Everful

Wholesale steel bottles

Factory-direct selection, vetted for quality and ready to order.

Sign Up
Steel Bottles

Find the perfect pieces: vacuum flasks & thermoses, tumblers, mugs and more

filterShow Filters
Best Seller
New Arrivals
Price Drop
Free Shipping
Gradient Frosted Sports Water Bottles With Motivational Time Markers And Straws Portable Handle Leakproof Plastic Drinkware
Gradient Frosted Sports Water Bottles With Motivational Time Markers And Straws Portable Handle Leakproof Plastic Drinkware
like
Find Similar
Set of four gradient plastic sports bottles in 2000ml to 300ml sizes on wood table - 2000+900+600+300ml / Pink
Set of four gradient frosted sports water bottles with time markers and scale details - 2000+900+600+300ml / Blue
Detailed set of 4 gradient sports water bottles with 2000ml to 300ml capacity and time markers - 2000+900+600+300ml / Green
4-pack gradient frosted sport water bottles in 2000ml to 300ml sizes with time markers - 2000+900+600+300ml / Purple
+5
Gradient Frosted Sports Water Bottles With Motivational Time Markers And Straws Portable Handle Leakproof Plastic Drinkware
-5%
$3.78-4.60
No MOQ
 · 
37 views
Stainless Steel Camping Cup Set 304 Portable Stackable For Outdoor Picnic Barbecue Artistic Cartoon Illustration
Stainless Steel Camping Cup Set 304 Portable Stackable For Outdoor Picnic Barbecue Artistic Cartoon Illustration
like
Find Similar
Outdoor 4-piece camping cup set in cream yellow 304 stainless steel with storage bag - Artist Edition 4-Piece Set (304 Stainless Steel/With Bag)
Stainless Steel Camping Cup Set 304 Portable Stackable For Outdoor Picnic Barbecue Artistic Cartoon Illustration
$12.97
No MOQ
 · 
42 views
304 Stainless Steel Taco Holder Stand W-Shaped Food Rack With Sauce Cups Non-Slip Feet For Restaurant Kitchen Dining
304 Stainless Steel Taco Holder Stand W-Shaped Food Rack With Sauce Cups Non-Slip Feet For Restaurant Kitchen Dining
like
Find Similar
Stainless steel taco holder with two sauce cups, dimensions 32.5x6.5x5 cm on white background - 32.5x6.5x5cm (Single Head Double Cup Style)
Brushed 304 stainless steel taco holder with 3-4 slots in a wavy folded metal structure - 27x10x5.5cm (3-4 Slots Iron Plate Style)
304 stainless steel taco holder rack in W-shape design, measuring 20x10x5.5cm - 20x10x5.5cm (2-3 Slots Iron Plate Style)
Stainless steel taco holder with 2 sauce cups wave style rack for 3 tortillas - 27.5x6.5x5cm (Single Cup at Both Ends)
+7
304 Stainless Steel Taco Holder Stand W-Shaped Food Rack With Sauce Cups Non-Slip Feet For Restaurant Kitchen Dining
-5%
$1.78-5.21
Mix MOQ : 2
 · 
31 views
Insulated Tumbler Stainless Steel Vacuum Flask With Portable Handle And Dual Drink Lid Large Capacity Car Coffee Mug
Insulated Tumbler Stainless Steel Vacuum Flask With Portable Handle And Dual Drink Lid Large Capacity Car Coffee Mug
like
Find Similar
Pink insulated stainless steel coffee tumbler with handle and matte finish exterior - 30oz / Pink
Matte khaki stainless steel insulated coffee mug with handle and transparent lid - 30oz / Brown
Creamy insulated coffee mug with handle and Nice Time slogan against a dark wall - 30oz / White
Matte black stainless steel insulated tumbler with handle and straw 40oz coffee mug - 30oz / Black
+5
Insulated Tumbler Stainless Steel Vacuum Flask With Portable Handle And Dual Drink Lid Large Capacity Car Coffee Mug
$8.90-10.06
No MOQ
 · 
118 views
Stainless Steel Insulated Coffee Mug Gradient Vacuum Travel Cup With Flip Lid Anti-Slip Stripe Vertical Texture
Stainless Steel Insulated Coffee Mug Gradient Vacuum Travel Cup With Flip Lid Anti-Slip Stripe Vertical Texture
like
Find Similar
Detail of gradient purple stainless steel coffee cup with textured vertical ridges - 500ml / Purple
Pink gradient stainless steel travel coffee mug with textured grip shown in hand - 500ml / Pink
Detail of blue gradient stainless steel coffee mug with non-slip vertical texture - 500ml / Blue
Detail of gradient green coffee tumbler with non-slip vertical texture and flip lid - 500ml / Green
Stainless Steel Insulated Coffee Mug Gradient Vacuum Travel Cup With Flip Lid Anti-Slip Stripe Vertical Texture
-4%
$4.38
Mix MOQ : 2
 · 
41 views
