Everful

Wholesale favor boxes

Factory-direct selection, vetted for quality and ready to order.

Sign Up
Favor Boxes

Find the perfect pieces: party gift bags, party favors, gift wrapping supplies and more

filterShow Filters
Best Seller
New Arrivals
Price Drop
Free Shipping
Halloween Round Self Adhesive Decorative Stickers Pumpkin Ghost Bat Horror Blood Handprint Patterns For Festive Party Favor Gift Bag Sealing
Halloween Round Self Adhesive Decorative Stickers Pumpkin Ghost Bat Horror Blood Handprint Patterns For Festive Party Favor Gift Bag Sealing
like
Find Similar
Roll of 500 Halloween self-adhesive stickers with cute pumpkin and ghost patterns - Cartoon Ghost Style (CK21) / 1 Inch - 2.5 cm
Macro view of Halloween stickers featuring pumpkins, ghosts and mummies on a roll - Dark Purple Festive Elements Style (CK22) / 1 Inch - 2.5 cm
Close-up of Happy Halloween roll stickers featuring black cats and orange designs - Orange Black Vintage Festive Style (CK23) / 1 Inch - 2.5 cm
Close-up of a roll of round Halloween stickers with pumpkin and ghost designs - Purple Cute Festive Style (CK24) / 1 Inch - 2.5 cm
+3
Halloween Round Self Adhesive Decorative Stickers Pumpkin Ghost Bat Horror Blood Handprint Patterns For Festive Party Favor Gift Bag Sealing
-6%
$0.30
No MOQ
 · 
10 views
Christmas Glasses Frames Glitter Plastic Felt Party Decoration Holiday Favors Photo Props Reindeer Antler Santa Snowman
Christmas Glasses Frames Glitter Plastic Felt Party Decoration Holiday Favors Photo Props Reindeer Antler Santa Snowman
like
Find Similar
Red sequin Christmas reindeer glasses with colorful pom-poms for festive parties - Red Cotton Ball
Sparkly red glitter reindeer Christmas glasses frame with holly leaf for kids party decor - Red Antlers Style
Detailed view of rose gold glitter Christmas glasses with bunny ears and dimensions - Brown Rabbit Ears
Glittery gold Merry Christmas glasses frame with holly leaves and white snowflake decor - Golden Merry Christmas
+60
Christmas Glasses Frames Glitter Plastic Felt Party Decoration Holiday Favors Photo Props Reindeer Antler Santa Snowman
-3%
$0.30-0.69
No MOQ
 · 
110 sold recently
30th Birthday Decoration Set Gold Silver Rose Gold Sash Rhinestone Tiara Crown For Women Party Supplies Gift Favors
30th Birthday Decoration Set Gold Silver Rose Gold Sash Rhinestone Tiara Crown For Women Party Supplies Gift Favors
like
Find Similar
Rose gold Dirty 30 glitter sash and tiara set for women 30th birthday party decor - 30th Birthday Set (Dirty Thirty Headband) / 2-Piece Set (Headband + Sash) / Rose Gold
Rose gold 30th birthday set with 30 and Fabulous sash and matching crystal tiara - 30th Birthday Set (30 & Fabulous) / 2-Piece Set (Crown + Shoulder Strap) / Rose Gold
Gold 30 and Fabulous glitter sash with rhinestone tiara set for 30th birthday parties - 30th Birthday Set (30 & Fabulous) / 2-Piece Set (Crown + Shoulder Strap) / Gold
Golden 30th birthday party set with rhinestone tiara and Talk Thirty to Me sash - 30th Birthday Set (Talk Thirty To Me) / 3-Piece Set (Including Pin) / Gold
+11
30th Birthday Decoration Set Gold Silver Rose Gold Sash Rhinestone Tiara Crown For Women Party Supplies Gift Favors
$2.88-3.17
No MOQ
Red Heart Sequin Headband Heart Sunglasses Valentine Party Favor For Women Feather Boppers
Red Heart Sequin Headband Heart Sunglasses Valentine Party Favor For Women Feather Boppers
like
Find Similar
Red sequin heart headband with spring bouncy LOVE hearts for party and festival costumes - Style 16 (LOVE Heart Spring)
Red heart spring headband with I Love You print and silver bows for Valentine party - Style 14 (I Love You Embroidery Bow)
Red heart headband with I Love You embroidery and tulle trim for party costume - Style 13 (I Love You Lace Edge)
Red spring headband with sparkling gold glitter hearts and LOVE lettering for party - Style 12 (LOVE Gold Powder Spring)
+29
Red Heart Sequin Headband Heart Sunglasses Valentine Party Favor For Women Feather Boppers
$0.43-1.30
No MOQ
 · 
110 sold recently
Mini Knife And Axe Keychain Pendant Zinc Alloy With Damascus Pattern Retro Horror Novelty Toy For Halloween Party Favor Gift
Mini Knife And Axe Keychain Pendant Zinc Alloy With Damascus Pattern Retro Horror Novelty Toy For Halloween Party Favor Gift
like
Find Similar
Detailed close-up of kitchen knife keychain with Damascus steel patterns on dark gold blade - Antique Bronze Cleaver
Macro shot of miniature silver and copper cleaver keychain with realistic metal textures - Antique Red Cleaver
Detailed view of metal kitchen cleaver keychain with Damascus steel pattern texture - Antique Pewter Cleaver
Damascus pattern axe keychain with bronze blade and silver handle on walnut wood - Antique Bronze Axe
+2
Mini Knife And Axe Keychain Pendant Zinc Alloy With Damascus Pattern Retro Horror Novelty Toy For Halloween Party Favor Gift
$0.25
Mix MOQ : 2
 · 
15 views
Halloween Miniature Ghost Skull Figurines Resin 3D Ghostface Sculpture For DIY Crafts Desk Decor Party Favors
Halloween Miniature Ghost Skull Figurines Resin 3D Ghostface Sculpture For DIY Crafts Desk Decor Party Favors
like
Find Similar
8-piece set of 3D Halloween ghost and skull figurines in white and black resin - 8-Style Set / Mixed Colors
Detailed macro shot of 3D mini ghost figurines on a vintage book for Halloween decor - Long Mouth White Ghost
Detailed view of mini 3D glossy ghost figurines on a vintage book for Halloween decor - Long Mouth Black Ghost
Close-up of two miniature 3D ghost figurines with red heart detail on a vintage book - White Ghost with Knife
+5
Halloween Miniature Ghost Skull Figurines Resin 3D Ghostface Sculpture For DIY Crafts Desk Decor Party Favors
$0.12-0.14
No MOQ
 · 
14 views
Non-Woven Fabric Christmas Tree Skirt Base Cover Box For Holiday Home Decor With Santa Claus Snowman Printed Patterns Red Ornament
Non-Woven Fabric Christmas Tree Skirt Base Cover Box For Holiday Home Decor With Santa Claus Snowman Printed Patterns Red Ornament
like
Find Similar
1 option
