Gift
$3.80
Mix MOQ : 2
 · 
15 sold recently
Free Shipping
Minimalist Titanium Steel Thin Gear Embossed Ring For Women Fashion Diamond Cut Texture Band Rose Gold Silver Finger Jewelry
Minimalist Titanium Steel Thin Gear Embossed Ring For Women Fashion Diamond Cut Texture Band Rose Gold Silver Finger Jewelry
like
Find Similar
Minimalist silver textured ring with diamond-cut gear engraving for women's fashion - US 6 / Silver
Minimalist rose gold ring with hammered texture in an ultra-slim elegant design - US 6 / Rose Gold
Minimalist gold-plated slim ring featuring diamond-cut texture and elegant gear embossing - US 5 / Gold
+15
Minimalist Titanium Steel Thin Gear Embossed Ring For Women Fashion Diamond Cut Texture Band Rose Gold Silver Finger Jewelry
-5%
$0.75-0.87
No MOQ
 · 
15 sold recently
Free Shipping
Minimalist Stainless Steel Heart Ring Hollow Out Double Heart Design For Women Fashion Jewelry Daily Accessory Gift
Minimalist Stainless Steel Heart Ring Hollow Out Double Heart Design For Women Fashion Jewelry Daily Accessory Gift
like
Find Similar
Detail showing two interlocking hollow heart shapes on a 2mm gold minimalist ring - US 6 / Gold
Minimalist black heart-shaped ring with 2mm band width shown on a white background - US 6 / Black
Minimalist silver heart-shaped open ring with 2mm band width on white background - US 6 / Silver
+18
Minimalist Stainless Steel Heart Ring Hollow Out Double Heart Design For Women Fashion Jewelry Daily Accessory Gift
$0.52-0.60
No MOQ
 · 
140 sold recently
Top 10% Best Sellers
in Rings
Vintage Nordic Viking Rune Stainless Steel Ring For Men Black Silver Engraved Runic Totem Band Ring Polished Jewelry Gift
Vintage Nordic Viking Rune Stainless Steel Ring For Men Black Silver Engraved Runic Totem Band Ring Polished Jewelry Gift
like
Find Similar
Men's black stainless steel Viking ring with white Nordic Rune totem engraving - US 6 / Black
Silver stainless steel Viking ring with black engraved Nordic runes and polished finish - US 6 / Silver
+14
Vintage Nordic Viking Rune Stainless Steel Ring For Men Black Silver Engraved Runic Totem Band Ring Polished Jewelry Gift
$0.84
No MOQ
 · 
17 sold recently
Free Shipping
Leopard Print Flower Open Ring Stainless Steel Resin Amber Retro Light Luxury Adjustable Finger Ring For Women Fashion Jewelry
Leopard Print Flower Open Ring Stainless Steel Resin Amber Retro Light Luxury Adjustable Finger Ring For Women Fashion Jewelry
like
Find Similar
Macro shot of leopard print resin flower ring with golden beads on white stone surface - Leopard Flower Style A (S-R912-A)
Elegant resin leopard print flower ring with gold beads on a white textured surface - Leopard Flower Style B (S-R912-B)
Macro view of leopard floral resin ring with 5.4cm diameter and adjustable gold band - Leopard Flower Style D (S-R912-D)
Vintage leopard print resin flower ring with golden metal base on a stone texture - Leopard Flower Style E (S-R912-E)
Leopard Print Flower Open Ring Stainless Steel Resin Amber Retro Light Luxury Adjustable Finger Ring For Women Fashion Jewelry
-4%
$1.94
No MOQ
 · 
15 views
Free Shipping
Minimalist Titanium Steel Open Ring Adjustable INS Style Geometric Ball Spike Cone Ring For Men Women Fashion Jewelry Gift
Minimalist Titanium Steel Open Ring Adjustable INS Style Geometric Ball Spike Cone Ring For Men Women Fashion Jewelry Gift
like
Find Similar
6 options
Minimalist Titanium Steel Open Ring Adjustable INS Style Geometric Ball Spike Cone Ring For Men Women Fashion Jewelry Gift
$3.41
No MOQ
Free Shipping
Minimalist Stainless Steel Rectangle Signet Ring For Men Women Vintage Oxidized Polished Titanium Steel Geometric Statement Ring
Minimalist Stainless Steel Rectangle Signet Ring For Men Women Vintage Oxidized Polished Titanium Steel Geometric Statement Ring
like
Find Similar
Macro view showing the glossy gold rectangular signet ring with high polished finish - US 7 / Gold
Minimalist matte black rectangular signet ring made of titanium steel in vintage style - US 7 / Black
Vintage oxidized titanium steel rectangular signet ring for men with industrial matte finish - US 7 / Antique Silver
Polished stainless steel rectangular signet ring for men in a minimalist vintage style - US 7 / Steel
+20
Minimalist Stainless Steel Rectangle Signet Ring For Men Women Vintage Oxidized Polished Titanium Steel Geometric Statement Ring
$2.75-3.14
No MOQ
 · 