Creative Penguin Shaped Double Walled Glass Bottle With Silicone Sleeve Cartoon Animal Glass Cup For Students Gift
Creative Penguin Shaped Double Walled Glass Bottle With Silicone Sleeve Cartoon Animal Glass Cup For Students Gift
like
Find Similar
Creative rose red penguin shaped cartoon glass water bottle with double layer design - 300ml / Red
Creative light grey penguin-shaped cartoon glass water bottle shown in a hand outdoors - 300ml / Gray
Macro view of blue penguin cartoon vacuum insulated stainless steel water bottle outdoor - 300ml / Blue
Detailed close-up view of the cute penguin-shaped water bottle in elegant black finish - 300ml / Black
Creative Penguin Shaped Double Walled Glass Bottle With Silicone Sleeve Cartoon Animal Glass Cup For Students Gift
$4.58
Mix MOQ : 2
 · 
36 sold recently
Ribbed Glass Cup Coffee Mug Heat Resistant Vertical Stripe Transparent Drinkware For Juice Latte Iced Tea Vintage Ins Style
Ribbed Glass Cup Coffee Mug Heat Resistant Vertical Stripe Transparent Drinkware For Juice Latte Iced Tea Vintage Ins Style
like
Find Similar
Close-up of hand holding a ribbed glass cup with iced coffee on a wooden table - 450ml Tall Style / Vertical Style
Set of 4 ribbed glass cups for coffee and juice, safely packed in foam inside a brown box - 450ml Tall Style / Vertical Style / 4 Pcs Pack
Ribbed Glass Cup Coffee Mug Heat Resistant Vertical Stripe Transparent Drinkware For Juice Latte Iced Tea Vintage Ins Style
$1.01-5.19
Mix MOQ : 2
 · 
203 sold recently
Stainless Steel Mug Cute Cartoon Dog Pattern Stackable Camping Cup Portable Travel Drinkware For Outdoor Picnic Ins Style
Stainless Steel Mug Cute Cartoon Dog Pattern Stackable Camping Cup Portable Travel Drinkware For Outdoor Picnic Ins Style
like
Find Similar
Camping mug with cartoon dog print and Shopping Day text held in hand by coffee machine - Shopping Dog
Close-up of a hand holding an off-white stainless steel dog doodle camping mug outdoors - Reading Dog
Camping mug with cartoon dog surfing illustration and stackable stainless steel rim - Surfing Dog
Cartoon dog camping mug made of cream stainless steel for picnic and outdoor travel - Leisure Beach Dog
Stainless Steel Mug Cute Cartoon Dog Pattern Stackable Camping Cup Portable Travel Drinkware For Outdoor Picnic Ins Style
$2.18
No MOQ
 · 
33 views
Protein Shaker Bottle Plastic With Mixing Ball Scale Marks Leak Proof For Gym Fitness Sports Portable Drinking Cup
Protein Shaker Bottle Plastic With Mixing Ball Scale Marks Leak Proof For Gym Fitness Sports Portable Drinking Cup
like
Find Similar
Black and white protein shaker bottle with Monster Gym text and metal mixing ball - White
Large black and red protein shaker bottle with Spider logo for fitness and sports gym use - Red
Black and purple protein shaker bottle with scale and Spider Bottle logo for fitness - Purple
Black and green protein shaker bottle with scale and Spider logo for sports fitness - Green
+1
Protein Shaker Bottle Plastic With Mixing Ball Scale Marks Leak Proof For Gym Fitness Sports Portable Drinking Cup
$1.79
Mix MOQ : 2
 · 
70 views
Cute Cartoon Bear Insulated Stainless Steel Coffee Mug With Handle Lid And Foldable Spoon Portable Desktop Drinking Cup
Cute Cartoon Bear Insulated Stainless Steel Coffee Mug With Handle Lid And Foldable Spoon Portable Desktop Drinking Cup
like
Find Similar
500ml coffee brown stainless steel mug with cartoon bear design and handle - Single Cup / Coffee
500ml cream-colored 304 stainless steel coffee mug with a cute bear pattern and lid - Single Cup / Off White
500ml coffee brown 304 stainless steel mug with lid, folding spoon and bear pattern - Cup + Foldable Spoon / Coffee
Creamy white 500ml stainless steel mug with a cute bear print and folding spoon - Cup + Foldable Spoon / Off White
+2
Cute Cartoon Bear Insulated Stainless Steel Coffee Mug With Handle Lid And Foldable Spoon Portable Desktop Drinking Cup
$3.14-3.92
Mix MOQ : 2
 · 
48 sold recently
Rhinestone Silicone Cup Boot Protective Sleeve Anti Slip Bottom Cover For Tumblers Water Bottles Bling Accessory
Rhinestone Silicone Cup Boot Protective Sleeve Anti Slip Bottom Cover For Tumblers Water Bottles Bling Accessory
like
Find Similar
Wide mint green silicone protective boot with sparkling rhinestone finish for water bottles - AB Green Rhinestone/Seafoam Green Sleeve
