Everful

Wholesale steel bottles

Factory-direct selection, vetted for quality and ready to order.

Sign Up
Steel Bottles

Find the perfect pieces: vacuum flasks & thermoses, tumblers, mugs and more

filterShow Filters
Best Seller
New Arrivals
Price Drop
Free Shipping
Pink Heart Wine Bottle Stopper Reusable Metal Decorative Beverage Sealer For Home Bar Wedding Party Gift
Pink Heart Wine Bottle Stopper Reusable Metal Decorative Beverage Sealer For Home Bar Wedding Party Gift
like
Find Similar
Pink heart shaped wine bottle stopper with metal base and silicone sealing ring - Heart / Pink Leather Ring Heart Wine Stopper
Pink Heart Wine Bottle Stopper Reusable Metal Decorative Beverage Sealer For Home Bar Wedding Party Gift
-4%
$1.93
Mix MOQ : 2
 · 
27 views
Minimalist Borosilicate Glass Water Bottle With PU Leather Sleeve And Tea Strainer Portable Leakproof Office Travel Drinkware
Minimalist Borosilicate Glass Water Bottle With PU Leather Sleeve And Tea Strainer Portable Leakproof Office Travel Drinkware
like
Find Similar
Close-up of glass tea cup with blue-grey faux leather sleeve and carrying strap - 550ml / Blue
Close-up of glass bottle with orange leather sleeve and ONE CUP embossing - 550ml / Orange
Detail of hand holding glass tumbler with black leather sleeve and integrated tea infuser - 550ml / Black
Close-up of glass tea cup with beige leather sleeve and One Cup printed detail - 550ml / White
Minimalist Borosilicate Glass Water Bottle With PU Leather Sleeve And Tea Strainer Portable Leakproof Office Travel Drinkware
$3.17
No MOQ
 · 
14 views
Glitter Bowknot Water Bottle Accessories For Large Capacity Tumbler Silicone Boot Straw Cover Metal Charm Decoration Women
Glitter Bowknot Water Bottle Accessories For Large Capacity Tumbler Silicone Boot Straw Cover Metal Charm Decoration Women
like
Find Similar
Blue Stanley cup accessory set with glitter bow, straw cover and silicone boot for 40oz bottle - Style 1
Pink glitter accessory set with bow and charms for 30/40oz Stanley tumblers - Style 2
Red butterfly accessory kit for 40oz tumblers with silicone boot and glitter charms - Style 3
Pink tumbler accessories set with glitter bow, butterfly straw cover, and gold chains - Style 4
Glitter Bowknot Water Bottle Accessories For Large Capacity Tumbler Silicone Boot Straw Cover Metal Charm Decoration Women
-4%
$5.20
Mix MOQ : 3
Portable Square Flat Water Bottle Plastic BPA Free Leakproof Frosted Sport Kettle With Handle Outdoor Minimalist Modern
Portable Square Flat Water Bottle Plastic BPA Free Leakproof Frosted Sport Kettle With Handle Outdoor Minimalist Modern
like
Find Similar
Matte grey flat square water bottle with portable strap and lemon slice inside - 450ml / Black
Minimalist white square water bottle with striped texture and portable handle strap - 450ml / Pure White
Flat minimalist square water bottle with light blue lid and portable strap handle - 450ml / Blue
Sleek gray flat square water bottle with portable loop held in a hand - 450ml / Gray
+1
Portable Square Flat Water Bottle Plastic BPA Free Leakproof Frosted Sport Kettle With Handle Outdoor Minimalist Modern
-5%
$3.23
No MOQ
Rectangle Stainless Steel Tea Tray Perforated Drainage Plate Set For Home Kitchen Serving Cooling Baking Multi-purpose Storage Tray
Rectangle Stainless Steel Tea Tray Perforated Drainage Plate Set For Home Kitchen Serving Cooling Baking Multi-purpose Storage Tray
like
Find Similar
Large rectangular stainless steel tray set with drainer plate, 49.5x44.5cm dimension - Natural
Black rectangle stainless steel tray set with oil drain holes for grilling and baking - Black
Two-piece rose gold rectangular stainless steel baking tray set with drainage colander - Rose Gold
Rectangle Stainless Steel Tea Tray Perforated Drainage Plate Set For Home Kitchen Serving Cooling Baking Multi-purpose Storage Tray
$7.13-19.72
Mix MOQ : 2
 · 
12 views
Coffee Capsule Holder Metal Storage Basket Mug Shape Iron Art Coffee Pod Organizer For Countertop Modern Minimalist
Coffee Capsule Holder Metal Storage Basket Mug Shape Iron Art Coffee Pod Organizer For Countertop Modern Minimalist
like
Find Similar
Golden cup-shaped metal coffee capsule storage basket with engraved COFFEE tag - Coffee Cup Style / Gold
Black metal wire coffee capsule storage basket with COFFEE logo sign in medium size - Coffee Cup Style / Black
Golden mug-shaped coffee pod holder basket with a cutout design and handle - Teapot Style / Gold
Black metal coffee capsule holder with cup design and hollow COFFEE text, 19cm wide - Teapot Style / Black
Coffee Capsule Holder Metal Storage Basket Mug Shape Iron Art Coffee Pod Organizer For Countertop Modern Minimalist
-5%
$1.67-2.08
Mix MOQ : 2
Mini Champagne Wine Stopper ABS Food Grade Silicone Rotational Vacuum Seal Leakproof Cap Preservation Bar Accessories
Mini Champagne Wine Stopper ABS Food Grade Silicone Rotational Vacuum Seal Leakproof Cap Preservation Bar Accessories
like
Find Similar
Mini black ABS plastic champagne stopper with lock icons and non-slip grooves - ABS / Food-grade Silicone / Champagne Stopper / Rotating Lock / Fits 17.5-18mm Bottle
Miniature black matte ABS wine stopper with lock icons and premium retail packaging - ABS / Food-grade Silicone / Wine Stopper / Rotating Lock / Fits 18-19mm Bottle
Electric salt and pepper grinder set KYMQ-64C with dual mills and charging base - 110ml / Electric Pepper Grinder Set / 2 Pack / With Charging Base
Mini Champagne Wine Stopper ABS Food Grade Silicone Rotational Vacuum Seal Leakproof Cap Preservation Bar Accessories
-5%
$0.71-20.26
Mix MOQ : 2
 · 
176 sold recently
Sports Shaker Bottle PP Plastic Protein Powder Mixing Cup With Scale And Mixing Ball For Gym Fitness
Sports Shaker Bottle PP Plastic Protein Powder Mixing Cup With Scale And Mixing Ball For Gym Fitness
like
Find Similar
Pink and white protein shaker bottle with mixing ball for fitness and sports gym use - 500ml / Pink
Yellow protein shaker bottle set with mixing ball and scale on wooden table - 700ml / Yellow