Non-Woven Fabric Christmas Tree Skirt Base Cover Box For Holiday Home Decor With Santa Claus Snowman Printed Patterns Red Ornament
-5%
$2.46
No MOQ
Christmas Gingerbread Man Plush Ornaments Corduroy Hanging Dolls Tree Decorations Festive Cartoon Figures Party Favors
Christmas Gingerbread Man Plush Ornaments Corduroy Hanging Dolls Tree Decorations Festive Cartoon Figures Party Favors
like
Find Similar
Gingerbread man chef plush hanging ornament with chef hat and red bow tie, 18cm height - X3-54 Chef Hat Style
Gingerbread man plush toy with red plaid hat and candy buttons on white background - X3-53 Christmas Hat Style
Christmas Gingerbread Man Plush Ornaments Corduroy Hanging Dolls Tree Decorations Festive Cartoon Figures Party Favors
-4%
$2.22
No MOQ
Santa Claus Toilet Seat Cover Set Including Lid Cover Rug Tank And Tissue Box Cover For Christmas Bathroom Home Decoration
Santa Claus Toilet Seat Cover Set Including Lid Cover Rug Tank And Tissue Box Cover For Christmas Bathroom Home Decoration
like
Find Similar
1 option
Santa Claus Toilet Seat Cover Set Including Lid Cover Rug Tank And Tissue Box Cover For Christmas Bathroom Home Decoration
-4%
$5.07
No MOQ
Christmas Spiral Straws Reusable Plastic With Silicone Santa Reindeer Decorations Party Favors Drinkware Accessories
Christmas Spiral Straws Reusable Plastic With Silicone Santa Reindeer Decorations Party Favors Drinkware Accessories
like
Find Similar
Pink spiral straw with green Christmas gift box charm for festive party supplies decoration - Green Gift Box / Pink
Pink spiral Christmas straw with Santa Claus topper for holiday party supplies - Santa Head / Pink
Pink spiral plastic party straw with green Christmas wreath decoration on white background - Christmas Wreath / Pink
Pink spiral Christmas straw featuring Santa Claus with Merry Christmas everyone text - Santa with Text / Pink
+22
Christmas Spiral Straws Reusable Plastic With Silicone Santa Reindeer Decorations Party Favors Drinkware Accessories
$0.23
Mix MOQ : 10
 · 
24 sold recently
Halloween Rings For Kids Cartoon Ghost Pumpkin Witch Skeleton PVC Silicone Soft Rubber Finger Rings Party Favors Novelty
Halloween Rings For Kids Cartoon Ghost Pumpkin Witch Skeleton PVC Silicone Soft Rubber Finger Rings Party Favors Novelty
like
Find Similar
Halloween cartoon green witch silicone ring for kids featuring a black pointed hat - Witch
Detail of purple PVC cartoon vampire ring for children featuring a cute ghost toy design - Vampire
Cartoon skull Halloween ring made of soft PVC rubber for kids, centered on white background - Skull
Close-up of cute orange pumpkin character ring made of soft PVC for Halloween gift - Pumpkin
+2
Halloween Rings For Kids Cartoon Ghost Pumpkin Witch Skeleton PVC Silicone Soft Rubber Finger Rings Party Favors Novelty
$0.10
No MOQ
 · 
49 sold recently
Tulip Scented Candle Flower Shape Soy Wax Home Decor Aesthetic Ribbon Bow Wedding Favor Souvenir Aesthetic Ornament
Tulip Scented Candle Flower Shape Soy Wax Home Decor Aesthetic Ribbon Bow Wedding Favor Souvenir Aesthetic Ornament
like
Find Similar
Pink tulip scented candle with a green stem and white bow on a ceramic tray - Light Pink with Light Green Leaf
Artistic tulip-shaped scented candle in purple with green base and white ribbon bow - Dark Purple with Light Green Leaf
White tulip scented candle with green stem and white bow, dimensions 9.5cm by 4.5cm - White with Dark Green Leaf
Tulip scented candle in yellow and green with a white ribbon bow for home decor - Light Yellow with Light Green Leaf
+3
Tulip Scented Candle Flower Shape Soy Wax Home Decor Aesthetic Ribbon Bow Wedding Favor Souvenir Aesthetic Ornament
$1.30
Mix MOQ : 5
 · 
16 views
Christmas Eyeglass Frames Glitter Non-Woven Fabric Novelty Reindeer Santa Styles Holiday Party Decor Costume Favors
Christmas Eyeglass Frames Glitter Non-Woven Fabric Novelty Reindeer Santa Styles Holiday Party Decor Costume Favors
like
Find Similar
Classic round black plastic glasses frame 14x5cm for cosplay costumes and holiday parties - Black Square Frame
Detail of red party glasses frames with dimensions 14cm width and 5cm height specs - Red Square Frame
Christmas tree party glasses with golden sequins and green glitter trees for festive events - SDYJ-5-4 Green Sequins Christmas Tree
Festive red glitter Christmas glasses frame with decorative Santa Claus character toppers - SDYJ-5-5 Glitter Santa Claus
+17
Christmas Eyeglass Frames Glitter Non-Woven Fabric Novelty Reindeer Santa Styles Holiday Party Decor Costume Favors
$0.10-0.48
Mix MOQ : 2
 · 
1K+ sold recently
Birthday Crown And Sash Rhinestone Alloy Tiara Glitter Fabric Shoulder Strap Girl Birthday Party Favor Rose Gold
Birthday Crown And Sash Rhinestone Alloy Tiara Glitter Fabric Shoulder Strap Girl Birthday Party Favor Rose Gold
like
Find Similar
Detail of rose gold crown and glitter sash with It's My 1st Birthday lettering for girls - Rose Gold 3-Piece Set 1st Birthday
Rose gold birthday crown with sparkling rhinestones and number 4 design for party hair decor - Single Crown 4th Birthday
Rose gold birthday crown for 5th birthday featuring sparkling rhinestones and side combs - Single Crown 5th Birthday
Gold metal birthday tiara with sparkling rhinestones and letter Z pendant on white background - Single Crown 7th Birthday
+20
Birthday Crown And Sash Rhinestone Alloy Tiara Glitter Fabric Shoulder Strap Girl Birthday Party Favor Rose Gold
-5%
$1.05-1.73
No MOQ
 · 
16 views
Fruit Shape Aluminum Foil Balloons Mini Watermelon Pineapple Lemon Orange Pattern For Birthday Celebration Party Decorations Kids Favors
Fruit Shape Aluminum Foil Balloons Mini Watermelon Pineapple Lemon Orange Pattern For Birthday Celebration Party Decorations Kids Favors
like
Find Similar
Mini 16-inch yellow pineapple foil balloon with green leaves for birthday party decor - Mini Pineapple
Close-up of a 16-inch orange slice foil balloon decoration measuring 32x30cm - Mini Orange
Mini 16-inch green lemon slice foil balloon for kids birthday party decoration - Mini Lemon