Protective silicone cup sleeve with sparkling yellow rhinestones in wide band design - Gold Rhinestone/Brown Sleeve
Sage silicone boot for tumblers with sparkling olive and silver rhinestones - Silver Olive Rhinestone/Grey Green Sleeve
Sparkling red silicone cup sleeve with silver diamond rhinestones for sports water bottles - Silver Red Rhinestone/Red Sleeve
+10
Rhinestone Silicone Cup Boot Protective Sleeve Anti Slip Bottom Cover For Tumblers Water Bottles Bling Accessory
$3.17
Mix MOQ : 2
 · 
39 sold recently
Shaker Bottle Plastic With Mixer Ball Portable Sports Gym Fitness Leakproof Cup Flip Lid
Shaker Bottle Plastic With Mixer Ball Portable Sports Gym Fitness Leakproof Cup Flip Lid
like
Find Similar
Detail of portable shaker bottle with whisk ball on autumn grass for protein shakes - White
Close-up of portable red shaker bottle with mixing ball on grass with autumn leaves - Red
Detail of purple protein shaker bottle with mixing whisk ball on grass background - Purple
Detail of green sports protein shaker bottle with stainless steel mixing ball on grass - Green
+3
Shaker Bottle Plastic With Mixer Ball Portable Sports Gym Fitness Leakproof Cup Flip Lid
$1.17
Mix MOQ : 2
 · 
60 views
Borosilicate Glass Water Bottle With Protective Silicone Sleeve Portable Handle Lid Heat Resistant Wide Mouth Drinkware
Borosilicate Glass Water Bottle With Protective Silicone Sleeve Portable Handle Lid Heat Resistant Wide Mouth Drinkware
like
Find Similar
Large capacity borosilicate glass water bottle with pink protective silicone sleeve and handle - Pink
High borosilicate glass bottle with gray protective silicone sleeve and carry handle - Gray
Portable high borosilicate glass water bottle with light green silicone sleeve and handle - Green
Blue high borosilicate glass water bottle with protective silicone sleeve and handle - Blue
+2
Borosilicate Glass Water Bottle With Protective Silicone Sleeve Portable Handle Lid Heat Resistant Wide Mouth Drinkware
$8.07
Mix MOQ : 2
 · 
10 views
Protein Shaker Bottle BPA Free Plastic Sports Water Cup Mixing Ball Portable Leakproof For Gym Fitness Men Women
Protein Shaker Bottle BPA Free Plastic Sports Water Cup Mixing Ball Portable Leakproof For Gym Fitness Men Women
like
Find Similar
Translucent green protein shaker bottle with mixing grid and stylized H! print - 500ml / Green
Translucent black plastic fitness shaker bottle with black lid and H! graphic logo - 500ml / Black
Pink fitness protein shaker bottle with mixing ball and HI! print on white background - 500ml / Pink
Matte black plastic fitness shaker bottle with H! logo and secure flip-top lid - 350ml / New Black Checkerboard
+14
Protein Shaker Bottle BPA Free Plastic Sports Water Cup Mixing Ball Portable Leakproof For Gym Fitness Men Women
$1.12-1.35
No MOQ
 · 
355 sold recently
Portable Insulated Soup Cup 304 Stainless Steel Thermal Breakfast Jar With Silicone Handle For Office School
Portable Insulated Soup Cup 304 Stainless Steel Thermal Breakfast Jar With Silicone Handle For Office School
like
Find Similar
Mint green 304 stainless steel soup cup with handle and delicious lettering design - 304 Stainless Steel / 430ml Stainless Steel Haze Blue
Pink portable 304 stainless steel insulated soup mug with handle and matte finish - 304 Stainless Steel / 430ml Stainless Steel Sakura Pink
Green 304 stainless steel insulated soup cup with handle and DELICIOUS lettering - 304 Stainless Steel / 430ml Stainless Steel Matcha Green
Portable blue 304 stainless steel breakfast soup cup with PP liner and handle - PP / 380ml Plastic Haze Blue
+2
Portable Insulated Soup Cup 304 Stainless Steel Thermal Breakfast Jar With Silicone Handle For Office School
$2.54-4.01
No MOQ
 · 
50 views
Double Layer 304 Stainless Steel Water Cup 330ml Insulated Coffee Mug Anti-Slip Hammered Texture Beer Tumbler For Home Office
Double Layer 304 Stainless Steel Water Cup 330ml Insulated Coffee Mug Anti-Slip Hammered Texture Beer Tumbler For Home Office
like
Find Similar
330ml hammer textured 304 stainless steel cup with measurements and double-wall design - Natural
Golden 304 stainless steel tumbler with wave texture and 330ml capacity for daily use - Gold