17 sold recently
Free Shipping
Vintage Stainless Steel Crown Ring For Men Women Gothic Cross Fleur De Lis Rhinestone Inlaid Retro Punk Party Jewelry Band Ring
Vintage Stainless Steel Crown Ring For Men Women Gothic Cross Fleur De Lis Rhinestone Inlaid Retro Punk Party Jewelry Band Ring
like
Find Similar
Silver crown ring with ruby stones featuring cross and fleur-de-lis gothic patterns - US 7 / Steel Red Zircon
Vintage crown ring with black gemstones, cross and fleur-de-lis motifs in silver finish - US 7 / Steel Color Black Zircon
Detailed view of vintage silver crown ring featuring blue gems and cross cutout patterns - US 7 / Steel Dark Blue Zirconia
Silver crown ring with cross and iris patterns and light blue gemstones on white background - US 7 / Silver Light Blue Zirconia
+60
Vintage Stainless Steel Crown Ring For Men Women Gothic Cross Fleur De Lis Rhinestone Inlaid Retro Punk Party Jewelry Band Ring
-4%
$2.74
No MOQ
 · 
1 reviews
Free Shipping
Minimalist Wave Shape Stainless Steel Ring Geometric High Polish Stacking Band Jewelry For Women Men Simple Elegant Non-Tarnish
Minimalist Wave Shape Stainless Steel Ring Geometric High Polish Stacking Band Jewelry For Women Men Simple Elegant Non-Tarnish
like
Find Similar
Detail view of 2mm wavy stainless steel ring in gold finish with 1g lightweight design - US 5 / Gold
Minimalist 2mm silver wavy stainless steel band ring available in sizes 5 to 10 - US 5 / Steel
Minimalist 2mm wavy stainless steel ring with polished rose gold finish in size 5 to 10 - US 5 / Rose Gold
+15
Minimalist Wave Shape Stainless Steel Ring Geometric High Polish Stacking Band Jewelry For Women Men Simple Elegant Non-Tarnish
$0.53-0.72
No MOQ
 · 
1K+ sold recently
Top 5% Best Sellers
in Rings
Free Shipping
Vintage Stainless Steel Flower Adjustable Open Ring For Women Hollow Geometric Two Tone Electroplated Fashion Jewelry Everyday Accessory
Vintage Stainless Steel Flower Adjustable Open Ring For Women Hollow Geometric Two Tone Electroplated Fashion Jewelry Everyday Accessory
like
Find Similar
Detail of adjustable cutout flower ring with artistic shadow and waterproof steel texture - Gold Flower Style (JDRW2409031)
Adjustable stainless steel ring with two-tone hollow flower design in gold and silver - Gold and Silver Two-Tone Flower Style (JDRW2409031-PS)
Vintage Stainless Steel Flower Adjustable Open Ring For Women Hollow Geometric Two Tone Electroplated Fashion Jewelry Everyday Accessory
$2.24
No MOQ
 · 
14 views
Free Shipping
Gothic Monster Fang Stainless Steel Ring For Men Retro Punk Titanium Steel Vampire Teeth Band Ring Personality Jewelry Gift
Gothic Monster Fang Stainless Steel Ring For Men Retro Punk Titanium Steel Vampire Teeth Band Ring Personality Jewelry Gift
like
Find Similar
6 options
Gothic Monster Fang Stainless Steel Ring For Men Retro Punk Titanium Steel Vampire Teeth Band Ring Personality Jewelry Gift
$3.14
No MOQ
Free Shipping
Minimalist Titanium Steel Frosted Ring For Women Simple Gold Rose Gold Silver Band Ring Fashion Commute Jewelry Thin 素圈
Minimalist Titanium Steel Frosted Ring For Women Simple Gold Rose Gold Silver Band Ring Fashion Commute Jewelry Thin 素圈
like
Find Similar
Simple women's titanium steel ring with elegant frosted finish in silver tone. - Size 5 / 2mm / Steel
Minimalist rose gold titanium steel ring with an elegant frosted finish for daily wear - Size 5 / 2mm / Gold
Minimalist rose gold titanium steel ring with a frosted sandblasted finish for women. - Size 5 / 2mm / Rose Gold
+18
Minimalist Titanium Steel Frosted Ring For Women Simple Gold Rose Gold Silver Band Ring Fashion Commute Jewelry Thin 素圈
$0.32-0.47
No MOQ
 · 
865 sold recently
Free Shipping
Luxurious Copper Heart Bowknot Adjustable Open Ring For Women Elegant Rhinestone Geometric Crown Star Moon Fashion Jewelry
Luxurious Copper Heart Bowknot Adjustable Open Ring For Women Elegant Rhinestone Geometric Crown Star Moon Fashion Jewelry
like
Find Similar
Detail of rose gold double layer crown ring with pink heart stone on brown silk - Rose Gold Crown Style (23938)
Close-up of double-layered silver ring with colorful zircon stones on brown silk - Silver Double Layer Blue Main Stone (23939)
Macro shot of gold-plated two-piece ring set with opal stone and delicate V-shaped band - Champagne Gold Opal Look Stone (23940)
Macro detail of silver ring set featuring opal center stone and micro-pave crystals - Silver Hollow Out Vintage Style (23941)