Detail shot of a 16-inch watermelon foil balloon for kids birthday party decoration - Mini Watermelon
+1
Fruit Shape Aluminum Foil Balloons Mini Watermelon Pineapple Lemon Orange Pattern For Birthday Celebration Party Decorations Kids Favors
$0.05-0.07
Mix MOQ : 50
 · 
16 views
Mini Christmas Laser Gift Box Hanging Ornaments Colorful Foam Foil Small Gift Bags For Christmas Tree Party Home Decoration
Mini Christmas Laser Gift Box Hanging Ornaments Colorful Foam Foil Small Gift Bags For Christmas Tree Party Home Decoration
like
Find Similar
Set of 12 colorful 2.5cm laser mini gift box ornaments for Christmas tree decoration - Set of 12
Mini Christmas Laser Gift Box Hanging Ornaments Colorful Foam Foil Small Gift Bags For Christmas Tree Party Home Decoration
$0.46
No MOQ
 · 
1 reviews
Cartoon Mermaid Temporary Tattoo Stickers Waterproof DIY Marine Life Body Art For Kids Birthday Party Favors Accessories
Cartoon Mermaid Temporary Tattoo Stickers Waterproof DIY Marine Life Body Art For Kids Birthday Party Favors Accessories
like
Find Similar
Waterproof cartoon mermaid temporary tattoos for kids featuring colorful ocean designs - Mermaid Series (WST091) / 10 Sheets Set
Cartoon Mermaid Temporary Tattoo Stickers Waterproof DIY Marine Life Body Art For Kids Birthday Party Favors Accessories
$0.08
Mix MOQ : 10
 · 
30 sold recently
Glowing LED Spring Wand Toy Plastic Metal Halloween Christmas Party Favor Cartoon Pumpkin Snowman Handheld Flash Stick
Glowing LED Spring Wand Toy Plastic Metal Halloween Christmas Party Favor Cartoon Pumpkin Snowman Handheld Flash Stick
like
Find Similar
Glowing Halloween pumpkin magic wand with wizard hat and flexible metal spring on black background - Wizard Spring Stick
Halloween glowing wand featuring dual pumpkin heads with red LED light and spring neck - Double Head Pumpkin Spring Stick
Halloween glowing pumpkin spring wand with colorful LED light and classic smiling face - Single Head Pumpkin Spring Stick
Halloween glowing skull hand wand toy with colorful LED light and red handle - Skeleton Spring Stick
Glowing LED Spring Wand Toy Plastic Metal Halloween Christmas Party Favor Cartoon Pumpkin Snowman Handheld Flash Stick
$0.40
No MOQ
 · 
41 views
Mosaic Pixel Glasses Led Luminous Thug Life Style Party Favor Novelty Glowing Plastic Accessories
Mosaic Pixel Glasses Led Luminous Thug Life Style Party Favor Novelty Glowing Plastic Accessories
like
Find Similar
Black pixelated LED sunglasses with multi-color RGB glowing lights and thug life frame - Black
Red pixel sunglasses with LED lighting effects and Thug Life mosaic style frame - Red
Glow-in-the-dark blue pixel sunglasses with LED lights for cosplay parties and festivals - Blue
Green pixel mosaic sunglasses with flashing LED lights for party and cosplay - Green
Mosaic Pixel Glasses Led Luminous Thug Life Style Party Favor Novelty Glowing Plastic Accessories
$0.43
Mix MOQ : 2
 · 
24 sold recently
Halloween DIY Cartoon Puzzle Stickers For Kids Witch Pumpkin Ghost Face Change Sticker Game Party Favors Handcraft Decor
Halloween DIY Cartoon Puzzle Stickers For Kids Witch Pumpkin Ghost Face Change Sticker Game Party Favors Handcraft Decor
like
Find Similar
6-sheet set of Halloween cartoon puzzle stickers with witches pumpkins and ghosts - Halloween Face Change Sticker (T01041994) / 6pcs
Halloween DIY Cartoon Puzzle Stickers For Kids Witch Pumpkin Ghost Face Change Sticker Game Party Favors Handcraft Decor
$0.11
Mix MOQ : 6
 · 
30 sold recently
Christmas LED Light Up Headband Reindeer Antlers Santa Claus Snowman Plush Party Favor Costume Accessory For Kids Adults
Christmas LED Light Up Headband Reindeer Antlers Santa Claus Snowman Plush Party Favor Costume Accessory For Kids Adults
like
Find Similar
Christmas headband with red spring Santa Claus figures for festive holiday party decor - Flannel Regular Style (Santa)
Festive red Christmas snowman headband with spring-attached plush figures and plaid hats - Plush Standard (Snowman)
Christmas reindeer headband with red velvet base and plush antlers on spring connectors - Plush Standard (Reindeer)
Christmas headband with brown bears wearing red-green plaid hats and scarves on springs - Plush Standard (Bear)
+19
Christmas LED Light Up Headband Reindeer Antlers Santa Claus Snowman Plush Party Favor Costume Accessory For Kids Adults
-5%
$0.47-0.90
No MOQ
 · 
119 sold recently
Christmas Cartoon Stickers Santa Snowman Elk Decorative Sealing Labels Holiday Party Favor DIY Scrapbooking Accessory
Christmas Cartoon Stickers Santa Snowman Elk Decorative Sealing Labels Holiday Party Favor DIY Scrapbooking Accessory
like
Find Similar
Cartoon Christmas sticker set with Santa Claus snowmen and reindeer on white background - Christmas Sticker Series 1
Cute Christmas stickers featuring Santa Claus, reindeer and penguins for gift sealing - Christmas Sticker Series 2
Detailed view of various festive Christmas stickers featuring Santa, snowmen, and reindeer - Christmas Sticker Series 3
Assorted Christmas stickers with snowman and festive icons on purple background - Christmas Sticker Series 4
+8
Christmas Cartoon Stickers Santa Snowman Elk Decorative Sealing Labels Holiday Party Favor DIY Scrapbooking Accessory
$0.14
No MOQ
 · 
1K+ sold recently
Graduation Party Eyewear Glitter Mortarboard Photo Booth Props Celebration Favors Novelty Glasses Frames
Graduation Party Eyewear Glitter Mortarboard Photo Booth Props Celebration Favors Novelty Glasses Frames
like
Find Similar
Graduation party glasses with Proud Moment text and mortarboard cap tassel design - Style N (Proud Moment)
Graduation party glasses with gold glitter accents and mortarboard hat decor - Style K (Graduate)
Black felt graduation party glasses featuring GRAD text and 18cm width measurement - Style M (Grad)
Funny black graduation glasses with gold and silver glitter decor and size dimensions - Style P (Grad Stars Balloon)
+16
Graduation Party Eyewear Glitter Mortarboard Photo Booth Props Celebration Favors Novelty Glasses Frames