330ml bronze finish 304 stainless steel tumbler with wave texture and dimensions - Rose Gold
Black 330ml double wall 304 stainless steel tumbler with vertical ripple wave texture - Black
+2
Double Layer 304 Stainless Steel Water Cup 330ml Insulated Coffee Mug Anti-Slip Hammered Texture Beer Tumbler For Home Office
-5%
$4.04-4.96
Mix MOQ : 2
304 Stainless Steel Food Tongs Hollow Three Line Design Heat Resistant BBQ Steak Bread Serving Tongs Mirror Polished
304 Stainless Steel Food Tongs Hollow Three Line Design Heat Resistant BBQ Steak Bread Serving Tongs Mirror Polished
like
Find Similar
24cm 304 stainless steel food tongs with 1mm thickness for BBQ and bread serving - Small (24cm) / 93g
28cm SUS 304 stainless steel food tongs with 1mm thickness and hollowed-out oil filter design - Medium (28cm) / 108g
Long 33cm SUS304 stainless steel food tongs for BBQ and steak with 1mm thickness - Large (33cm) / 124g
304 Stainless Steel Food Tongs Hollow Three Line Design Heat Resistant BBQ Steak Bread Serving Tongs Mirror Polished
-5%
$1.23-1.43
No MOQ
Tritan Straw Water Bottle BPA Free Portable Drinking Cup With Silicone Handle And Metal Straw Leak Proof Outdoor
Tritan Straw Water Bottle BPA Free Portable Drinking Cup With Silicone Handle And Metal Straw Leak Proof Outdoor
like
Find Similar
Outdoor 740ml Tritan straw cup with pink lid and silicone carry strap in transparent finish - 740ml / Rose Red
740ml Tritan water bottle with yellow lid, integrated straw and portable silicone handle - 740ml / Yellow
Minimalist transparent Tritan straw cup with matte black lid and silicone carry handle - 740ml / Black
Detail of clear Tritan water bottle showing white lid, internal straw and silicone handle - 740ml / White
+12
Tritan Straw Water Bottle BPA Free Portable Drinking Cup With Silicone Handle And Metal Straw Leak Proof Outdoor
$7.20
Mix MOQ : 2
 · 
26 views
40oz Stainless Steel Vacuum Insulated Tumbler With Handle And Straw Tie Dye Marble Pattern Car Coffee Mug For Travel Home
40oz Stainless Steel Vacuum Insulated Tumbler With Handle And Straw Tie Dye Marble Pattern Car Coffee Mug For Travel Home
like
Find Similar
Tie-dye 40oz stainless steel tumbler with handle and straw for car use. - 40oz / Peach Tie-dye
40oz purple tie-dye stainless steel vacuum insulated tumbler with handle and straw - 40oz / Tie Dye Purple
Green and White 40oz Tie-Dye Stainless Steel Insulated Tumbler with Handle and Clear Straw - 40oz / Tie Dye Green
40oz tie-dye stainless steel insulated tumbler with handle and straw - 40oz / Tie-Dye Blue
+2
40oz Stainless Steel Vacuum Insulated Tumbler With Handle And Straw Tie Dye Marble Pattern Car Coffee Mug For Travel Home
$8.93
Mix MOQ : 2
 · 
11 sold recently
Mini Tactical Vest Beer Bottle Cooler Nylon MOLLE Beverage Decorative Cover Adjustable Military Style Bar Accessory
Mini Tactical Vest Beer Bottle Cooler Nylon MOLLE Beverage Decorative Cover Adjustable Military Style Bar Accessory
like
Find Similar
Tactical vest bottle cooler in olive green nylon with MOLLE system for beverage decoration - Green
Khaki tactical vest bottle cooler with MOLLE webbing for beverage bottles - Khaki
Tactical vest bottle cooler in black nylon with MOLLE system for beverage cans and beer - Black
Tactical vest beer bottle cooler in grey digital camo pattern with adjustable straps - ACU Camouflage
+3
Mini Tactical Vest Beer Bottle Cooler Nylon MOLLE Beverage Decorative Cover Adjustable Military Style Bar Accessory
-5%
$3.56
No MOQ
 · 
18 sold recently
Gradient 304 Stainless Steel Vacuum Insulated Tumbler With Portable Handle And Straw Lid Travel Mug For Car Office
Gradient 304 Stainless Steel Vacuum Insulated Tumbler With Portable Handle And Straw Lid Travel Mug For Car Office
like
Find Similar
Detail of 30oz insulated tumbler with blue and yellow gradient finish and white handle - 30oz / Blue-Yellow Gradient
Detailed close-up of 30oz stainless steel tumbler with pink and purple gradient finish - 30oz / Gradient Pink Purple
Detail of pink and yellow gradient 30oz stainless steel tumbler with handle and lid - 30oz / Pink-Yellow Gradient
Detail view of 30oz insulated stainless steel tumbler with yellow-white gradient and handle - 30oz / White-Green Gradient
+1
Gradient 304 Stainless Steel Vacuum Insulated Tumbler With Portable Handle And Straw Lid Travel Mug For Car Office