+10
Luxurious Copper Heart Bowknot Adjustable Open Ring For Women Elegant Rhinestone Geometric Crown Star Moon Fashion Jewelry
$1.62-2.25
No MOQ
 · 
16 views
Free Shipping
Vintage Bohemian Alloy Gold Plated Enamel Evil Eye Open Adjustable Ring For Women Jewelry Gift Colorful Star Ring
Vintage Bohemian Alloy Gold Plated Enamel Evil Eye Open Adjustable Ring For Women Jewelry Gift Colorful Star Ring
like
Find Similar
Macro shot of gold-plated adjustable ring featuring colorful enamel star charms - Adjustable Open / Colorful Star Style
Golden open evil eye ring with five blue enamel motifs on a white textured stone base - Adjustable Open / Sky Blue Eye Style
Golden open adjustable ring featuring five red enamel evil eye charms on rock background - Adjustable Open / Red Eye Style
Detailed close-up of gold alloy evil eye rings featuring blue enamel inlay on a stone stand - Adjustable Open / White Eye Style
+3
Vintage Bohemian Alloy Gold Plated Enamel Evil Eye Open Adjustable Ring For Women Jewelry Gift Colorful Star Ring
$0.42
Mix MOQ : 5
Free Shipping
French Minimalist 18K Gold Plated Stainless Steel Thin Ring For Women Geometric Twist Woven Checkered Texture Finger Ring Jewelry
French Minimalist 18K Gold Plated Stainless Steel Thin Ring For Women Geometric Twist Woven Checkered Texture Finger Ring Jewelry
like
Find Similar
Macro shot of 18K gold plated ring featuring textured geometric pattern on a velvet box - US 7 / Plaid Style / Gold
Minimalist 18K gold plated twisted rope ring for women on a beige jewelry box display - US 7 / Woven Style / Gold
+6
French Minimalist 18K Gold Plated Stainless Steel Thin Ring For Women Geometric Twist Woven Checkered Texture Finger Ring Jewelry
$1.52-1.78
No MOQ
 · 
37 sold recently
Free Shipping
Minimalist Stainless Steel Freshwater Pearl Ring For Women Men Gold Silver Plated Linear Pearl Finger Ring Fashion Jewelry Gift
Minimalist Stainless Steel Freshwater Pearl Ring For Women Men Gold Silver Plated Linear Pearl Finger Ring Fashion Jewelry Gift
like
Find Similar
Minimalist 18K gold plated stainless steel ring with five natural freshwater pearls - US 8 (57mm) / Gold
Size chart for stainless steel rings with freshwater pearl details and silver finish - US 8 (57mm) / Steel
+8
Minimalist Stainless Steel Freshwater Pearl Ring For Women Men Gold Silver Plated Linear Pearl Finger Ring Fashion Jewelry Gift
-5%
$2.31-2.41
No MOQ
 · 
15 sold recently
Free Shipping
Retro Punk Alloy Dragon Claw Eagle Claw Ring For Men Vintage Gothic Animal Open Adjustable Ring Jewelry Gift
Retro Punk Alloy Dragon Claw Eagle Claw Ring For Men Vintage Gothic Animal Open Adjustable Ring Jewelry Gift
like
Find Similar
Vintage punk dragon claw ring in stainless steel with detailed scale texture on white background - Eagle Claw
Detailed close-up of antique silver wolf head ring with vintage punk aesthetic carvings - Wolf Head
Vintage guitar style biomechanical men's ring in antique silver punk finish - Guitar
Detailed close-up of antique silver snake ring with textured scales and geometric head design - Silver Snake
+14
Retro Punk Alloy Dragon Claw Eagle Claw Ring For Men Vintage Gothic Animal Open Adjustable Ring Jewelry Gift
$0.05-0.58
No MOQ
 · 
51 sold recently
Vintage Stainless Steel Open Ring For Women Gold Plated Adjustable Band With Artificial Pearl Elegant Fashion Finger Jewelry Gift
Vintage Stainless Steel Open Ring For Women Gold Plated Adjustable Band With Artificial Pearl Elegant Fashion Finger Jewelry Gift
like
Find Similar
1 option
Vintage Stainless Steel Open Ring For Women Gold Plated Adjustable Band With Artificial Pearl Elegant Fashion Finger Jewelry Gift
-10%
$1.06
No MOQ
 · 
124 sold recently
Free Shipping
Luxury Stainless Steel Wing Open Ring For Women Adjustable Two Tone Gold Silver Feather Fashion Jewelry Non-Fading Finger Ring
Luxury Stainless Steel Wing Open Ring For Women Adjustable Two Tone Gold Silver Feather Fashion Jewelry Non-Fading Finger Ring
like
Find Similar
18K gold plated stainless steel angel wing open ring in two-tone silver and gold finish - Gold Silver Mixed Color Wing Style (JDR0305035-PS)
Detailed view of adjustable golden wing ring with size specs and waterproof features - Gold Wing Style (JDR0305035)
Luxury Stainless Steel Wing Open Ring For Women Adjustable Two Tone Gold Silver Feather Fashion Jewelry Non-Fading Finger Ring