Sports Shaker Bottle PP Plastic Protein Powder Mixing Cup With Scale And Mixing Ball For Gym Fitness
$1.15-1.30
No MOQ
Portable 304 Stainless Steel Insulated Soup Cup Thermal Food Jar With Folding Spoon Silicone Handle For Student Office
Portable 304 Stainless Steel Insulated Soup Cup Thermal Food Jar With Folding Spoon Silicone Handle For Student Office
like
Find Similar
Deep green portable 304 stainless steel insulated soup cup with silicone handle - Green
Portable 304 Stainless Steel Insulated Soup Cup Thermal Food Jar With Folding Spoon Silicone Handle For Student Office
-5%
$3.50
No MOQ
Cute Cartoon Dog 304 Stainless Steel Mouthwash Cup Kawaii Toothbrush Tumbler For Home Dormitory Stackable Durable
Cute Cartoon Dog 304 Stainless Steel Mouthwash Cup Kawaii Toothbrush Tumbler For Home Dormitory Stackable Durable
like
Find Similar
Detail of cream stainless steel cup with cartoon dachshund and happy family quote - Beige Striped Dog
Detailed macro view of the stainless steel cup with a cute cartoon dog illustration - Silver Cow Dog
Beige dachshund puppy ceramic mouthwash cup with cute cartoon dog illustration - Beige Star Dog
Cartoon dachshund stainless steel toothbrush cup with happy family quote in silver finish - Silver Angel Dog
+3
Cute Cartoon Dog 304 Stainless Steel Mouthwash Cup Kawaii Toothbrush Tumbler For Home Dormitory Stackable Durable
$2.20
No MOQ
Multi Functional Bottle Opener Manual Jar Lid Remover Magnetic Kitchen Tool For Cans Soda Tabs Non Slip Japanese Style
Multi Functional Bottle Opener Manual Jar Lid Remover Magnetic Kitchen Tool For Cans Soda Tabs Non Slip Japanese Style
like
Find Similar
Yellow multifunctional 5-in-1 jar opener with magnetic back and ergonomic grip - Large / Yellow
Multifunctional white kitchen jar opener tool with serrated edges in a sleek triangular design - Extra Large / White
White multi-functional jar opener with triangular design and transparent plastic finish - Extra Large / Clear
Multifunctional yellow jar opener with non-slip serrated edge and integrated pry tool - Extra Large / Yellow
+4
Multi Functional Bottle Opener Manual Jar Lid Remover Magnetic Kitchen Tool For Cans Soda Tabs Non Slip Japanese Style
-5%
$2.05-3.01
No MOQ
Cute Cartoon Dog Toothbrush Mug 304 Stainless Steel Mouthwash Cup Bathroom Tumbler Home Use
Cute Cartoon Dog Toothbrush Mug 304 Stainless Steel Mouthwash Cup Bathroom Tumbler Home Use
like
Find Similar
Detailed macro view of the stainless steel cup with a cute cartoon dog illustration - Silver Cow Dog
Detail of cream stainless steel cup with cartoon dachshund and happy family quote - Beige Striped Dog
Blue Dachshund dog themed stainless steel mouthwash cup with toothbrush and toothpaste set - Dog Family - Blue
Beige dachshund themed cup with cartoon pet illustrations and inspirational English text - Dog Family - Beige
+3
Cute Cartoon Dog Toothbrush Mug 304 Stainless Steel Mouthwash Cup Bathroom Tumbler Home Use
$2.20
No MOQ
Foldable Water Bottle Food Grade Silicone Collapsible Portable Sports Kettle With Carabiner Spiral Non-Slip Design
Foldable Water Bottle Food Grade Silicone Collapsible Portable Sports Kettle With Carabiner Spiral Non-Slip Design
like
Find Similar
Collapsible silicone sports water bottle in dual-tone blue with metal carabiner clip - 500ml / Classic Blue
Collapsible beige silicone sports water bottle with brown lid and metal carabiner clip - 500ml / Coffee
Collapsible silicone sports bottle in Morandi green with textured grip and silver carabiner - 500ml / Vanilla Green
Foldable Water Bottle Food Grade Silicone Collapsible Portable Sports Kettle With Carabiner Spiral Non-Slip Design
-4%
$4.96
No MOQ
304 Stainless Steel Oil Filter Pot With Fine Mesh Strainer And Lid Brushed Large Capacity Lard Storage Container For Kitchen Cooking
304 Stainless Steel Oil Filter Pot With Fine Mesh Strainer And Lid Brushed Large Capacity Lard Storage Container For Kitchen Cooking
like
Find Similar
Stainless steel 2.8L oil container with fine mesh strainer and lid on white background - Silver
Three-piece golden stainless steel oil container set with lid and mesh filter tray - Gold
Rose gold stainless steel oil container set with mesh strainer and lid, 2.8L capacity - Rose Gold
Rainbow stainless steel oil strainer pot with lid and fine mesh filter 2.8L set - AB Color
304 Stainless Steel Oil Filter Pot With Fine Mesh Strainer And Lid Brushed Large Capacity Lard Storage Container For Kitchen Cooking
$8.49-13.80
Mix MOQ : 2
Studded Tumbler Double Wall Holographic Laser Gradient Plastic Straw Cup With Heart Charm Reusable Large Capacity Drinkware
Studded Tumbler Double Wall Holographic Laser Gradient Plastic Straw Cup With Heart Charm Reusable Large Capacity Drinkware
like
Find Similar
Pink purple gradient heart straw cup with grid texture and Hug Me decorative charm - 800ML / Glitter Paper
Iridescent textured diamond plastic straw cup with purple Sweet Heart decoration - 800ML / Holographic
Studded Tumbler Double Wall Holographic Laser Gradient Plastic Straw Cup With Heart Charm Reusable Large Capacity Drinkware
$6.34
Mix MOQ : 2
 · 
18 views
Professional 304 Stainless Steel Manual Knife Sharpener Triple Slot Sharpening Tool With Non Slip Base For Kitchen Chef Knives
Professional 304 Stainless Steel Manual Knife Sharpener Triple Slot Sharpening Tool With Non Slip Base For Kitchen Chef Knives
like
Find Similar
3-stage manual knife sharpener set with stainless steel chef and cleaver knives - Natural
Rainbow titanium-coated kitchen knife set with cylindrical 3-stage knife sharpener - Sharpener Chef Knife And Roast Knife Style (Iridescent) / AB Color
Brushed gold 3-piece kitchen knife set including cleaver, santoku knife and 3-stage sharpener - Sharpener Chef Knife And Roast Knife Style (Gold) / Gold
Manual 3-stage knife sharpener in brushed metallic finish with ergonomic cylinder handle - Knife Sharpener (Original) / Natural
+3
Professional 304 Stainless Steel Manual Knife Sharpener Triple Slot Sharpening Tool With Non Slip Base For Kitchen Chef Knives