$4.85
Mix MOQ : 2
 · 
79 views
Professional Stainless Steel Hawthorne Cocktail Strainer Fine Mesh Spring Bar Ice Filter Tool For Bartending Mixing
Professional Stainless Steel Hawthorne Cocktail Strainer Fine Mesh Spring Bar Ice Filter Tool For Bartending Mixing
like
Find Similar
Polished silver stainless steel Hawthorne strainer with tight spring coil for cocktails - Straight Handle Cat Head Strainer
Polished stainless steel cocktail strainer with circular perforations and hanging handle - Julep Spoon Strainer
Silver stainless steel Hawthorne cocktail strainer with spiral spring for mixology - 4-Prong Hawthorne Strainer
Polished stainless steel Hawthorne strainer with high-density spring and three-slit design - Tube Handle 5-Stripe Strainer
+9
Professional Stainless Steel Hawthorne Cocktail Strainer Fine Mesh Spring Bar Ice Filter Tool For Bartending Mixing
$0.63-2.39
No MOQ
 · 
55 sold recently
Portable Rectangular Flat Water Bottle Plastic Leakproof Lightning Bolt Design With Adjustable Shoulder Strap For Outdoor
Portable Rectangular Flat Water Bottle Plastic Leakproof Lightning Bolt Design With Adjustable Shoulder Strap For Outdoor
like
Find Similar
Pink rectangular plastic water bottle with lightning pattern and adjustable crossbody strap - 450ml / Girl Pink
Detail of blue rectangular plastic water bottle with lightning pattern and shoulder strap - 450ml / Ice Blue
Detail of purple square plastic water bottle with adjustable strap held outdoors - 450ml / Dreamy Purple
Detail of durable zinc alloy hooks and patterned strap on a yellow rectangular water bottle - 450ml / Light Orange Yellow
+1
Portable Rectangular Flat Water Bottle Plastic Leakproof Lightning Bolt Design With Adjustable Shoulder Strap For Outdoor
-5%
$3.97
Mix MOQ : 2
 · 
42 views
Square Plastic Water Bottle Leakproof Pop Lid With Adjustable Shoulder Strap For Sports Fitness Gym Outdoor Portable Clear
Square Plastic Water Bottle Leakproof Pop Lid With Adjustable Shoulder Strap For Sports Fitness Gym Outdoor Portable Clear
like
Find Similar
Sleek 750ml square fitness water bottle in transparent finish with white strap and time scale - 750ml / Time Scale Style / YB-0791 White
Pink 750ml square fitness water bottle with straw, time marker and carrying strap - 750ml / Time Scale Style / YB-0791 Pink
Cyan 750ml square fitness water bottle with time markers and adjustable strap - 750ml / Time Scale Style / YB-0791 Green
Minimalist square 750ml blue plastic sports bottle with straw and time marker - 750ml / Time Scale Style / YB-0791 Blue
+4
Square Plastic Water Bottle Leakproof Pop Lid With Adjustable Shoulder Strap For Sports Fitness Gym Outdoor Portable Clear
-4%
$3.54
No MOQ
 · 
32 views
Square Glass Water Cup With Glass Straw And Pink Bow Decoration 400ml High Borosilicate Glass Cup For Coffee Milk Juice Women
Square Glass Water Cup With Glass Straw And Pink Bow Decoration 400ml High Borosilicate Glass Cup For Coffee Milk Juice Women
like
Find Similar
Square glass water bottle with bamboo lid, glass straw, and cute pink bow decorations - 400ml / Bamboo Lid Bow Style
Square glass water bottle with pink 3D bows and matching straw on white pedestal - 400ml / Plastic Lid Bow Style
Square Glass Water Cup With Glass Straw And Pink Bow Decoration 400ml High Borosilicate Glass Cup For Coffee Milk Juice Women
$1.41
No MOQ
 · 
37 views
Modern Bamboo Joint High Borosilicate Glass Cup Heat Resistant Clear Coffee Mug For Iced Americano Latte Milk Juice Tea Water Glass
Modern Bamboo Joint High Borosilicate Glass Cup Heat Resistant Clear Coffee Mug For Iced Americano Latte Milk Juice Tea Water Glass
like
Find Similar
Bamboo-shaped borosilicate glass cup for iced Americano and latte with ribbed design - 415ml / Bamboo Joint Design
Modern Bamboo Joint High Borosilicate Glass Cup Heat Resistant Clear Coffee Mug For Iced Americano Latte Milk Juice Tea Water Glass
-11%
$1.07
No MOQ
 · 
27 views
Multi-Functional Manual Can Opener Yellow V-Shaped Non-Slip Bottle Lid Twist Opener Durable Plastic Metal Kitchen Tool For Elderly
Multi-Functional Manual Can Opener Yellow V-Shaped Non-Slip Bottle Lid Twist Opener Durable Plastic Metal Kitchen Tool For Elderly
like