-5%
$0.52-0.69
Mix MOQ : 2
 · 
11 views
Clear Plastic Christmas Fillable Ball Ornament Transparent Hollow Acrylic Sphere For DIY Holiday Tree Decoration Party Favors
Clear Plastic Christmas Fillable Ball Ornament Transparent Hollow Acrylic Sphere For DIY Holiday Tree Decoration Party Favors
like
Find Similar
13 options
Clear Plastic Christmas Fillable Ball Ornament Transparent Hollow Acrylic Sphere For DIY Holiday Tree Decoration Party Favors
-16%
$0.05-2.60
No MOQ
Mini Christmas Hat Lollipop Candy Toppers Non-Woven Fabric Small Scarf Wine Bottle Decor Festive Party Favor DIY Ornaments
Mini Christmas Hat Lollipop Candy Toppers Non-Woven Fabric Small Scarf Wine Bottle Decor Festive Party Favor DIY Ornaments
like
Find Similar
Three mini red plush Christmas scarves with white pompoms for lollipop candy decorations - Mini Christmas Scarf 1Pc
Mini red and white knitted Christmas hat and scarf set for wine bottle decor - Wine Bottle Mini Santa Hat 1Pc
Set of 5 mini red and white non-woven Christmas hats for lollipop decorations - Lollipop Mini Santa Hat 1Pc
Mini Christmas Hat Lollipop Candy Toppers Non-Woven Fabric Small Scarf Wine Bottle Decor Festive Party Favor DIY Ornaments
$0.05-0.10
Mix MOQ : 2
 · 
120 sold recently
Christmas Hanging Ornaments Fabric Santa Snowman Reindeer Bear Xmas Tree Decor Plaid Plush Doll Pendant Party Favors
Christmas Hanging Ornaments Fabric Santa Snowman Reindeer Bear Xmas Tree Decor Plaid Plush Doll Pendant Party Favors
like
Find Similar
Plush brown reindeer Christmas ornament with red plaid scarf and golden bell on tree - Bell Reindeer
Plush Christmas bear ornament with red plaid hat and golden bell on tree branch - Bell Bear
Christmas Santa plush doll hanging ornament with green tree and festive plaid hat - Santa Hugging Tree
Plush snowman Christmas tree ornament with red coat and green sequined tree detail - Snowman Hugging Tree
+44
Christmas Hanging Ornaments Fabric Santa Snowman Reindeer Bear Xmas Tree Decor Plaid Plush Doll Pendant Party Favors
-5%
$0.49-0.71
No MOQ
Halloween Luminous Temporary Tattoo Stickers Glow In The Dark Waterproof Cartoon Pumpkin Ghost Party Favors For Kids
Halloween Luminous Temporary Tattoo Stickers Glow In The Dark Waterproof Cartoon Pumpkin Ghost Party Favors For Kids
like
Find Similar
Luminous Halloween cartoon tattoo stickers with ghosts and pumpkins in glowing green, WS-K72 - 120*76mm / Ghost Bat Pattern (WS-K72)
Luminous Halloween cartoon tattoos WS-K79 with glowing ghosts and pumpkins - 120*76mm / Cross Black Cat Pattern (WS-K79)
Luminous Halloween cartoon tattoo stickers with ghosts and pumpkins for kids model WS-K69 - 120*76mm / Ghost Castle Pattern (WS-K69)
Glow-in-the-dark Halloween temporary tattoo for kids with pumpkin and ghost designs - 120*76mm / Zombie Tombstone Pattern (WS-K75)
+16
Halloween Luminous Temporary Tattoo Stickers Glow In The Dark Waterproof Cartoon Pumpkin Ghost Party Favors For Kids
$0.15
Mix MOQ : 10
 · 
25 sold recently
Satin Sleep Eye Mask Adjustable Strap Wedding Party Favors For Team Bride Bridesmaid Groomsman Light Blocking
Satin Sleep Eye Mask Adjustable Strap Wedding Party Favors For Team Bride Bridesmaid Groomsman Light Blocking
like
Find Similar
Pink silk satin eye mask with crown and Bride print featuring adjustable black strap - Lotus Pink BRIDE with Crown (Style 1)
Pink satin eye mask with Bride crown print and adjustable black elastic strap - Coral Pink BRIDE with Crown (Style 2)
Adjustable faux silk bride eye mask with crown and elegant black lettering on white satin - Pearl White BRIDE with Crown (Style 3)
Champagne silk satin Bride eye mask with crown print and adjustable strap for wedding gifts - Champagne Gold BRIDE with Crown (Style 4)
+10
Satin Sleep Eye Mask Adjustable Strap Wedding Party Favors For Team Bride Bridesmaid Groomsman Light Blocking
-5%
$1.64
No MOQ
Free Shipping
Christmas Wine Bottle Cover Knitted Cartoon Santa Snowman Reindeer Embroidery Holiday Dinner Table Decor Party Favor
Christmas Wine Bottle Cover Knitted Cartoon Santa Snowman Reindeer Embroidery Holiday Dinner Table Decor Party Favor
like
Find Similar
Christmas snowman knitted wine bottle sweater and mini hat for festive holiday table decor - Snowman
Christmas wine bottle cover with Santa embroidery and red knit mini sweater set - Santa Claus
Christmas wine bottle cover with reindeer sweater and polka dot hat decoration - Elk Style
Christmas Wine Bottle Cover Knitted Cartoon Santa Snowman Reindeer Embroidery Holiday Dinner Table Decor Party Favor
$1.37
No MOQ
Unicorn Latex Balloon Assortment 12 Inch Confetti Balloons For Kids Birthday Wedding Party Decorations Favor
Unicorn Latex Balloon Assortment 12 Inch Confetti Balloons For Kids Birthday Wedding Party Decorations Favor
like
Find Similar
15pcs Rose Gold Unicorn Confetti Balloons with pink and white latex party decorations - Pink White Gold Confetti Unicorn Face Style (1)
15pcs rose gold confetti balloons and unicorn print latex party decorations set - Pink White Rose Gold Confetti Unicorn Face Style (2)
12-inch unicorn latex balloon set with pink, white and purple sequins for party decor - Pink White Purple Confetti Unicorn Face Style (3)
12-inch unicorn latex balloon set with pink, white and gold confetti variants - Pink White Gold Confetti Squinting Unicorn Style (4)
+14
NewUnicorn Latex Balloon Assortment 12 Inch Confetti Balloons For Kids Birthday Wedding Party Decorations Favor
$1.30
Mix MOQ : 2
Christmas Cake Toppers Mini Hats Reindeer Antlers Felt Acrylic Cupcake Decorative Inserts Party Favors
Christmas Cake Toppers Mini Hats Reindeer Antlers Felt Acrylic Cupcake Decorative Inserts Party Favors
like
Find Similar
Festive Christmas cupcake toppers and mini paper hats decorating assorted dessert jars - Pom Pom Hat Set A
Detailed view of eight mini Christmas party hats with red pom-poms for cake decoration - Pom Pom Hat Set B
5pcs set of 8x8cm red Christmas tree cake topper cards with Merry Christmas text - Style A Christmas Card