$15.17-24.72
Mix MOQ : 2
Modern 304 Stainless Steel Mini Milk Pot With Double Spouts Three Layer Bottom For Butter Chocolate Melting Sauce Pan
Modern 304 Stainless Steel Mini Milk Pot With Double Spouts Three Layer Bottom For Butter Chocolate Melting Sauce Pan
like
Find Similar
Mini 304 stainless steel melting pot with pouring spout and long flat handle - Natural Silver (5055027442650)
Mini gold 304 stainless steel heating pot with pour spouts and long handle - 304 Mini Pot - Gold
Mini stainless steel melting pot with rose gold coating and long handle on white background - 304 Mini Pot - Rose Gold
Rainbow mini stainless steel melting pot with long handle and dual pour spouts - 304 Mini Pot - Iridescent
Modern 304 Stainless Steel Mini Milk Pot With Double Spouts Three Layer Bottom For Butter Chocolate Melting Sauce Pan
$8.34-9.56
Mix MOQ : 2
Pink Floral Water Bottle Accessory Decoration With Woven Strap Silicone Boot Straw Cover Heart Leak Stopper Charm Jewelry
Pink Floral Water Bottle Accessory Decoration With Woven Strap Silicone Boot Straw Cover Heart Leak Stopper Charm Jewelry
like
Find Similar
Pink accessories set for 30oz and 40oz tumblers with straw cover and woven flower straps - Pink Floral Accessory Set (Style 1)
Pink Floral Water Bottle Accessory Decoration With Woven Strap Silicone Boot Straw Cover Heart Leak Stopper Charm Jewelry
-11%
$4.82
Mix MOQ : 3
Fashion Tumbler Accessories Set For 40oz 30oz Cup With Cloud Straw Cover Heart Charm Silicone Boot Braided Strap For Women
Fashion Tumbler Accessories Set For 40oz 30oz Cup With Cloud Straw Cover Heart Charm Silicone Boot Braided Strap For Women
like
Find Similar
Pink and white tumbler set with woven handle, shoulder strap, and floral charm accessory - Pink And White Style (Style 1)
Fashion Tumbler Accessories Set For 40oz 30oz Cup With Cloud Straw Cover Heart Charm Silicone Boot Braided Strap For Women
-11%
$4.56
Mix MOQ : 3
Portable Pill Case Titanium Alloy Stainless Steel Waterproof Sealed Capsule Storage Bottle Keychain For Outdoor Emergency Medicine
Portable Pill Case Titanium Alloy Stainless Steel Waterproof Sealed Capsule Storage Bottle Keychain For Outdoor Emergency Medicine
like
Find Similar
Mini stainless steel waterproof capsule pendant container 30mm for pills and emergencies - Stainless Steel Small
Mini titanium alloy waterproof pill capsule container in gunmetal grey finish - Titanium Alloy Medium
Small titanium waterproof pill capsule container in silver gray with 30mm height - Titanium Alloy Small
Titanium alloy portable pill case with matte metal grey finish and top hanging hole - Titanium Alloy Large
+2
Portable Pill Case Titanium Alloy Stainless Steel Waterproof Sealed Capsule Storage Bottle Keychain For Outdoor Emergency Medicine
$2.88-10.58
Mix MOQ : 2
 · 
58 views
Free Shipping
Mens Folding Beard Comb Stainless Steel Handle Acetate Teeth Portable Pocket Hair Styling With Bottle Opener Vintage
Mens Folding Beard Comb Stainless Steel Handle Acetate Teeth Portable Pocket Hair Styling With Bottle Opener Vintage
like
Find Similar
Men's portable folding comb with grey handle and black teeth for mustache styling - Electroplated Stainless Steel/Acetate / Electroplated Grey Fine Teeth Folding Comb
Folding pocket comb with silver metal handle and brown teeth for men hair styling - Stainless Steel/PP Plastic / Amber Fine Teeth Folding Comb
Mens Folding Beard Comb Stainless Steel Handle Acetate Teeth Portable Pocket Hair Styling With Bottle Opener Vintage
$2.25-2.54
No MOQ
 · 
83 sold recently
304 Stainless Steel Straw Cleaning Brushes Nylon Flexible Long Handle For Reusable Straws Bottles Pipes Nipple
304 Stainless Steel Straw Cleaning Brushes Nylon Flexible Long Handle For Reusable Straws Bottles Pipes Nipple
like
Find Similar
336 options
304 Stainless Steel Straw Cleaning Brushes Nylon Flexible Long Handle For Reusable Straws Bottles Pipes Nipple
$0.07-1.73
Mix MOQ : 2
 · 
2K+ sold recently
Luxury Business Souvenir Gift Set With Insulated Thermos Stainless Steel Water Bottle Folding Umbrella Mini Handheld Fan
Luxury Business Souvenir Gift Set With Insulated Thermos Stainless Steel Water Bottle Folding Umbrella Mini Handheld Fan
like
Find Similar
Elegant BP-05 gift set featuring a bamboo glass cup, fabric notebook and golden key pen - Glass Cup + Notebook + Key Pen Set (BP-05) / White
Elegant white vacuum flask and face towel gift box set with marble texture lid - White Bp-17
Elegant corporate gift set with white coffee mug and beige notebook in marble box - White Bp-24
Elegant white gift set featuring a coffee cup, soft face towel, and folding umbrella - White Bp-30
+189
Luxury Business Souvenir Gift Set With Insulated Thermos Stainless Steel Water Bottle Folding Umbrella Mini Handheld Fan
$2.16-9.22
No MOQ
 · 
22 views
Glass Soap Dispenser Bottle With Natural Crystal Stones And 304 Stainless Steel Pump Refillable Lotion Bottle Bathroom
Glass Soap Dispenser Bottle With Natural Crystal Stones And 304 Stainless Steel Pump Refillable Lotion Bottle Bathroom
like
Find Similar
Soap dispenser with white crystal base and brushed silver pump on glass bottle - White Crystal
Glass lotion dispenser with pink crystal stones and a brushed stainless steel pump - Rose Quartz
Glass lotion dispenser with red agate crystals and stainless steel pump - Red Agate
Glass soap dispenser with tiger's eye crystals and stainless steel pump head - Tiger's Eye
+14
Glass Soap Dispenser Bottle With Natural Crystal Stones And 304 Stainless Steel Pump Refillable Lotion Bottle Bathroom
-5%
$9.36-12.32
No MOQ
 · 
53 views
Multifunctional Retractable Cup Brush Bottle Cleaner With Straw Brush And Gap Brush ABS Nylon Stainless Steel White Long Handle Kitchen Household
Multifunctional Retractable Cup Brush Bottle Cleaner With Straw Brush And Gap Brush ABS Nylon Stainless Steel White Long Handle Kitchen Household
like
Find Similar
White retractable long handle cup brush set with hidden straw and gap cleaning tools - Extendable Long Handle Style / White