$2.23-2.36
No MOQ
 · 
1 reviews
Free Shipping
Stainless Steel Celtic Witch Knot Adjustable Ring Geometric Hollow Open Band Vintage Gothic Ring Jewelry For Women Men
Stainless Steel Celtic Witch Knot Adjustable Ring Geometric Hollow Open Band Vintage Gothic Ring Jewelry For Women Men
like
Find Similar
Macro shot of gold witch's knot ring showcased in a blue velvet gift box - Gold
Detailed view of silver stainless steel Celtic knot ring on a white jewelry box lining - Silver
Macro shot of black stainless steel Celtic knot ring on natural wood surface - Black
Stainless Steel Celtic Witch Knot Adjustable Ring Geometric Hollow Open Band Vintage Gothic Ring Jewelry For Women Men
$0.47-0.58
No MOQ
 · 
31 sold recently
Vintage Tree Of Life Stainless Steel Ring For Men Nordic Viking Celtic Knot Oxidized Silver Color Wide Band Signet Ring Punk Jewelry
Vintage Tree Of Life Stainless Steel Ring For Men Nordic Viking Celtic Knot Oxidized Silver Color Wide Band Signet Ring Punk Jewelry
like
Find Similar
6 options
Vintage Tree Of Life Stainless Steel Ring For Men Nordic Viking Celtic Knot Oxidized Silver Color Wide Band Signet Ring Punk Jewelry
-4%
$3.24
No MOQ
Free Shipping
Punk Titanium Steel Fist Open Ring For Men Women Gothic Rock Streetwear Adjustable Stainless Steel Band Ring Jewelry Gift
Punk Titanium Steel Fist Open Ring For Men Women Gothic Rock Streetwear Adjustable Stainless Steel Band Ring Jewelry Gift
like
Find Similar
Retro silver fist shaped open ring in punk style made of polished stainless steel for men - US 7 / Steel
Polished gold stainless steel ring featuring detailed twin fist design with mirror reflection - US 7 / Gold
Macro shot of stainless steel ring featuring dual fist design with rainbow plating - US 7 / Rainbow
Detailed view of black polished stainless steel ring with two fists on an open band - US 7 / Black
+24
Punk Titanium Steel Fist Open Ring For Men Women Gothic Rock Streetwear Adjustable Stainless Steel Band Ring Jewelry Gift
-4%
$2.74-2.99
Mix MOQ : 3
Free Shipping
Stainless Steel Ring Two Tone Gold Silver Irregular Wave Line Geometric Minimalist Punk Fashion Jewelry For Women
Stainless Steel Ring Two Tone Gold Silver Irregular Wave Line Geometric Minimalist Punk Fashion Jewelry For Women
like
Find Similar
Abstract two-tone stainless steel ring with elegant curved lines in gold and silver finish - Irregular Curve Style (Style 1)
Two-tone minimalist stainless steel open ring with wave texture in gold and silver - Wave Texture Style (Style 2)
Two-tone wavy stainless steel ring in gold and silver finish with dimension specs - Wave Shape Open Style (Style 3)
Two-tone gold and silver stainless steel ring with elegant curved streamline design - Streamlined Bicolor Style (Style 4)
+5
Stainless Steel Ring Two Tone Gold Silver Irregular Wave Line Geometric Minimalist Punk Fashion Jewelry For Women
$0.92-1.16
No MOQ
 · 
558 sold recently
Top 5% Best Sellers
in Rings
Free Shipping
Minimalist Titanium Steel DIY Ring Blank Double Groove Design Hip Hop Finger Ring For Men Women Polished Jewelry
Minimalist Titanium Steel DIY Ring Blank Double Groove Design Hip Hop Finger Ring For Men Women Polished Jewelry
like
Find Similar
Men's black brushed stainless steel ring blank with U-shaped groove for DIY inlay crafts - US 7 / Black
Polished silver stainless steel ring blank with dual groove for DIY inlay crafting - US 7 / Silver
+12
Minimalist Titanium Steel DIY Ring Blank Double Groove Design Hip Hop Finger Ring For Men Women Polished Jewelry
$0.29-0.39
No MOQ
 · 
141 sold recently
Vintage Stainless Steel Lion Head Ring For Men Gothic Punk Biker Jewelry Gold Black Silver Tone Geometric Finger Ring Gift
Vintage Stainless Steel Lion Head Ring For Men Gothic Punk Biker Jewelry Gold Black Silver Tone Geometric Finger Ring Gift
like
Find Similar
Men's stainless steel ring featuring a black lion head design on a clean white background - US 7 / Black
Macro shot of silver lion head ring showing 3D embossed texture and antique steel finish - US 7 / Steel
Bold vintage gold lion head statement ring crafted in durable polished stainless steel - US 7 / Gold
Two-tone stainless steel lion head ring with gold mane and silver face in high relief - US 7 / Two-tone (Gold & Silver)
+32
Vintage Stainless Steel Lion Head Ring For Men Gothic Punk Biker Jewelry Gold Black Silver Tone Geometric Finger Ring Gift