Green Christmas tree cake toppers with Merry & Bright text, 5 pieces per pack, 8x8cm size - Style B Christmas Card
+9
Christmas Cake Toppers Mini Hats Reindeer Antlers Felt Acrylic Cupcake Decorative Inserts Party Favors
-15%
$0.16-0.38
Mix MOQ : 2
 · 
10 views
Soccer Party Glasses World Cup Fans Cheering Props Novelty Sports Eyewear For Kids Adults Festival Costume Favors
Soccer Party Glasses World Cup Fans Cheering Props Novelty Sports Eyewear For Kids Adults Festival Costume Favors
like
Find Similar
Detail showing 16x12cm dimensions of the football party glasses with athlete silhouettes - Football Contention Black Purple
Detail view of soccer fan party glasses with size specs 15cm width and trophy decor - Soccer Trophy Celebration
Detail showing football party glasses dimensions 18.5x12.7cm with weight of 16.4g - Green Field Shooting
Detailed view of green football party glasses frame with 17x13cm dimension and weight info - FOOTBALL Stars
+29
Soccer Party Glasses World Cup Fans Cheering Props Novelty Sports Eyewear For Kids Adults Festival Costume Favors
$0.56
No MOQ
Christmas Decoration Glasses Reindeer Antlers Santa Snowman Christmas Tree Party Eyeglasses Frames Glitter Party Favors For Kids Adults
Christmas Decoration Glasses Reindeer Antlers Santa Snowman Christmas Tree Party Eyeglasses Frames Glitter Party Favors For Kids Adults
like
Find Similar
Festive Christmas party glasses featuring cute snowman designs with a white glitter finish. - Snowman Style (CHYJ-10)
Festive green glitter Christmas tree glasses frames with colorful pom-poms and gems for parties - Green Double Tree Style (CHYJ-15GR)
Festive red glitter Christmas glasses featuring cute Santa Claus characters for party fun. - Santa Claus Style (CHYJ-09)
Red glitter Christmas reindeer glasses for festive holiday party costume decoration - Red Antler with Rhinestone Style (CHYJ-11R)
+76
Christmas Decoration Glasses Reindeer Antlers Santa Snowman Christmas Tree Party Eyeglasses Frames Glitter Party Favors For Kids Adults
-6%
$0.30-0.50
Mix MOQ : 2
 · 
152 sold recently
Mexican Fiesta Beaded Necklace Cinco De Mayo Skull Sombrero Avocado Taco Pinata Pendant Party Favor Costume Accessory
Mexican Fiesta Beaded Necklace Cinco De Mayo Skull Sombrero Avocado Taco Pinata Pendant Party Favor Costume Accessory
like
Find Similar
Mexican Fiesta beaded necklace with orange trapezoid pendant and gold plastic beads - Mexican Shawl Style
Mexican Day of the Dead avocado necklace with sombrero and gold bead chain 48.5cm - Sombrero Avocado Style
Day of the Dead sugar skull necklace with colorful flowers and gold bead chain - Painted Skull Style
Cinco de Mayo beaded necklace featuring green pearls and a mini sombrero pendant charm - Sombrero Mustache Style
+6
Mexican Fiesta Beaded Necklace Cinco De Mayo Skull Sombrero Avocado Taco Pinata Pendant Party Favor Costume Accessory
$0.40
Mix MOQ : 2
Happy Birthday Decorative Glasses Glitter Plastic Novelty Eyewear Party Favors Photo Props Adult Kids
Happy Birthday Decorative Glasses Glitter Plastic Novelty Eyewear Party Favors Photo Props Adult Kids
like
Find Similar
Silver glitter Happy Birthday party glasses with red temples and dimension markings - Silver Birthday Letter Star Style
Blue glitter Happy Birthday party glasses with red temples and detailed size measurements - Blue Birthday Letter Star Style
Pink glitter Happy Birthday party glasses frame for kids with red temples and dimensions - Pink Birthday Letter Star Style
Silver glitter Happy Birthday party glasses with red temples and gold star accent - Silver Birthday Letter Gold Star Style
+5
Happy Birthday Decorative Glasses Glitter Plastic Novelty Eyewear Party Favors Photo Props Adult Kids
-5%
$0.55-0.64
Mix MOQ : 2
 · 
23 views
Happy New Year Headband 2026 Party Favors Glitter Star Gnome Crown Headband Photo Props For Celebration Decorations
Happy New Year Headband 2026 Party Favors Glitter Star Gnome Crown Headband Photo Props For Celebration Decorations
like
Find Similar
Gnome Happy New Year headband with gold star and purple polka dot hat design - New Year Headband / Hello Gnome Style
Purple Happy New Year headband with gnomes motif, 24cm by 16.5cm holiday party hair accessory - New Year Headband / Three Gnomes Style
Black heart New Year headband with Happy New Year print and sparkling silver tinsel - New Year Headband / Happy New Year Heart Style
Black New Year headband with silver stars and Cheers to the New Year lettering - New Year Headband / Cheers Toasting Style
+34
Happy New Year Headband 2026 Party Favors Glitter Star Gnome Crown Headband Photo Props For Celebration Decorations
$0.46-1.38
No MOQ
Mini Christmas Tree Colorful Sisal Frosting Wood Base Desktop Miniature Decoration Party Favors Holiday
Mini Christmas Tree Colorful Sisal Frosting Wood Base Desktop Miniature Decoration Party Favors Holiday
like
Find Similar
Set of 4 mini green cedar Christmas trees with snow effect and wooden bases for decor - Green (Pack of 4)
Set of 4 dark lake blue mini 10cm cedar Christmas trees with snow frost effect - Blue (Pack of 4)
Set of four mini golden cedar Christmas trees with snow tips and wooden bases - Gold (Pack of 4)
Set of four 10cm mini frosted cedar Christmas trees with natural round wooden bases - Silver (Pack of 4)
+6
Mini Christmas Tree Colorful Sisal Frosting Wood Base Desktop Miniature Decoration Party Favors Holiday
$2.25
No MOQ
Christmas Stickers Make A Face Puzzle Cartoon Santa Reindeer Snowman Kids Holiday Activity Party Favor Adhesive Paper
Christmas Stickers Make A Face Puzzle Cartoon Santa Reindeer Snowman Kids Holiday Activity Party Favor Adhesive Paper
like
Find Similar
DIY Christmas stickers featuring snowman Santa and reindeer for festive kids crafts - 6 Sheets/Pack
+6
Christmas Stickers Make A Face Puzzle Cartoon Santa Reindeer Snowman Kids Holiday Activity Party Favor Adhesive Paper
$0.61-4.84
No MOQ
 · 
21 views
Knitted Christmas Gnome Hanging Ornaments Faceless Doll Long White Beard Holiday Tree Decor Festive Party Home Favor