Multifunctional Retractable Cup Brush Bottle Cleaner With Straw Brush And Gap Brush ABS Nylon Stainless Steel White Long Handle Kitchen Household
-4%
$2.00
No MOQ
304 Stainless Steel Oil Strainer Pot With Fine Mesh Filter Dustproof Grease Storage Container For Kitchen Cooking
304 Stainless Steel Oil Strainer Pot With Fine Mesh Filter Dustproof Grease Storage Container For Kitchen Cooking
like
Find Similar
Matte finish 2L stainless steel oil container with filter mesh and lid set - 2.0L / Matte Style (Pot+Lid+Strainer)
1.5L Matte Stainless Steel Oil Filter Pot with Fine Mesh Strainer and Fry Basket - 1.5L / Matte Style (Pot+Lid+Strainer+Frying Basket)
2L matte stainless steel oil filter pot set with fine mesh strainer and fry basket - 2.0L / Matte Style (Pot+Lid+Strainer+Frying Basket)
1.5L 304 stainless steel oil strainer pot with filter mesh and bottom coaster set - 1.5L / Matte Style (Pot+Lid+Strainer)
+2
304 Stainless Steel Oil Strainer Pot With Fine Mesh Filter Dustproof Grease Storage Container For Kitchen Cooking
$2.02-13.54
No MOQ
 · 
32 sold recently
Water Bottle Accessories Silicone Boot Straw Cover Woven Strap Pom Pom Flower Heart Charms For Large Tumbler Cup Decor
Water Bottle Accessories Silicone Boot Straw Cover Woven Strap Pom Pom Flower Heart Charms For Large Tumbler Cup Decor
like
Find Similar
Christmas themed Stanley cup accessory set with green silicone boot and red festive charms - Christmas
White 40oz tumbler DIY accessory set featuring daisy charms and woven handle - White
Mint green accessory set for tumbler with woven handle and floral silicone straw cover - Grass Green
Pink and white floral accessory set for tumblers including silicone boot and charms - Pink
+7
Water Bottle Accessories Silicone Boot Straw Cover Woven Strap Pom Pom Flower Heart Charms For Large Tumbler Cup Decor
-4%
$3.70-4.66
No MOQ
 · 
75 sold recently
Top 10% Best Sellers
in Kitchen & Dining
Tactical Water Bottle Bag Oxford Cloth Waterproof MOLLE System Outdoor Hiking Cycling Shoulder Bag With Detachable Strap
Tactical Water Bottle Bag Oxford Cloth Waterproof MOLLE System Outdoor Hiking Cycling Shoulder Bag With Detachable Strap
like
Find Similar
Tactical black nylon water bottle bag with Molle system and adjustable shoulder strap - One Size / Black
Tactical water bottle pouch in coyote brown nylon with MOLLE system and shoulder strap - One Size / Tan
Tactical water bottle pouch in military olive green nylon with MOLLE system for hiking - One Size / Army Green
Tactical water bottle bag in desert digital camouflage pattern with adjustable shoulder strap - One Size / ACU Camouflage
+2
Tactical Water Bottle Bag Oxford Cloth Waterproof MOLLE System Outdoor Hiking Cycling Shoulder Bag With Detachable Strap
-12%
$3.37
No MOQ
 · 
36 sold recently
Insulated Water Bottle Bag With Adjustable Shoulder Strap Phone Pocket Drawstring Holder For Hiking Traveling Outdoor
Insulated Water Bottle Bag With Adjustable Shoulder Strap Phone Pocket Drawstring Holder For Hiking Traveling Outdoor
like
Find Similar
Detail of black tactical water bottle pouch with zippered front pocket and shoulder strap - Black
Pink outdoor water bottle holder bag with adjustable shoulder strap and zipper pocket - Pink
Close-up of mint green water bottle sleeve with adjustable strap and front pocket - Light Green
Detail of lilac purple insulated water bottle carrier with adjustable shoulder strap and pad - Purple
Insulated Water Bottle Bag With Adjustable Shoulder Strap Phone Pocket Drawstring Holder For Hiking Traveling Outdoor
$5.19
No MOQ
 · 
17 views
Quilted Nylon Water Bottle Bag With Adjustable Stripe Strap Crossbody Hiking Travel Outdoor Bottle Carrier Storage Bag
Quilted Nylon Water Bottle Bag With Adjustable Stripe Strap Crossbody Hiking Travel Outdoor Bottle Carrier Storage Bag
like
Find Similar
Pink quilted cross-body water bottle bag with phone pocket and adjustable strap - Pink
Detail of black quilted water bottle bag with phone pocket and striped shoulder strap - Black
Quilted water bottle crossbody bag with cream fabric and striped detachable shoulder strap - Beige
Quilted Nylon Water Bottle Bag With Adjustable Stripe Strap Crossbody Hiking Travel Outdoor Bottle Carrier Storage Bag
$5.71
No MOQ
 · 
18 sold recently
Large Capacity Sport Water Bottle Neoprene Sleeve Storage Pocket Adjustable Shoulder Strap Tritan Motivational Time Marker
Large Capacity Sport Water Bottle Neoprene Sleeve Storage Pocket Adjustable Shoulder Strap Tritan Motivational Time Marker
like
Find Similar
Pink 64oz water bottle with neoprene sleeve, pockets and adjustable shoulder strap - Pink
Floral SBR water bottle sleeve with strap and 64oz bottle featuring time markers - Pink Floral Print
64 OZ water bottle with black camo SBR sleeve and adjustable shoulder strap - Black Camouflage Print
Purple gradient sport bottle with thick SBR protective sleeve and adjustable strap - Purple & Green
+6
Large Capacity Sport Water Bottle Neoprene Sleeve Storage Pocket Adjustable Shoulder Strap Tritan Motivational Time Marker
-5%
$3.01
Mix MOQ : 2
 · 
61 views
Plastic Squeeze Bottle For Oil And Sauce Non-Drip Kitchen Seasoning Container Transparent Frosted Scaled Oil Dispenser
Plastic Squeeze Bottle For Oil And Sauce Non-Drip Kitchen Seasoning Container Transparent Frosted Scaled Oil Dispenser
like
Find Similar
Frosted PP5 oil dispenser bottles in two sizes with leakproof flip caps for kitchen - Frosted Style / 300ml
Waterproof kitchen labels for sauce and oil bottles featuring 8 specific Chinese seasonings - Oil Bottle Label Stickers / Multicolor Seasoning Identifiers
Plastic Squeeze Bottle For Oil And Sauce Non-Drip Kitchen Seasoning Container Transparent Frosted Scaled Oil Dispenser
-16%
$0.05-0.36
No MOQ
 · 
200 sold recently
Travel Bottle Leak Proof Covers High Elastic Silicone Sleeves Stretchable Waterproof Toiletry Protectors Outdoor Essentials
Travel Bottle Leak Proof Covers High Elastic Silicone Sleeves Stretchable Waterproof Toiletry Protectors Outdoor Essentials