Find Similar
1 option
Multi-Functional Manual Can Opener Yellow V-Shaped Non-Slip Bottle Lid Twist Opener Durable Plastic Metal Kitchen Tool For Elderly
-87%
$0.02
Mix MOQ : 3
 · 
32 views
Floral Cup Accessories Set Silicone Straw Cover Boot Decoration With Artificial Pearl Chain Heart Charm For Large Water Bottle Women
Floral Cup Accessories Set Silicone Straw Cover Boot Decoration With Artificial Pearl Chain Heart Charm For Large Water Bottle Women
like
Find Similar
All-black 40oz water bottle accessory set with silicone cover, straw topper and charms - Black
Light blue insulated tumbler with flower straw cover and pearl charm accessory kit - Light Blue
Vibrant orange water bottle accessory set with silicone flower charms and pearl chain - Orange
Pink tumbler accessory set with silicone straw cover, pearl chain, and heart keychain - Pink
+4
Floral Cup Accessories Set Silicone Straw Cover Boot Decoration With Artificial Pearl Chain Heart Charm For Large Water Bottle Women
-4%
$5.20
Mix MOQ : 3
Square Plastic Water Bottle With Straw Portable Strap Leakproof Lock Outdoor Sports Fitness Bottle For Student Adult
Square Plastic Water Bottle With Straw Portable Strap Leakproof Lock Outdoor Sports Fitness Bottle For Student Adult
like
Find Similar
Close-up of 720ml square water bottle with purple silicone sleeve and hand strap - 720ml / Blue
720ml purple square water bottle with straw, carrying strap and cartoon stickers - 720ml / Purple
720ml square plastic water bottle with straw and orange non-slip sleeve in hand - 720ml / Pink
Close-up of 720ml square orange water bottle with straw, stickers and silicone sleeve - 720ml / Yellow
+4
Square Plastic Water Bottle With Straw Portable Strap Leakproof Lock Outdoor Sports Fitness Bottle For Student Adult
-5%
$2.57-2.71
No MOQ
 · 
53 views
Can Crusher Manual Wall Mounted Heavy Duty Metal Recycling Tool For Aluminum Beer Soda Cans With Soft Grip Handle
Can Crusher Manual Wall Mounted Heavy Duty Metal Recycling Tool For Aluminum Beer Soda Cans With Soft Grip Handle
like
Find Similar
Manual wall-mounted soda can crusher in vibrant red finish with ergonomic black lever - Red
Wall-mounted heavy duty metal can crusher in black finish with non-slip handle grip - Black
Manual wall-mounted gray metal soda can crusher with ergonomic black non-slip handle - Space Gray
Close-up of wall-mounted yellow can crusher showing its manual handle and sturdy frame - Yellow
Can Crusher Manual Wall Mounted Heavy Duty Metal Recycling Tool For Aluminum Beer Soda Cans With Soft Grip Handle
-5%
$4.18
No MOQ
 · 
32 sold recently
Stainless Steel Funnels With Cleaning Brush Mini Small Funnels For Liquid Spices Essential Oils Kitchen Filling Tool
Stainless Steel Funnels With Cleaning Brush Mini Small Funnels For Liquid Spices Essential Oils Kitchen Filling Tool
like
Find Similar
Stainless steel mini funnel set with long handles and cleaning brushes for kitchen use - 3Pcs Long Handle Funnel Set + 2 Cleaning Brushes
Three-piece stainless steel mini funnel set for oil and liquid with a metal ring - 3Pcs Long Handle Funnel Set
Stainless steel mini funnel set of 3 with cleaning brush on white background - 3Pcs Long Handle Funnel Set + 1 Cleaning Brush
3-piece stainless steel funnel set with cleaning brushes for oils and liquids - 3Pcs Long Handle Funnel Set + 3 Cleaning Brushes
Stainless Steel Funnels With Cleaning Brush Mini Small Funnels For Liquid Spices Essential Oils Kitchen Filling Tool
-5%
$2.16-2.51
Mix MOQ : 2
 · 
98 sold recently
40oz Rhinestone Insulated Tumbler Stainless Steel Vacuum Cup With Handle Straw Baseball Football Pattern Sporty Travel Car Mug
40oz Rhinestone Insulated Tumbler Stainless Steel Vacuum Cup With Handle Straw Baseball Football Pattern Sporty Travel Car Mug
like
Find Similar
Detailed macro view of a 40oz baseball rhinestone tumbler featuring a white handle. - 40oz / White
Close-up of 40oz stainless steel baseball rhinestone tumbler with handle and lid. - 40oz / Yellow
40oz stainless steel tumbler with orange baseball rhinestone design and handle - 40oz / Orange
40oz Rhinestone Insulated Tumbler Stainless Steel Vacuum Cup With Handle Straw Baseball Football Pattern Sporty Travel Car Mug
-4%
$9.73
Mix MOQ : 2
 · 
13 sold recently