-5%
$2.74-2.98
No MOQ
Free Shipping
Sweet Zircon Four Leaf Flower Open Ring For Women Elegant Alloy Adjustable Rotating Index Finger Jewelry Accessory
Sweet Zircon Four Leaf Flower Open Ring For Women Elegant Alloy Adjustable Rotating Index Finger Jewelry Accessory
like
Find Similar
Golden clover zircon open ring for women with four teardrop stones and adjustable band - Gold Rotating Style / Gold
Adjustable silver flower ring with marquise-cut cubic zirconia on champagne silk - Silver Rotating Style / Silver
Adjustable gold open ring featuring a four-leaf clover design with purple gemstone - Purple Clover Style (J0095) / Purple
Sweet Zircon Four Leaf Flower Open Ring For Women Elegant Alloy Adjustable Rotating Index Finger Jewelry Accessory
$0.92-1.65
No MOQ
Free Shipping
Vintage Alloy Ring Constellation Zodiac Sign Carved Portrait Synthetic Gemstone Bohemian Retro Women Jewelry
Vintage Alloy Ring Constellation Zodiac Sign Carved Portrait Synthetic Gemstone Bohemian Retro Women Jewelry
like
Find Similar
Vintage bohemian celestial ring with engraved star moon motifs and clear zircon stone - US 5 / Star Moon Ring
Vintage Taurus alloy ring with floral relief and green gemstone on dark fur background - US 5 / Taurus
Detail of vintage Capricorn alloy ring featuring girl relief and red ruby floral accents - US 5 / Capricorn
Vintage Aries zodiac ring with relief woman profile and floral accents for women - US 5 / Aries
+129
Vintage Alloy Ring Constellation Zodiac Sign Carved Portrait Synthetic Gemstone Bohemian Retro Women Jewelry
$0.79
No MOQ
 · 
544 sold recently
Top 5% Best Sellers
in Rings
Free Shipping
Fashion Stainless Steel Ring For Men Women Zirconia Rhinestone Inlaid Band Ring Elegant Modern Couple Jewelry No Unit
Fashion Stainless Steel Ring For Men Women Zirconia Rhinestone Inlaid Band Ring Elegant Modern Couple Jewelry No Unit
like
Find Similar
Detail showing polished gold finish stainless steel ring with micro-pave crystal setting - US 5 / Gold with Stone
Detailed view of 6mm gold stainless steel ring featuring a polished finish and center groove - US 5 / Gold
Macro detail of 6mm stainless steel band featuring a row of sparkling inset cubic zirconia - US 5 / Steel with Stone
Macro detail of 6mm silver stainless steel ring with brushed finish and grooved design - US 5 / Silver Color Plain
+50
Fashion Stainless Steel Ring For Men Women Zirconia Rhinestone Inlaid Band Ring Elegant Modern Couple Jewelry No Unit
$0.26-1.18
Mix MOQ : 2
 · 
83 sold recently
Free Shipping
Vintage Bohemian Rings Alloy Carved Turquoise Opal Stone Ethnic Antique Silver Finish Stackable Finger Jewelry For Women
Vintage Bohemian Rings Alloy Carved Turquoise Opal Stone Ethnic Antique Silver Finish Stackable Finger Jewelry For Women
like
Find Similar
9-piece set of silver bohemian feather rings with turquoise stones for women - Turquoise Resort Style (3589-silver)
9-piece bohemian silver ring set with turquoise stones and vintage floral carvings - Retro Pale Green Opal-Look Style (6421-green)
11-piece vintage bohemian elephant and turquoise ring set in antique silver finish - Bohemian Totem Turquoise Style (4189)
Retro bohemian silver ring set featuring turquoise stones and ethnic elephant motifs - Sunflower Carved Turquoise Style (19606-silver)
+17
Vintage Bohemian Rings Alloy Carved Turquoise Opal Stone Ethnic Antique Silver Finish Stackable Finger Jewelry For Women
$0.65-2.02
Mix MOQ : 2
 · 
39 sold recently
Women Elegant 18K Gold Plated Titanium Steel Ring Double Row Rhinestone Glistening Band Ring Minimalist Jewelry Gift
Women Elegant 18K Gold Plated Titanium Steel Ring Double Row Rhinestone Glistening Band Ring Minimalist Jewelry Gift
like
Find Similar
Elegant double row crystal eternity ring in titanium steel with polished finish - US 5 / Silver
Elegant 18K gold-plated titanium steel ring with double row of sparkling cubic zirconia - US 5 / Gold
Elegant 18K rose gold titanium steel ring with double row pavé zircons in a minimalist style - US 5 / Rose Gold
+21
Women Elegant 18K Gold Plated Titanium Steel Ring Double Row Rhinestone Glistening Band Ring Minimalist Jewelry Gift
-5%
$1.74-1.99
No MOQ
 · 
29 sold recently
Free Shipping
Bohemian Alloy Rhinestone Evil Eye Hamsa Hand Open Ring For Women Adjustable Vintage Gold Silver Plated Finger Ring Jewelry
Bohemian Alloy Rhinestone Evil Eye Hamsa Hand Open Ring For Women Adjustable Vintage Gold Silver Plated Finger Ring Jewelry