like
Find Similar
Pink leakproof silicone travel bottle sleeve with vertical textured stretchable design - 1st Gen (Cylindrical) / Pink
Blue translucent stretchable silicone sleeve for leakproof travel bottle protection - 1st Gen (Cylindrical) / Blue
Black silicone leak-proof sleeve with vertical anti-slip stripes for travel bottles - 1st Gen (Cylindrical) / Black
Translucent white silicone travel bottle sleeve with stretchable vertical stripe texture - 1st Gen (Cylindrical) / White
+30
Travel Bottle Leak Proof Covers High Elastic Silicone Sleeves Stretchable Waterproof Toiletry Protectors Outdoor Essentials
$0.23-0.32
Mix MOQ : 10
 · 
300 sold recently
Water Bottle Carrier Bag With Zipper Phone Pocket Adjustable Shoulder Strap Synthetic Leather Insulated Pouch For Outdoor
Water Bottle Carrier Bag With Zipper Phone Pocket Adjustable Shoulder Strap Synthetic Leather Insulated Pouch For Outdoor
like
Find Similar
Detail view of water bottle pouch with adjustable shoulder strap and zipper pocket - Black
Adjustable pink insulated water bottle bag with front drawstring pocket and phone pouch - Pink
Detail of insulated water bottle bag with zipper pocket and adjustable strap in beige - Off White
Detail view of sage green water bottle pouch with drawstring and zipper phone pocket - Green
Water Bottle Carrier Bag With Zipper Phone Pocket Adjustable Shoulder Strap Synthetic Leather Insulated Pouch For Outdoor
$4.61
No MOQ
 · 
10 views
Borosilicate Glass Oil Dispenser Bottle With Gravity Automatic Flip Lid Leak Proof For Kitchen Vinegar Soy Sauce Cooking
Borosilicate Glass Oil Dispenser Bottle With Gravity Automatic Flip Lid Leak Proof For Kitchen Vinegar Soy Sauce Cooking
like
Find Similar
Minimalist 500ml glass oil bottle in greyish white with automatic lid and sticker set - 1PC
Set of 2 glass oil bottles 500ml with auto-open lids and seasoning label stickers - 2-Piece Set
Set of 3 leakproof glass oil dispensers in grey white with 500ml capacity and labels - 3 Piece Set
4-piece glass oil dispenser set with 500ml grey automatic flip lids and labels - 4 Pcs Pack
Borosilicate Glass Oil Dispenser Bottle With Gravity Automatic Flip Lid Leak Proof For Kitchen Vinegar Soy Sauce Cooking
-5%
$2.46-7.94
No MOQ
 · 
10 sold recently
Korean INS Style Quilted Cotton Water Bottle Sleeve Bag With Adjustable Strap Embroidered Animal Bear Rabbit For Kids
Korean INS Style Quilted Cotton Water Bottle Sleeve Bag With Adjustable Strap Embroidered Animal Bear Rabbit For Kids
like
Find Similar
Quilted white canvas bottle bag with bear embroidery and adjustable beige shoulder strap - White/Black Bear
Grey quilted water bottle bag with embroidered white bear face and adjustable strap - Grey/White Bear
Detail of white quilted cotton bottle holder with cute brown teddy bear embroidery - White/Brown Bear
Quilted white cotton bottle bag with cute teddy bear embroidery and adjustable strap - White/Beige Bear
+15
Korean INS Style Quilted Cotton Water Bottle Sleeve Bag With Adjustable Strap Embroidered Animal Bear Rabbit For Kids
$5.19
No MOQ
 · 
31 views
Portable Water Bottle Holder Bag Quilted Fabric Floral Bear Printed Soft Protective Sleeve With Handle
Portable Water Bottle Holder Bag Quilted Fabric Floral Bear Printed Soft Protective Sleeve With Handle
like
Find Similar
Close-up of quilted cotton water bottle carrier with colorful cartoon bear and rainbow prints - Graffiti
Detailed view of quilted colorful striped bottle bag with soft fabric and carry handle - Colorful Stripes and Dots
Close-up of quilted cotton cup sleeve with cute rabbit and strawberry prints - Rabbit Family
Close-up of quilted floral water bottle holder with soft cotton padding and handle - Blue Flower
+1
Portable Water Bottle Holder Bag Quilted Fabric Floral Bear Printed Soft Protective Sleeve With Handle
$2.28
No MOQ
 · 
14 views
Hand Woven Adjustable Cotton Water Bottle Strap Daisy Flower Cup Handle Portable Coffee Sleeve Checkerboard Hanger For Travel
Hand Woven Adjustable Cotton Water Bottle Strap Daisy Flower Cup Handle Portable Coffee Sleeve Checkerboard Hanger For Travel
like
Find Similar
Handmade woven daisy flower water bottle strap in purple and blue tones with measurements - Purple
Handmade crochet flower cup strap with pink and green daisy patterns and gold metal clasp - Pink
Handmade woven daisy cup lanyard in black and white with adjustable cord - Black
Hand Woven Adjustable Cotton Water Bottle Strap Daisy Flower Cup Handle Portable Coffee Sleeve Checkerboard Hanger For Travel
$2.73-2.96
No MOQ
 · 
20 sold recently
Free Shipping
Quilted Gingham Water Bottle Holder Bag Padded Cotton Portable Cup Sleeve Thermal Insulation Tote For Outdoor Travel
Quilted Gingham Water Bottle Holder Bag Padded Cotton Portable Cup Sleeve Thermal Insulation Tote For Outdoor Travel
like
Find Similar
Pink and white checkered quilted water bottle carrier bag with a heart stitching pattern - Quilted Pink Heart Plaid
Blue gingham quilted water bottle carrier with long handles and brand patch - Quilted Blue Heart Plaid
Quilted yellow checkered water bottle carrier bag with portable handle and fabric label - Quilted Heart Plaid Yellow
Blue and yellow checkered quilted cup holder bag with soft padded cotton handle - Quilted Heart Plaid Cyan Yellow
+1
Quilted Gingham Water Bottle Holder Bag Padded Cotton Portable Cup Sleeve Thermal Insulation Tote For Outdoor Travel
-5%
$2.16
No MOQ
 · 
14 views
Drawstring Water Bottle Bag Plaid Color Block Nylon Shoulder Crossbody Bag With Flower Pendant Outdoor Cycling Sports Mobile Phone Bucket Bag
Drawstring Water Bottle Bag Plaid Color Block Nylon Shoulder Crossbody Bag With Flower Pendant Outdoor Cycling Sports Mobile Phone Bucket Bag
like
Find Similar
Outdoor crossbody water bottle bag in grey and green plaid with adjustable blue strap - With Charm / Green
Brown and purple checkerboard drawstring bucket bag with pink flower charm and strap - With Charm / Purple
Outdoor drawstring water bottle bag with grey green plaid and flower charm accent - With Charm / Yellow