Foldable Silicone Water Bottle Collapsible Leakproof Portable Outdoor Sports Travel Cup BPA Free Lightweight Flexible
Foldable Silicone Water Bottle Collapsible Leakproof Portable Outdoor Sports Travel Cup BPA Free Lightweight Flexible
like
Find Similar
Collapsible blue 600ml silicone sports water bottle in both expanded and folded states - Blue
Collapsible 600ml light blue silicone sports bottle shown expanded and folded - Gray
+4
Foldable Silicone Water Bottle Collapsible Leakproof Portable Outdoor Sports Travel Cup BPA Free Lightweight Flexible
$2.16-4.32
Mix MOQ : 2
 · 
60 views
Silicone Winged Heart Straw Topper Cover With Artificial Pearl Chain Tumbler Charm For Drinking Cup Dust Proof Decorative Accessories
Silicone Winged Heart Straw Topper Cover With Artificial Pearl Chain Tumbler Charm For Drinking Cup Dust Proof Decorative Accessories
like
Find Similar
Stanley cup accessory set with pearl chain and red winged heart straw cover topper - Straw Cap + Pearl Chain / Set-Red
Stanley cup straw accessory set with pearl chain and yellow winged heart pendant charm - Straw Cap + Pearl Chain / Set-Yellow
Blue heart wing straw topper set with faux pearl charm for 40oz tumblers - Straw Cap + Pearl Chain / Set-Blue
Stanley cup pearl charm set featuring a purple heart with wings and white beads - Straw Cap + Pearl Chain / Set-Purple
+5
Silicone Winged Heart Straw Topper Cover With Artificial Pearl Chain Tumbler Charm For Drinking Cup Dust Proof Decorative Accessories
-5%
$0.21-4.92
No MOQ
 · 
22 views
Oil Bottle Pourer Stopper Dispenser Spout Press Type Leakproof Kitchen Accessory For Soy Sauce Vinegar
Oil Bottle Pourer Stopper Dispenser Spout Press Type Leakproof Kitchen Accessory For Soy Sauce Vinegar
like
Find Similar
Kitchen oil bottle pourer with black lever and silver finish for precise liquid pouring - Large
Kitchen oil bottle pourer with black plastic flip top and metal nozzle on white background - Standard
Oil Bottle Pourer Stopper Dispenser Spout Press Type Leakproof Kitchen Accessory For Soy Sauce Vinegar
$0.01
Mix MOQ : 4
 · 
17 sold recently
Stainless Steel Chopstick Holder Golden Cutlery Organizer Hollowed Drainage Kitchen Countertop Storage Rack With Base
Stainless Steel Chopstick Holder Golden Cutlery Organizer Hollowed Drainage Kitchen Countertop Storage Rack With Base
like
Find Similar
Modern gold stainless steel utensil holder with hollow drainage holes for kitchen storage - 10CM Thickened 15CM High Silver
Golden stainless steel kitchen utensil holder set with drainage holes for chopsticks - 10CM Thickened 17CM High Gold
Gold stainless steel utensil holder in cylindrical design with 17.2cm height and 12.5cm base - 10CM Solid Gold With Base
Golden stainless steel chopstick holder with drainage holes and 17.2cm height - 10CM Perforated Gold With Base
+11
Stainless Steel Chopstick Holder Golden Cutlery Organizer Hollowed Drainage Kitchen Countertop Storage Rack With Base
-5%
$0.74-2.41
Mix MOQ : 5
 · 
25 views
Ribbed Glass Cup With Bamboo Lid And Glass Straw High Borosilicate Heat Resistant Tumbler For Iced Coffee Fruit Tea
Ribbed Glass Cup With Bamboo Lid And Glass Straw High Borosilicate Heat Resistant Tumbler For Iced Coffee Fruit Tea
like
Find Similar
8 options
Ribbed Glass Cup With Bamboo Lid And Glass Straw High Borosilicate Heat Resistant Tumbler For Iced Coffee Fruit Tea
$2.59-13.83
No MOQ
 · 
20 views
Cute Bow Knot Borosilicate Glass Cup Vertical Stripe Heat Resistant Coffee Cup Ruffle Rim Drinking Water Glass Women Gift
Cute Bow Knot Borosilicate Glass Cup Vertical Stripe Heat Resistant Coffee Cup Ruffle Rim Drinking Water Glass Women Gift
like
Find Similar
Pink ribbon borosilicate glass coffee cup with ribbed vertical stripes and wavy rim - 350ml / Purple Bowknot
Pink bow ripple glass cup, heat-resistant borosilicate coffee mug with vertical stripes - 350ml / Pink Bowknot
Pink ribbon bow glass cup with vertical stripes and heat resistant borosilicate glass - 350ml / Dark Pink Bowknot
Cute Bow Knot Borosilicate Glass Cup Vertical Stripe Heat Resistant Coffee Cup Ruffle Rim Drinking Water Glass Women Gift
$1.30
No MOQ
 · 
23 views
Natural Crystal Merkaba Star Wine Bottle Stopper Zinc Alloy Reusable Vacuum Sealer Decorative Champagne Plug Barware Accessory