like
Find Similar
Gold Hamsa and Evil Eye open ring with colorful rhinestones on a white textured background - Gold Eye Hand Style / Gold
Silver Hamsa Hand and Evil Eye open adjustable ring with sparkling blue and white crystals - Silver Eye Hand Style / Silver
Bohemian Alloy Rhinestone Evil Eye Hamsa Hand Open Ring For Women Adjustable Vintage Gold Silver Plated Finger Ring Jewelry
$0.67
Mix MOQ : 6
Free Shipping
Vintage Titanium Steel Pentagram Star Ring For Men Women Punk Retro Distressed Silver Color Band Ring Fashion Jewelry
Vintage Titanium Steel Pentagram Star Ring For Men Women Punk Retro Distressed Silver Color Band Ring Fashion Jewelry
like
Find Similar
7 options
Vintage Titanium Steel Pentagram Star Ring For Men Women Punk Retro Distressed Silver Color Band Ring Fashion Jewelry
$3.14
No MOQ
 · 
14 sold recently
Free Shipping
Vintage Stainless Steel Colorful Enamel Open Ring Abstract Mosaic Geometric Adjustable Wide Band Ring For Women Jewelry
Vintage Stainless Steel Colorful Enamel Open Ring Abstract Mosaic Geometric Adjustable Wide Band Ring For Women Jewelry
like
Find Similar
Adjustable wide stainless steel open ring with pink marble enamel inlay in gold finish - Light Pink Grey Marble Style (S-R880-hui)
Adjustable wide gold-plated stainless steel ring with colorful enamel abstract textures - Light Purple Green Painted Style (S-R880-lv)
Adjustable wide enamel ring with pink base and orange geometric patterns on gold base - Pink Orange Red Geometric Style (S-R880-mh)
Close-up of adjustable enamel wide ring with pastel geometric patterns on gold plating - Purple Pink Cream Geometric Style (S-R880-zi)
Vintage Stainless Steel Colorful Enamel Open Ring Abstract Mosaic Geometric Adjustable Wide Band Ring For Women Jewelry
$1.70
No MOQ
 · 
11 views
Free Shipping
Vintage Bohemian Multi Stone Geometric Ring Gold Alloy Inlaid Natural Stone Faux Artificial Pearl Retro Finger Jewelry Women
Vintage Bohemian Multi Stone Geometric Ring Gold Alloy Inlaid Natural Stone Faux Artificial Pearl Retro Finger Jewelry Women
like
Find Similar
Three-stone gold ring with malachite and turquoise inlays on a ceramic jewelry tray - Pink Crystal + Malachite
Vintage golden ring with three stacked natural stones on a white ceramic plate - White Pearl + Blue Sandstone
Gold ring with vertical blue stone, stardust resin, and white pearl inlay design - White Pearl + Lapis Lazuli
Detailed shot of retro gold ring with marble stone and black mineral on a magazine - Lemon Jade + White Turquoise
Vintage Bohemian Multi Stone Geometric Ring Gold Alloy Inlaid Natural Stone Faux Artificial Pearl Retro Finger Jewelry Women
-4%
$1.62
No MOQ
 · 
178 sold recently
Top 10% Best Sellers
in Rings
Free Shipping
Vintage Titanium Steel Fox Ring Retro Marcasite Inlay Animal Wrap Band For Men Women Antique Silver Jewelry
Vintage Titanium Steel Fox Ring Retro Marcasite Inlay Animal Wrap Band For Men Women Antique Silver Jewelry
like
Find Similar
Vintage oxidized silver fox ring with marcasite stones and unique wraparound design - US 7 / Antique Silver
Vintage Titanium Steel Fox Ring Retro Marcasite Inlay Animal Wrap Band For Men Women Antique Silver Jewelry
-5%
$3.73
No MOQ
Free Shipping
4Pcs Set Acrylic Resin Rings For Women Minimalist Alloy Chain Geometric Finger Ring Marble Amber Pattern Korean Fashion Jewelry
4Pcs Set Acrylic Resin Rings For Women Minimalist Alloy Chain Geometric Finger Ring Marble Amber Pattern Korean Fashion Jewelry
like
Find Similar
Set of 4 minimalist rings featuring silver chain link and marble resin textures - Blue
Detail of four-piece mixed set with acrylic resin and silver metal chain rings - Green
Flat lay detail of four-piece rings set with amber resin and silver chain texture - Brown
4Pcs Set Acrylic Resin Rings For Women Minimalist Alloy Chain Geometric Finger Ring Marble Amber Pattern Korean Fashion Jewelry
-4%
$0.80
No MOQ
Vintage Stainless Steel Octopus Eye Of Providence Ring Men Gothic Mystery Occult Symbol Polished Punk Jewelry Band Ring
Vintage Stainless Steel Octopus Eye Of Providence Ring Men Gothic Mystery Occult Symbol Polished Punk Jewelry Band Ring
like
Find Similar
Gothic Eye of Providence stainless steel ring with octopus tentacle design for men - US 7 / Steel
Gothic Eye of Horus ring in silver with golden octopus tentacle relief details - US 7 / Gold & Silver