Pink and gray plaid water bottle bag with adjustable strap and floral pendant charm - With Charm / Pink
+4
Drawstring Water Bottle Bag Plaid Color Block Nylon Shoulder Crossbody Bag With Flower Pendant Outdoor Cycling Sports Mobile Phone Bucket Bag
$5.76-6.63
No MOQ
Glass Oil Dispenser Bottle With Handle Leakproof Vinegar Cruet With Scale Borosilicate Heat Resistant Kitchen Storage Clear
Glass Oil Dispenser Bottle With Handle Leakproof Vinegar Cruet With Scale Borosilicate Heat Resistant Kitchen Storage Clear
like
Find Similar
400ml high borosilicate glass oil bottle with measurement scale and beige handle - 400ml / Borosilicate Glass / Beige Lid
500ml high borosilicate glass oil bottle with cream white handle and scale marks - 500ml / Borosilicate Glass / Beige Lid
Beige 600ml leakproof glass oil dispenser with measurements and handle for kitchen - 600ml / Borosilicate Glass / Beige Lid
Glass Oil Dispenser Bottle With Handle Leakproof Vinegar Cruet With Scale Borosilicate Heat Resistant Kitchen Storage Clear
-29%
$2.88-3.17
No MOQ
 · 
17 views
Water Bottle Carrier Bag Drawstring Spliced Gingham Plaid Star Pattern Polyester Portable Storage Pouch With Handle
Water Bottle Carrier Bag Drawstring Spliced Gingham Plaid Star Pattern Polyester Portable Storage Pouch With Handle
like
Find Similar
Detail of red checkered drawstring water bottle bag with denim base and handles - Red Checkerboard
Detail of drawstring plaid water bottle bag with pink gingham and denim patchwork - Blush Pink Plaid
Detail of blue plaid water bottle bag with star patterns and pink drawstring cord - Light Blue Plaid
Close-up of drawstring water bottle bag with green plaid and blue star patterns - Green Check
+1
Water Bottle Carrier Bag Drawstring Spliced Gingham Plaid Star Pattern Polyester Portable Storage Pouch With Handle
-4%
$2.44
No MOQ
Quilted Water Bottle Carrier Bag With Adjustable Shoulder Strap Portable Bottle Sleeve With Zipper Pocket For Outdoor Travel
Quilted Water Bottle Carrier Bag With Adjustable Shoulder Strap Portable Bottle Sleeve With Zipper Pocket For Outdoor Travel
like
Find Similar
Black quilted down water bottle bag with front zipper pocket and adjustable strap - Black
Quilted nylon water bottle sling bag with adjustable strap and drawstring in taupe - Camel
Close-up of pink quilted puffer water bottle bag with zipper pocket and strap - Light Pink
Detailed view of quilted lilac water bottle bag with front zipper pocket and strap - Light Purple
Quilted Water Bottle Carrier Bag With Adjustable Shoulder Strap Portable Bottle Sleeve With Zipper Pocket For Outdoor Travel
$6.20
No MOQ
 · 
11 views
Tactical Water Bottle Pouch Oxford Cloth Molle Kettle Bag Outdoor Camping Cycling Hiking Adjustable Shoulder Accessory Bag
Tactical Water Bottle Pouch Oxford Cloth Molle Kettle Bag Outdoor Camping Cycling Hiking Adjustable Shoulder Accessory Bag
like
Find Similar
Tactical water bottle pouch in digital woodland camouflage with MOLLE webbing system - Jungle Digital
Tactical black nylon water bottle waist bag with MOLLE system and front zipper pocket - Black
Army green tactical water bottle pouch with MOLLE webbing and front zipper pocket - Army Green
Tactical ACU camouflage water bottle waist bag with MOLLE system and buckle closure - ACU Camouflage
+2
Tactical Water Bottle Pouch Oxford Cloth Molle Kettle Bag Outdoor Camping Cycling Hiking Adjustable Shoulder Accessory Bag
-4%
$5.48
No MOQ
Portable Gingham Water Bottle Bag With Drawstring And Handle Denim Star Patchwork Polyester Storage Pouch For Travel
Portable Gingham Water Bottle Bag With Drawstring And Handle Denim Star Patchwork Polyester Storage Pouch For Travel
like
Find Similar
Detail of red checkered drawstring water bottle bag with denim base and sturdy handle - Red Checkerboard
Detail of pink plaid drawstring cup pouch with blue star print and rope handle - Blush Pink Plaid
Detail of checkered canvas drawstring pouch with blue star pattern for water bottle storage - Light Blue Plaid
Flat lay of checkered drawstring water bottle bag with star patterns and lifestyle props - Green Check
+1
Portable Gingham Water Bottle Bag With Drawstring And Handle Denim Star Patchwork Polyester Storage Pouch For Travel
-11%
$2.26
No MOQ
Glass Oil Dispenser Bottle Leak Proof Automatic Opening Closing Sauce Vinegar Container Sealed Lid Kitchen Cooking Style
Glass Oil Dispenser Bottle Leak Proof Automatic Opening Closing Sauce Vinegar Container Sealed Lid Kitchen Cooking Style
like
Find Similar
280ml white and orange leak-proof oil bottle with precise control pourer and measurements - 280ml / White
280ml kitchen glass dispenser for oil or vinegar with black leakproof lid - 280ml / Black
Glass Oil Dispenser Bottle Leak Proof Automatic Opening Closing Sauce Vinegar Container Sealed Lid Kitchen Cooking Style
-4%
$3.43
No MOQ
 · 
15 views
Cartoon Big Eyes Water Bottle Carrier Bag Mesh Crossbody Bottle Holder With Adjustable Strap For Travel Outdoor
Cartoon Big Eyes Water Bottle Carrier Bag Mesh Crossbody Bottle Holder With Adjustable Strap For Travel Outdoor
like
Find Similar
Pink mesh water bottle carrier with cartoon eyes and adjustable beige crossbody strap - Pink
Detail of dark grey mesh bag with cartoon eyes on a desk with lifestyle accessories - Gray
Cartoon Big Eyes Water Bottle Carrier Bag Mesh Crossbody Bottle Holder With Adjustable Strap For Travel Outdoor
-5%
$2.46
No MOQ
Stainless Steel Flatware Roman Column Texture Handle Mirror Polished Luxury Cutlery Knife Fork Spoon For Home Dining
Stainless Steel Flatware Roman Column Texture Handle Mirror Polished Luxury Cutlery Knife Fork Spoon For Home Dining
like
Find Similar
Silver stainless steel flatware set with ribbed handles and detailed size specifications - Five-Piece Set / Silver
Golden Roman column stainless steel 5-piece cutlery set with size and weight details - Five-Piece Set / Gold
5-piece rose gold stainless steel cutlery set with roman column handles and detailed dimensions - Five-Piece Set / Rose Gold