Knitted Christmas Gnome Hanging Ornaments Faceless Doll Long White Beard Holiday Tree Decor Festive Party Home Favor
like
Find Similar
Gray knitted Christmas gnome ornament hanging on a snowy tree with festive baubles - Style B
Close-up of red striped knit gnome plush ornament on snow-covered Christmas branches - Style D
Close-up of a red plush Christmas gnome hanging on a snowy pine branch with ornaments - Style F
Detail of a Christmas gnome hanging on a snowy tree with a red knitted hat and white beard - Style G
+4
Knitted Christmas Gnome Hanging Ornaments Faceless Doll Long White Beard Holiday Tree Decor Festive Party Home Favor
-4%
$0.60
Mix MOQ : 2
 · 
255 sold recently
American Flag Shutter Shades Glasses For Independence Day Patriotic Party Favors Fourth Of July Costume Eyewear Photo Props
American Flag Shutter Shades Glasses For Independence Day Patriotic Party Favors Fourth Of July Costume Eyewear Photo Props
like
Find Similar
Patriotic USA flag shutter glasses for Independence Day party and festive events - Standard Size / US Flag Style
American Flag Shutter Shades Glasses For Independence Day Patriotic Party Favors Fourth Of July Costume Eyewear Photo Props
-9%
$0.20
Mix MOQ : 12
 · 
13 views
Halloween Acrylic Keychain 2D Flat Ghost Pumpkin Skeleton Pattern Key Ring Festive Hanging Ornament Party Favor Gift
Halloween Acrylic Keychain 2D Flat Ghost Pumpkin Skeleton Pattern Key Ring Festive Hanging Ornament Party Favor Gift
like
Find Similar
Side view of 4cm acrylic Halloween keychain showing slim 0.25cm thickness and welcome art - Skeleton Bone Style (1)
Detail showing 0.25cm thickness of acrylic Halloween keychain with ghost design - Ghost Bat Spider Style (2)
Acrylic 2D Halloween ghost keychain featuring spider web and pumpkin motifs - Welcome Halloween Skeleton Style (3)
2D Acrylic Halloween Ghost Keychain with skeleton and pumpkin design, 0.25cm thickness - Pumpkin Skeleton Lantern Style (4)
+8
Halloween Acrylic Keychain 2D Flat Ghost Pumpkin Skeleton Pattern Key Ring Festive Hanging Ornament Party Favor Gift
-5%
$0.37
No MOQ
Christmas Theme Felt Non-Woven Gift Bag Cartoon Santa Claus Snowman Reindeer Gingerbread Man Candy Packaging Handbag Kids Party Favors
Christmas Theme Felt Non-Woven Gift Bag Cartoon Santa Claus Snowman Reindeer Gingerbread Man Candy Packaging Handbag Kids Party Favors
like
Find Similar
Gingerbread man Christmas gift bag in brown felt with dimensions and weight data - Christmas Tote Bag / Gingerbread Man
Red Christmas Santa felt gift bag with black belt and gold buckle 15.5x23cm - Christmas Tote Bag / Christmas Belt Style
Christmas reindeer felt gift bag in red and white with dimensions 22cm by 15.2cm - Christmas Tote Bag / Christmas Sock Style
Green non-woven Christmas gift bag with red glitter bow and tree cutouts 23x13cm - Christmas Tote Bag / Gift Box Pattern
+19
Christmas Theme Felt Non-Woven Gift Bag Cartoon Santa Claus Snowman Reindeer Gingerbread Man Candy Packaging Handbag Kids Party Favors
$0.44-1.16
No MOQ
Christmas Headband LED Glowing Santa Snowman Reindeer Antler Hair Hoop Festive Party Favors For Kids Adults
Christmas Headband LED Glowing Santa Snowman Reindeer Antler Hair Hoop Festive Party Favors For Kids Adults
like
Find Similar
Classic green Christmas tree headband with spring-loaded stars and white snowflakes - Standard (Green Tree)
Christmas headband with red velvet band and Santa Claus figures on metal springs - Standard (Santa Claus)
Christmas snowman headband with festive red snowflake hats and bows on white background - Standard (Snowman)
Christmas headband featuring red gloves with snowflake pattern on spring bobbles - Standard (Gloves)
+19
Christmas Headband LED Glowing Santa Snowman Reindeer Antler Hair Hoop Festive Party Favors For Kids Adults
-5%
$0.56-1.18
Mix MOQ : 60
 · 
12 sold recently
Christmas DIY Stickers For Kids Make A Face Puzzle Toys Santa Snowman Reindeer Elf Cartoon Decorative Party Favors
Christmas DIY Stickers For Kids Make A Face Puzzle Toys Santa Snowman Reindeer Elf Cartoon Decorative Party Favors
like
Find Similar
DIY Christmas stickers for kids featuring Santa, reindeer, and snowman cartoon characters - 10 Sheets/Set
Christmas DIY Stickers For Kids Make A Face Puzzle Toys Santa Snowman Reindeer Elf Cartoon Decorative Party Favors
$1.73-6.92
No MOQ
 · 
21 views
St. Patrick's Day Headband Green Shamrock Leprechaun Hat Hair Accessory For Irish Festival Party Favors Festive Headpiece
St. Patrick's Day Headband Green Shamrock Leprechaun Hat Hair Accessory For Irish Festival Party Favors Festive Headpiece
like
Find Similar
Saint Patrick's Day headband with gold hat and champagne bottle design for party - Beer Bottle Tinsel Headband
Green and gold glitter shamrock headband for St. Patrick's Day party with measurements - Mixed Gold & Green Shamrock Headband
St. Patrick's Day green tinsel headband with shamrocks and gold mini hat decoration - Shamrock Hat Tinsel Headband
Green tinsel St. Patrick's Day headband with clover and daisy decorations - Flower & Shamrock Tinsel Headband
+34
St. Patrick's Day Headband Green Shamrock Leprechaun Hat Hair Accessory For Irish Festival Party Favors Festive Headpiece
$0.55-1.30
No MOQ
Cute Angel Elf Plush Pendant Christmas Tree Hanging Ornament Faux Fur Ball Doll For Holiday Home Decor Party Favors Gift
Cute Angel Elf Plush Pendant Christmas Tree Hanging Ornament Faux Fur Ball Doll For Holiday Home Decor Party Favors Gift
like
Find Similar
Pink plush angel Christmas ornament with grey wings and hanging rope, 9cm height - Pink Fur Ball Angel (Style N)
Cute Angel Elf Plush Pendant Christmas Tree Hanging Ornament Faux Fur Ball Doll For Holiday Home Decor Party Favors Gift
$2.82
Mix MOQ : 2
 · 
13 views
Free Shipping
Ocean Animal Party Headband And Glasses Cute Shark Turtle Dolphin Seahorse Crab Kids Birthday Costume Party Favor Supplies
Ocean Animal Party Headband And Glasses Cute Shark Turtle Dolphin Seahorse Crab Kids Birthday Costume Party Favor Supplies