+12
Vintage Stainless Steel Octopus Eye Of Providence Ring Men Gothic Mystery Occult Symbol Polished Punk Jewelry Band Ring
-5%
$3.04-3.29
No MOQ
Free Shipping
Vintage Men Chinese Dragon Adjustable Open Ring Silver Plated Alloy Animal Motif Gothic Punk Style Domineering Finger Jewelry
Vintage Men Chinese Dragon Adjustable Open Ring Silver Plated Alloy Animal Motif Gothic Punk Style Domineering Finger Jewelry
like
Find Similar
Vintage silver-plated Chinese dragon open ring featuring intricate dragon scale textures - Silver Dragon Style
Vintage punk dragon claw ring in stainless steel with detailed scale texture on white background - Eagle Claw Shape
Detailed close-up of antique silver wolf head ring with vintage punk aesthetic carvings - Wolf Head Design
Vintage guitar style biomechanical men's ring in antique silver punk finish - Guitar Shape
+14
Vintage Men Chinese Dragon Adjustable Open Ring Silver Plated Alloy Animal Motif Gothic Punk Style Domineering Finger Jewelry
$0.05-0.58
No MOQ
 · 
37 sold recently
Vintage Stainless Steel Snake Ring For Men Retro Animal Wrap Ring With Green Rhinestone Eyes Gothic Punk Jewelry Finger Ring
Vintage Stainless Steel Snake Ring For Men Retro Animal Wrap Ring With Green Rhinestone Eyes Gothic Punk Jewelry Finger Ring
like
Find Similar
Vintage stainless steel snake ring with realistic scales and green gemstone eyes - US Size 7 / Multi-layer Wrap Style (BR8-1103)
Vintage stainless steel snake ring with realistic scale texture and green gemstone eyes - US Size 10 / Retro Silver Green Gem (BR8-1102)
Macro shot of 3D snake scale texture on vintage stainless steel punk ring - US Size 7 / 3D Scale Style (BR8-1105)
+11
Vintage Stainless Steel Snake Ring For Men Retro Animal Wrap Ring With Green Rhinestone Eyes Gothic Punk Jewelry Finger Ring
$3.09-3.62
No MOQ
Free Shipping
Stainless Steel Evil Eye Open Ring Gold Plated Rhinestone Boho Adjustable Hollow Winding Finger Ring For Women Jewelry
Stainless Steel Evil Eye Open Ring Gold Plated Rhinestone Boho Adjustable Hollow Winding Finger Ring For Women Jewelry
like
Find Similar
Detail of gold evil eye ring with white floral element and adjustable double-band design - White Floral Evil Eye Style (SFLR728-B-LAN)
Detail of gold multilayer ring with red stone and adjustable open band design - Red Square Irregular Style (SFLR728-C-HONG)
Detailed macro view of a gold plated adjustable ring with a heart-shaped turquoise stone - Heart Turquoise Style (SFLR728-C-LV)
Macro shot of gold wave-textured adjustable ring with a square evil eye charm pendant - White Square Evil Eye Style (SFLR733-E-BAI)
+1
Stainless Steel Evil Eye Open Ring Gold Plated Rhinestone Boho Adjustable Hollow Winding Finger Ring For Women Jewelry
$1.52
No MOQ
Free Shipping
Minimalist Dome Ring Titanium Steel High Polish Glossy Wide Band Jewelry For Men And Women Fashion Commute Finger Accessory
Minimalist Dome Ring Titanium Steel High Polish Glossy Wide Band Jewelry For Men And Women Fashion Commute Finger Accessory
like
Find Similar
Minimalist silver dome ring in polished titanium steel with a sleek teardrop design - US 6 / Silver
Close-up of polished gold titanium steel teardrop ring with smooth metallic luster - US 6 / Gold
Macro close-up of polished black titanium water drop ring on grey stone texture - US 7 / Black
+18
Minimalist Dome Ring Titanium Steel High Polish Glossy Wide Band Jewelry For Men And Women Fashion Commute Finger Accessory
$1.44-1.62
No MOQ
 · 
437 sold recently
Top 10% Best Sellers
in Rings
Free Shipping
Vintage Stainless Steel Rhinestone Inlaid Ring For Men Women Emerald Cut Gemstone Grooved Band Fashion Jewelry Wedding Party Accessory
Vintage Stainless Steel Rhinestone Inlaid Ring For Men Women Emerald Cut Gemstone Grooved Band Fashion Jewelry Wedding Party Accessory
like
Find Similar
Vintage stainless steel ring featuring a rectangle emerald cut purple gemstone with grooved band - US 7 / Steel Color Purple Stone
Vintage silver steel ring with rectangle clear gemstone and black groove texture - US 7 / Steel Color White Stone
Silver stainless steel ring featuring a rectangular tiger eye stone with grooved band - US 7 / Silver Tiger Eye
Vintage stainless steel ring for men featuring horizontal stripes and black rectangle stone - US 7 / Silver Black Onyx
+50
Vintage Stainless Steel Rhinestone Inlaid Ring For Men Women Emerald Cut Gemstone Grooved Band Fashion Jewelry Wedding Party Accessory