Rainbow stainless steel cutlery set with 5 pieces including knife and forks - Five-Piece Set / AB Color
+26
Stainless Steel Flatware Roman Column Texture Handle Mirror Polished Luxury Cutlery Knife Fork Spoon For Home Dining
$0.43-4.15
No MOQ
 · 
70% reordered
Top 1% Best Sellers
in Kitchen & Dining
Stainless Steel Stirring Spoons Long Handle Flower Heart Shaped Golden Coffee Tea Dessert Spoons Elegant Japanese Style
Stainless Steel Stirring Spoons Long Handle Flower Heart Shaped Golden Coffee Tea Dessert Spoons Elegant Japanese Style
like
Find Similar
Polished silver stainless steel long handle spoon with creative heart-shaped head - Heart-shaped Spoon / Silver
Elegant silver stainless steel long handle spoon featuring a rose flower shaped head - Rose Spoon / Silver
Golden long-handle rose flower head stirrer spoon in elegant stainless steel finish - Rose Spoon / Gold
Golden heart-shaped stainless steel long handle spoon with polished finish - Heart-shaped Spoon / Gold
+20
Stainless Steel Stirring Spoons Long Handle Flower Heart Shaped Golden Coffee Tea Dessert Spoons Elegant Japanese Style
-6%
$0.22-1.97
No MOQ
 · 
435 sold recently
Top 10% Best Sellers
in Kitchen & Dining
Natural Crystal Raw Stone Tea Infuser Stainless Steel Mesh Ball Strainer With Healing Mineral Pendant For Loose Leaf Tea
Natural Crystal Raw Stone Tea Infuser Stainless Steel Mesh Ball Strainer With Healing Mineral Pendant For Loose Leaf Tea
like
Find Similar
Golden 304 stainless steel tea infuser with smoky quartz natural crystal stone pendant - Smoky Quartz (Gold)
Citrine natural stone pendant on a 304 stainless steel mesh tea infuser strainer - Citrine (Silver)
Stainless steel mesh tea strainer with purple fluorite raw stone crystal pendant - Purple Fluorite (Silver)
304 stainless steel tea infuser featuring a natural Yellow Aventurine stone pendant - Yellow Aventurine (Silver)
+34
Natural Crystal Raw Stone Tea Infuser Stainless Steel Mesh Ball Strainer With Healing Mineral Pendant For Loose Leaf Tea
-5%
$1.86
No MOQ
 · 
611 sold recently
Vacuum Insulated Mug Natural Bamboo Shell 304 Stainless Steel Leak-Proof Travel Coffee Cup Eco-Friendly Portable Flask
Vacuum Insulated Mug Natural Bamboo Shell 304 Stainless Steel Leak-Proof Travel Coffee Cup Eco-Friendly Portable Flask
like
Find Similar
Insulated bamboo water bottle with a sleek metal lid placed on a wooden desk surface - 450ml Bamboo Shell Straight Cup
Bamboo vacuum thermos bottle with stainless steel lid and non-slip bottom base - 260ml Portable Cup
Bamboo exterior 450ml travel coffee mug with stainless steel rim and plastic lid - 450ml Car Mug with Plastic Lid
Eco-friendly bamboo vacuum flask with stainless steel lid on a rustic wooden table - 350ml Bamboo Shell Straight Cup
+20
Vacuum Insulated Mug Natural Bamboo Shell 304 Stainless Steel Leak-Proof Travel Coffee Cup Eco-Friendly Portable Flask
$4.18-8.65
Mix MOQ : 3
 · 
302 sold recently
Top 3% Best Sellers
in Kitchen & Dining
Tea Infuser Stainless Steel Fine Mesh Strainer With Chain Hook And Drip Tray For Loose Leaf Tea Spice Filter Reusable Durable
Tea Infuser Stainless Steel Fine Mesh Strainer With Chain Hook And Drip Tray For Loose Leaf Tea Spice Filter Reusable Durable
like
Find Similar
Polished 304 stainless steel round tea tray and small filter basket saucer in silver - Small Base Tray
Detailed macro view of 304 stainless steel tea infuser ball with fine mesh and metal chain - Small Ball
Detail of 304 stainless steel tea infuser ball with fine mesh, chain, and base tray - Medium Ball + Base
Close-up of SUS304 stainless steel tea infuser mesh with chain and hanging hook - Small Crimped Style
+37
Tea Infuser Stainless Steel Fine Mesh Strainer With Chain Hook And Drip Tray For Loose Leaf Tea Spice Filter Reusable Durable
$0.58-7.20
Mix MOQ : 2
 · 
1K+ sold recently
Top 5% Best Sellers
in Kitchen & Dining
Free Shipping
Stainless Steel Flatware Knife Fork Spoon Dinner Cutlery Mirror Polished Modern Luxury Tableware Gift Boxed
Stainless Steel Flatware Knife Fork Spoon Dinner Cutlery Mirror Polished Modern Luxury Tableware Gift Boxed
like
Find Similar
24-piece golden stainless steel cutlery set with matte dark green handles in a gift box - Portugal Style (24Pcs Set/Mail Box) / Green Gold
Close-up of a 24-piece silver stainless steel cutlery set in a black premium gift box - 1010 Style (24Pcs Set/Flip Case) / Silver
Detailed view of 24-piece rose gold stainless steel cutlery set in a black gift box - 1010 Style (24Pcs Set/Flip Case) / Rose Gold
24-piece silver stainless steel cutlery set with elegant black and gold gift box - 1010 Style (24Pcs Set/Mail Box) / Silver
+35
Stainless Steel Flatware Knife Fork Spoon Dinner Cutlery Mirror Polished Modern Luxury Tableware Gift Boxed
$4.18-13.54
Mix MOQ : 2
 · 
127 sold recently
Vintage Crane Stork Embroidery Scissors 420 Stainless Steel Pointed Sharp Sewing Shears For Needlework Arts Crafts
Vintage Crane Stork Embroidery Scissors 420 Stainless Steel Pointed Sharp Sewing Shears For Needlework Arts Crafts
like
Find Similar
Silver crane-shaped stainless steel scissors with 94mm length for sewing and embroidery - Crane Sharp Pointed / Silver
Golden crane-shaped stainless steel embroidery scissors with precision pointed blades - Crane Sharp Pointed / Gold
Antique crane shaped stainless steel embroidery scissors in vintage bronze finish - Crane Sharp Pointed / Tea Titanium
Rainbow titanium stork embroidery scissors made of 420 stainless steel and 94mm long - Crane Sharp Pointed / Rainbow
+17
Vintage Crane Stork Embroidery Scissors 420 Stainless Steel Pointed Sharp Sewing Shears For Needlework Arts Crafts
$1.04-1.63
Mix MOQ : 3
 · 
415 sold recently
Top 10% Best Sellers
in Kitchen & Dining
Free Shipping
Artistic Geode Crystal Agate Pattern Coffee Mug Resin Drinking Cup With Stainless Steel Liner Natural Mineral Style Ornament For Home Office Gift
Artistic Geode Crystal Agate Pattern Coffee Mug Resin Drinking Cup With Stainless Steel Liner Natural Mineral Style Ornament For Home Office Gift