like
Find Similar
Cartoon green turtle headband for ocean parties with glitter shell details and dimensions - One Size / Big Turtle Style
Funny green seahorse headband with gold glitter details for ocean party costumes - One Size / Green Seahorse Style
Cute blue sequined shark headband for kids party decorations with size measurements - One Size / Blue Shark Style
Blue felt dolphin headband for ocean theme birthdays with dimensions and size marking - One Size / Big Dolphin Style
+8
Ocean Animal Party Headband And Glasses Cute Shark Turtle Dolphin Seahorse Crab Kids Birthday Costume Party Favor Supplies
$0.45-0.84
Mix MOQ : 2
Easter Headband Bunny Ears Chick Egg Carrot Plastic Felt Glitter Hair Accessories Holiday Party Favor For Kids Adults
Easter Headband Bunny Ears Chick Egg Carrot Plastic Felt Glitter Hair Accessories Holiday Party Favor For Kids Adults
like
Find Similar
Easter purple headband featuring yellow chicks and feathers with dimensions 22x18cm - Easter Egg Chick with Feather
Easter headband dimensions showing 22cm height and Happy Easter rabbit egg design - Bunny Carrot Letter Style
Detailed size and weight view of the purple and pink Easter bunny headband with eggs - Bunny Egg Letter Style
Easter headband with yellow chick and Happy Easter sign showing dimensions and weight - Sunglasses Chick Letter Style
+17
Easter Headband Bunny Ears Chick Egg Carrot Plastic Felt Glitter Hair Accessories Holiday Party Favor For Kids Adults
$0.52-0.72
Mix MOQ : 2
 · 
17 sold recently
Christmas Glasses Frames Glitter Reindeer Antler Snowflake Santa Hat Xmas Party Favors Holiday Photo Props Costume Accessory
Christmas Glasses Frames Glitter Reindeer Antler Snowflake Santa Hat Xmas Party Favors Holiday Photo Props Costume Accessory
like
Find Similar
Sparkly red HO HO Christmas party glasses with white snowflakes, size 14cm by 10cm - HOHO Red Glasses
Christmas reindeer antler glasses with red and green sequins, 16cm wide party frame - Large Antler Green Beard
Golden Christmas tree glasses with reversible sequins and Merry Christmas text decor - Colorful Christmas Tree
Christmas party glasses frame with red sequins, white fur and glittery snowflakes - Red Snowflake Hat Glasses
+19
Christmas Glasses Frames Glitter Reindeer Antler Snowflake Santa Hat Xmas Party Favors Holiday Photo Props Costume Accessory
-5%
$0.74
Mix MOQ : 2
Kids Christmas Cartoon Resin Rings Set Santa Claus Reindeer Snowman Adjustable Pink Plastic Finger Rings Party Favors
Kids Christmas Cartoon Resin Rings Set Santa Claus Reindeer Snowman Adjustable Pink Plastic Finger Rings Party Favors
like
Find Similar
Cute resin Santa Claus head charm with red hat and white beard for DIY ring making - Santa Claus Head Style 1
Festive Santa Claus resin rings for kids featuring red hats and pink bands in a two-piece set - Santa Claus Head Style 2
Children's festive Christmas ring set featuring red bow and golden bell on pink band - Bell Style 1
Kids' resin Christmas rings set featuring yellow bells and a festive red bow - Bell Style 2
+11
Kids Christmas Cartoon Resin Rings Set Santa Claus Reindeer Snowman Adjustable Pink Plastic Finger Rings Party Favors
$0.11
Mix MOQ : 10
St Patrick's Day Green Headband With Shamrock Leprechaun Top Hat Lucky Letters Sequin Bow For Party Decoration Favors
St Patrick's Day Green Headband With Shamrock Leprechaun Top Hat Lucky Letters Sequin Bow For Party Decoration Favors
like
Find Similar
Detail of St. Patrick’s Day headband showing green tinsel wreath with small golden bells - Irish Headband / Shamrock Bells Style
Detailed dimensions of St. Patrick's Day headband with green bows and shamrock sequins - Irish Headband / Shamrock Tinsel Bowknot Style
Detail view of St. Patrick's Day headband with shamrock sequins and spring pom-poms - Irish Headband / Tinsel Shamrock Pot Style
Detailed view of St. Patrick's Day headband with green shamrocks and dimensions info - Irish Headband / Shamrock Green Tinsel Style
+21
St Patrick's Day Green Headband With Shamrock Leprechaun Top Hat Lucky Letters Sequin Bow For Party Decoration Favors
$0.55-1.30
Mix MOQ : 2
Christmas Headband Decorations Xmas Tree Snowman Tinsel Hair Hoop Elk Snowflake Gingerbread Man For Xmas Holiday Party Favors
Christmas Headband Decorations Xmas Tree Snowman Tinsel Hair Hoop Elk Snowflake Gingerbread Man For Xmas Holiday Party Favors
like
Find Similar
Christmas headband dimensions and weight featuring red socks and festive green tinsel - Bell Christmas Sock Style
Christmas headband dimensions detail showing 25cm height and 22cm width on white background - Snowflake Christmas Hat Style
Detailed dimensions and weight of Christmas headband with tinsel, berries and bells - Bell Star Style
Detailed size chart for Christmas headband featuring dimensions and weight information - Christmas Tree Ball Style
+11
NewChristmas Headband Decorations Xmas Tree Snowman Tinsel Hair Hoop Elk Snowflake Gingerbread Man For Xmas Holiday Party Favors
-3%
$0.78-1.33
No MOQ
Christmas Reindeer Antler Headbands Plush Santa Hat Hair Hoops With Bells For Holiday Party Favors Costume Dress Up
Christmas Reindeer Antler Headbands Plush Santa Hat Hair Hoops With Bells For Holiday Party Favors Costume Dress Up
like
Find Similar
Christmas reindeer headband with gold antlers, white fur, and red holly berries detail - Gold Classic Antlers
Christmas headband with red Santa hat and plush beard on a holiday background - Santa Beard Pointed Hat
Red Christmas headband featuring a mini Santa hat with white fur trim and a black belt - Belt Style Pointed Hat
Christmas headband with gold reindeer antlers, white faux fur, and festive red bell - Gold Cartoon Antlers
+2
Christmas Reindeer Antler Headbands Plush Santa Hat Hair Hoops With Bells For Holiday Party Favors Costume Dress Up
-5%
$0.55
No MOQ
Christmas Inflatable Foil Balloons Cartoon Santa Claus Snowman Reindeer Headbands Wristbands Holiday Party Decorations Favors