$3.88
No MOQ
 · 
87 sold recently
Free Shipping
Modern Stainless Steel Spinner Rings For Men Women Hammered Texture Chain Rotating Greek Key Rhinestone Fashion Jewelry Rings
Modern Stainless Steel Spinner Rings For Men Women Hammered Texture Chain Rotating Greek Key Rhinestone Fashion Jewelry Rings
like
Find Similar
Set of 12 silver titanium steel rings for men featuring chain and greek key textures - US 7 / Silver
12pcs men's titanium steel ring set with chain spinner and matte black signet designs - US 7 / Black
Macro shot of 12-piece men's titanium steel rings set in gold and silver finish - US 7 / Gold
+18
Modern Stainless Steel Spinner Rings For Men Women Hammered Texture Chain Rotating Greek Key Rhinestone Fashion Jewelry Rings
$7.86-9.17
No MOQ
 · 
10 views
Free Shipping
Evil Eye Open Adjustable Ring Retro Alloy Dragon Eye Gothic Punk Jewelry For Men
Evil Eye Open Adjustable Ring Retro Alloy Dragon Eye Gothic Punk Jewelry For Men
like
Find Similar
Detailed view of punk evil eye ring with purple gem and vintage embossed textures - Adjustable Open / Type 1 Devil Eye Purple Gemstone
Retro punk devil's eye open ring with blue dragon eye stone and silver finish - Adjustable Open / Type 1 Devil Eye Blue Gemstone
Detailed view of silver punk ring featuring a purple devil eye and intricate carvings - Adjustable Open / Type 3 Devil Eye Purple Gemstone
Macro detail of vintage punk evil eye ring with purple eye stone on wooden surface - Adjustable Open / Type 2 Devil Eye Purple Gemstone
+12
Evil Eye Open Adjustable Ring Retro Alloy Dragon Eye Gothic Punk Jewelry For Men
-5%
$0.24-0.35
Mix MOQ : 2
 · 
113 sold recently
Retro Hollow Ring With Oval Imitation Turquoise Alloy Bohemian Ethnic Style Jewelry For Women
Retro Hollow Ring With Oval Imitation Turquoise Alloy Bohemian Ethnic Style Jewelry For Women
like
Find Similar
Retro turquoise ring with oval stone and filigree copper-tone metal open design - US 5 / Rose Gold
Retro hollow turquoise ring with antique gold finish and bohemian scroll engraving - US 5 / Gold
Retro hollowed silver ring featuring oval faux turquoise with bohemian braided texture - US 5 / White Gold
+12
Retro Hollow Ring With Oval Imitation Turquoise Alloy Bohemian Ethnic Style Jewelry For Women
$0.58
No MOQ
 · 
566 sold recently
Top 10% Best Sellers
in Rings
Free Shipping
Modern Design Stainless Steel Multi-Layer Spiral Ring For Women Gold Silver Two-Tone Adjustable Open Ring With Bead Accents
Modern Design Stainless Steel Multi-Layer Spiral Ring For Women Gold Silver Two-Tone Adjustable Open Ring With Bead Accents
like
Find Similar
Detail view of two-tone stainless steel multi-layer ring with size and weight specs - Gold and Silver Two-Tone Multi-Layer Spiral Bead Style (JDR0211002-PS)
Modern Design Stainless Steel Multi-Layer Spiral Ring For Women Gold Silver Two-Tone Adjustable Open Ring With Bead Accents
$1.96
No MOQ
 · 
13 sold recently
Free Shipping
Punk Gothic Skull Stainless Steel Ring For Men Rock Biker Evil Eye Rhinestone Finger Ring Retro Oxidized Jewelry Gift
Punk Gothic Skull Stainless Steel Ring For Men Rock Biker Evil Eye Rhinestone Finger Ring Retro Oxidized Jewelry Gift
like
Find Similar
Gothic skull ring in silver stainless steel with a round red ruby stone eye setting - US 7 / Steel Color Red Eye
Punk style stainless steel skull ring featuring a purple devil eye stone for men - US 7 / Steel Color Purple Eye
Punk gothic skull ring for men in stainless steel with a green evil eye gemstone - US 7 / Steel Color Green Eye
Gothic punk skull ring in vintage silver with a bright orange tiger eye stone - US 7 / Steel Color Yellow Eye
+45
Punk Gothic Skull Stainless Steel Ring For Men Rock Biker Evil Eye Rhinestone Finger Ring Retro Oxidized Jewelry Gift
$2.98
No MOQ
 · 
21 sold recently
Free Shipping
Go to

More in jewelry

Lab-Created Gemstone Jewelry

Explore more in toe rings

openfoot jewelryfingersimplewhiteplasticinlaiddesignbodyplated stainless steel
footgold platedsteelartificialpolishedgirlsgold plated adjustableturquoise18k gold platedcolor ring

Ready to source like an insider

Get a direct line to the factory floor — no minimums, no middlemen, no guesswork.
iconReal factory pricing, no markup in betweeniconEvery order hand-inspected before it shipsicon5,000+ new products added daily
Get Inside Access