like
Find Similar
Handmade purple amethyst crystal coffee mug with irregular natural mineral texture - No Inner Liner / Mineral Mug-Amethyst
Blue agate mineral coffee mug with natural concentric textures on wooden base - No Inner Liner / Mineral Mug-Blue Crystal
Minimalist pink crystal coffee mug with natural facets and steam on a wooden coaster - No Inner Liner / Mineral Mug-Pink
Close-up of a blue agate geode texture on a creative mineral crystal coffee mug - No Inner Liner / Mineral Mug-Dark Blue
+28
Artistic Geode Crystal Agate Pattern Coffee Mug Resin Drinking Cup With Stainless Steel Liner Natural Mineral Style Ornament For Home Office Gift
-4%
$3.85
No MOQ
 · 
143 sold recently
Top 10% Best Sellers
in Kitchen & Dining
Stainless Steel Coffee Spoon Flower Shape Stirring Dessert Spoon Leaf Handle For Tea Cake Creative Gift
Stainless Steel Coffee Spoon Flower Shape Stirring Dessert Spoon Leaf Handle For Tea Cake Creative Gift
like
Find Similar
Floral stainless steel coffee spoons set with rose and cherry blossom heads in pink gift box - Silver/Short Handle Flower Spoon 2PCS (Cherry + Rose) / Silver/Pink Box
Stainless steel flower spoon gift set with rose and cherry blossom designs in blue box - Silver/Short Handle Flower Spoon 2PCS (Cherry + Rose) / Silver/Blue Box
Golden stainless steel spoon gift set with rose and cherry blossom heads in a pink box - Gold/Short Handle Flower Spoon 2PCS (Cherry + Rose) / Gold/Pink Box
Golden stainless steel flower spoons gift set in blue box with two pieces included - Gold/Short Handle Flower Spoon 2PCS (Cherry + Rose) / Gold/Blue Box
+30
Stainless Steel Coffee Spoon Flower Shape Stirring Dessert Spoon Leaf Handle For Tea Cake Creative Gift
-5%
$0.66-1.73
No MOQ
 · 
295 sold recently
Cute Cartoon Animal Coffee Spoon 304 Stainless Steel Creative Hanging Cup Dessert Stirring Teaspoon Kitchen Accessory
Cute Cartoon Animal Coffee Spoon 304 Stainless Steel Creative Hanging Cup Dessert Stirring Teaspoon Kitchen Accessory
like
Find Similar
Creative rose gold cat-shaped 304 stainless steel dessert spoon with hanging design - Cat / Rose Gold
Silver stainless steel creative cat shaped coffee spoon with hanging handle design - Cat / Silver
Rose gold stainless steel coffee spoon with cute teddy bear handle design - Bear / Rose Gold
Silver stainless steel coffee spoon with cute bear shaped handle design and paw prints - Bear / Silver
+14
Cute Cartoon Animal Coffee Spoon 304 Stainless Steel Creative Hanging Cup Dessert Stirring Teaspoon Kitchen Accessory
-10%
$0.41-0.91
No MOQ
 · 
1K+ sold recently
Top 10% Best Sellers
in Kitchen & Dining
Stainless Steel Tea Infuser Tree Of Life Crystal Stone Pendant Functional Mesh Ball Strainer For Steeping Loose Leaf Tea
Stainless Steel Tea Infuser Tree Of Life Crystal Stone Pendant Functional Mesh Ball Strainer For Steeping Loose Leaf Tea
like
Find Similar
Stainless steel tea infuser with pink quartz crystal tree of life charm and mesh ball - Rose Quartz
Stainless steel tea infuser with red crystal tree of life pendant and mesh ball - Red Jasper
Stainless steel tea infuser with Tree of Life pendant featuring yellow crystal stones - Citrine
Egg-shaped tea infuser in 304 stainless steel with a tree of life gemstone charm - Labradorite
+8
Stainless Steel Tea Infuser Tree Of Life Crystal Stone Pendant Functional Mesh Ball Strainer For Steeping Loose Leaf Tea
$1.79
No MOQ
 · 
326 sold recently
Top 10% Best Sellers
in Kitchen & Dining
Creative Mineral Crystal Coffee Mug Synthetic Resin Natural Stone Texture With Stainless Steel Liner Natural Gemstone Style Drinking Cup For Home Office Desk Decor Gift
Creative Mineral Crystal Coffee Mug Synthetic Resin Natural Stone Texture With Stainless Steel Liner Natural Gemstone Style Drinking Cup For Home Office Desk Decor Gift
like
Find Similar
Unique handcrafted purple mineral crystal resin coffee mug with natural stone texture finish. - With Inner Liner / Purple (Amethyst)
Blue agate mineral crystal coffee mug made of resin with natural stone texture detail - With Inner Liner / Blue (Blue Crystal)
Pink mineral crystal resin coffee mug with geometric facets and a sturdy handle. - With Inner Liner / Pink
Colorful mineral crystal style resin coffee mug with vibrant agate-like textures and handle - With Inner Liner / Volcanic Red
+26
Creative Mineral Crystal Coffee Mug Synthetic Resin Natural Stone Texture With Stainless Steel Liner Natural Gemstone Style Drinking Cup For Home Office Desk Decor Gift
-5%
$4.05
Mix MOQ : 2
 · 
54 sold recently
304 Stainless Steel Bento Lunch Box Compartmentalized Leakproof Insulated Portable Food Container With Utensils School Office
304 Stainless Steel Bento Lunch Box Compartmentalized Leakproof Insulated Portable Food Container With Utensils School Office
like
Find Similar
Light green 304 stainless steel 3-compartment bento box with matching spoon and chopsticks - Green 3-Compartment 1L (No Cutlery)
Pink 3-compartment SUS304 stainless steel bento box with pink base and metal cutlery - Pink 3-Compartment 1L (With Cutlery + Color Box)
Light blue 3-compartment 304 stainless steel bento box with matching spoon and chopsticks - Blue 3-Compartment 1L (With Cutlery + Thermal Bag)
Blue 304 stainless steel lunch box with dual compartments and utensil set - Blue 2-Compartment 1L (With Cutlery + Color Box)
+56
304 Stainless Steel Bento Lunch Box Compartmentalized Leakproof Insulated Portable Food Container With Utensils School Office
$4.32-7.64
Mix MOQ : 2
 · 
88 sold recently
Go to

More in home & kitchen

Explore more in steel bottles

steeldoubledisplaymagnetickidsstrapdiywidetitaniumgirls
304 stainless steel316 stainless steelnaturalstylebarplasticmetalpolishedshapenecklace stainless steel

Ready to source like an insider

Get a direct line to the factory floor — no minimums, no middlemen, no guesswork.
iconReal factory pricing, no markup in betweeniconEvery order hand-inspected before it shipsicon5,000+ new products added daily
Get Inside Access