Christmas Inflatable Foil Balloons Cartoon Santa Claus Snowman Reindeer Headbands Wristbands Holiday Party Decorations Favors
like
Find Similar
Inflatable Christmas headband with Santa Claus cartoon motif for holiday party decor - Christmas Headband Balloon
Christmas Inflatable Foil Balloons Cartoon Santa Claus Snowman Reindeer Headbands Wristbands Holiday Party Decorations Favors
$0.06
No MOQ
 · 
30 sold recently
Christmas Velvet Drawstring Gift Bag Apple Candy Storage Pouch With Bow Bell Festive Party Favor Holiday Decor
Christmas Velvet Drawstring Gift Bag Apple Candy Storage Pouch With Bow Bell Festive Party Favor Holiday Decor
like
Find Similar
Dark green velvet Christmas drawstring gift bag with Santa Claus print and golden bell - Small 【10*13cm】 / Dark Green - Bow Double Snowman Logo
Dark green velvet Christmas drawstring gift bag with gold Merry Christmas lettering - Small 【10*13cm】 / Dark Green - Bow Antlers Logo
Dark green velvet Christmas drawstring gift bag with gold Merry Christmas print and bell - Small 【10*13cm】 / Dark Green - Bow Christmas Tree Logo
Dark green velvet Christmas apple gift bag with red bow and Santa Claus print - Small 【10*13cm】 / Dark Green - Bow Single Snowman Logo
+8
Christmas Velvet Drawstring Gift Bag Apple Candy Storage Pouch With Bow Bell Festive Party Favor Holiday Decor
$0.77-0.85
No MOQ
Christmas Party Decorative Eyeglass Frames Glitter Plastic Festive Photo Props Reindeer Antler Santa Claus Holiday Favors
Christmas Party Decorative Eyeglass Frames Glitter Plastic Festive Photo Props Reindeer Antler Santa Claus Holiday Favors
like
Find Similar
Golden Merry Christmas glitter party glasses showing dimensions of 11cm by 15.5cm - Golden Merry Christmas
Detailed view of gold glitter Christmas tree glasses with multi-color sequins and Merry Christmas text - Colorful Christmas Tree
Christmas tree party glasses with colorful pompoms and rhinestones, size 14.5x11.8cm - Dark Green Christmas Tree
Christmas party glasses with red reindeer antlers and glitter finish for festive costumes - Red Antler Glitter
+8
Christmas Party Decorative Eyeglass Frames Glitter Plastic Festive Photo Props Reindeer Antler Santa Claus Holiday Favors
$0.37-0.58
No MOQ
 · 
17 sold recently
Christmas Headband Non-Woven Fabric Spring Santa Snowman Reindeer Xmas Party Favor Holiday Hair Hoop Cosplay Decoration
Christmas Headband Non-Woven Fabric Spring Santa Snowman Reindeer Xmas Party Favor Holiday Hair Hoop Cosplay Decoration
like
Find Similar
Christmas headband with 3D Santa Claus figures in red fabric, size 25x12CM for parties - Santa Claus Spring Headband
Christmas snowman headband with red spring design for kids party gift, 25x12cm size - Snowman Spring Headband
Christmas reindeer antler headband with white fur and red bows, size 25x12cm - Reindeer Spring Headband
Christmas party headband with plush white bears wearing red hats and bows, 25x12cm - Bear Spring Headband
+4
Christmas Headband Non-Woven Fabric Spring Santa Snowman Reindeer Xmas Party Favor Holiday Hair Hoop Cosplay Decoration
-4%
$0.47
No MOQ
 · 
229 sold recently
Christmas Cake Toppers Soft Glue Santa Claus Reindeer Gingerbread House Tree Dessert Decorations Festive Party Favors
Christmas Cake Toppers Soft Glue Santa Claus Reindeer Gingerbread House Tree Dessert Decorations Festive Party Favors
like
Find Similar
Christmas tree cake topper with red bow and colorful balls, 2.8cm wide and 4.7cm high - New 3D Christmas Tree
Detail view of 6cm tall spotted fawn cake topper figurine on star patterned tulle - Sika Deer
Detail of 5cm golden reindeer cake topper with metallic finish on white background - Golden Reindeer
Soft PVC Santa Claus cake topper decoration with Merry Christmas text for holiday desserts - Soft Glue Santa Claus Sign
+7
Christmas Cake Toppers Soft Glue Santa Claus Reindeer Gingerbread House Tree Dessert Decorations Festive Party Favors
$0.05-0.46
Mix MOQ : 100
Christmas Wooden Hanging Ornaments 3D Layered Santa Snowman Reindeer Tags For Holiday Tree Decor Party Favors
Christmas Wooden Hanging Ornaments 3D Layered Santa Snowman Reindeer Tags For Holiday Tree Decor Party Favors
like
Find Similar
Wooden Christmas hanging tag with 3D Santa Claus figure and hoho engraving on white background - Santa Claus
Christmas wooden snowman hanging ornament with SNOW sign and rustic hemp rope hanger - Snowman
Christmas reindeer wooden hanging tag with red nose and bright text for tree decor - Elk Style
Wooden Nutcracker Christmas tag with merry text and twine for tree decoration - KING Style
+2
Christmas Wooden Hanging Ornaments 3D Layered Santa Snowman Reindeer Tags For Holiday Tree Decor Party Favors
-4%
$0.47
Mix MOQ : 2
 · 
181 sold recently
Halloween Window Clings Double Sided Static PVC Stickers For Glass Decoration Cartoon Pumpkin Ghost Witch Party Favors
Halloween Window Clings Double Sided Static PVC Stickers For Glass Decoration Cartoon Pumpkin Ghost Witch Party Favors
like
Find Similar
9 sheets of Halloween window clings featuring witches and pumpkins, size 20x30cm per sheet - Cartoon Monsters Theme (WSJ05)
Detail of 9-sheet Halloween static window decals set with pumpkins and ghosts - Gnome Pumpkin Theme (W12)
Set of 9 Halloween static window decals featuring gnomes and pumpkins, 20x30cm size - Elf Bat Theme (W13)
Halloween window clings featuring black witch and castle silhouettes, 9-sheet set - Black Silhouette Theme (W14)
+12
Halloween Window Clings Double Sided Static PVC Stickers For Glass Decoration Cartoon Pumpkin Ghost Witch Party Favors
$2.45
No MOQ
Go to

More in party supplies

Explore more in favor boxes

partygoldartificialdecorativeheartstoragehandmadestorage boxtagsdecoration accessories
hollowshapesquarewindowsmalltasselwrappingflippackaging baggift wrapping

Ready to source like an insider

Get a direct line to the factory floor — no minimums, no middlemen, no guesswork.
iconReal factory pricing, no markup in betweeniconEvery order hand-inspected before it shipsicon5,000+ new products added daily
Get Inside Access