Natural Crystal Merkaba Star Wine Bottle Stopper Zinc Alloy Reusable Vacuum Sealer Decorative Champagne Plug Barware Accessory
like
Find Similar
Red jasper Merkaba star wine stopper with zinc alloy base and silicone seal - Bloodstone
Ruby in Zoisite crystal star wine bottle stopper with stainless steel and silicone seal - Ruby Zoisite
Green crystal Merkaba star wine stopper with zinc alloy base and silicone seal - India Agate
Tiger eye stone Merkaba star wine bottle stopper with polished metal and silicone seal - Tiger's Eye
+12
Natural Crystal Merkaba Star Wine Bottle Stopper Zinc Alloy Reusable Vacuum Sealer Decorative Champagne Plug Barware Accessory
-4%
$1.84
No MOQ
Free Shipping
Reusable Drinking Straw Set Large Diameter For Boba Tritan Silicone Detachable With Cleaning Brush Drinkware
Reusable Drinking Straw Set Large Diameter For Boba Tritan Silicone Detachable With Cleaning Brush Drinkware
like
Find Similar
Reusable 1.2cm black TRITAN telescopic straw with cleaning brush on green background - 1.2x21cm / Black
Reusable Tritan telescopic straw set in cream color with a dedicated cleaning brush - 1.2x21cm / Cream
Reusable Tritan straw set in light pink with cleaning brush and silicone tip 1.2x21cm - 1.2x21cm / Light Pink
Light blue 1.2x21cm Tritan telescopic straw set with silicone tip and cleaning brush - 1.2x21cm / Cyan White
+26
Reusable Drinking Straw Set Large Diameter For Boba Tritan Silicone Detachable With Cleaning Brush Drinkware
$1.96
Mix MOQ : 5
 · 
18 views
Free Shipping
Insulated Coffee Mug 316 Stainless Steel Ceramic Liner With Strap And Straw Portable Travel Tumbler Cup
Insulated Coffee Mug 316 Stainless Steel Ceramic Liner With Strap And Straw Portable Travel Tumbler Cup
like
Find Similar
Freedom series tricolor coffee tumbler with woven strap and matte brown finish - Blue & Coffee - Freedom
Brown and light blue stainless steel coffee tumbler with handle and cute 3D duck charm - Blue & Coffee - 3D Duck
Pink and yellow cartoon coffee tumbler with duck patch and portable carry strap - Pink & White - 3D Fruit & Blue Duck
Insulated Coffee Mug 316 Stainless Steel Ceramic Liner With Strap And Straw Portable Travel Tumbler Cup
-5%
$7.39
No MOQ
 · 
38 views
Striped Wave Glass Cup With Bow And Glass Straw Heat Resistant Creative Clear Mug For Water Juice Milk Girl Gift
Striped Wave Glass Cup With Bow And Glass Straw Heat Resistant Creative Clear Mug For Water Juice Milk Girl Gift
like
Find Similar
Striped glass mug with a pink glitter bow and elegant scalloped rim for girls - Striped Ripple Style / Pink Plaid Bow
Vertical stripe glass mug with blue checkered bowknot and elegant wavy rim for girls - Striped Ripple Style / Blue Plaid Bow
Vintage style ribbed glass mug with a green checkered resin bow decoration - Striped Ripple Style / Green Plaid Bow Tie
Pink checkered bow glass cup with vertical stripe texture and wave rim design - Striped Ripple Style / Dark Pink Bow
Striped Wave Glass Cup With Bow And Glass Straw Heat Resistant Creative Clear Mug For Water Juice Milk Girl Gift
-5%
$1.23
No MOQ
 · 
26 views
Wide Mouth Canning Funnel Stainless Steel With Handle For Filling Mason Jars Jam Liquid Dry Goods Kitchen Tool
Wide Mouth Canning Funnel Stainless Steel With Handle For Filling Mason Jars Jam Liquid Dry Goods Kitchen Tool
like
Find Similar
Large wide mouth canning funnel in stainless steel with handle and size annotations - Original Large
Small stainless steel wide mouth canning funnel with handle for kitchen use - Original Small
Polished golden stainless steel wide mouth canning funnel with side handle for kitchen - Small Gold
Dual sizes of stainless steel wide mouth funnels with handles for kitchen canning - Silver 2-Piece Set
Wide Mouth Canning Funnel Stainless Steel With Handle For Filling Mason Jars Jam Liquid Dry Goods Kitchen Tool
-5%
$1.35-3.18
No MOQ
Portable Insulated Soup Cup 304 Stainless Steel Breakfast Jar With Folding Spoon Handle Leakproof Thermal Food Container
Portable Insulated Soup Cup 304 Stainless Steel Breakfast Jar With Folding Spoon Handle Leakproof Thermal Food Container
like
Find Similar
Navy blue 304 stainless steel insulated soup cup with convenient carrying handle - 430ml / Blue
Portable purple stainless steel soup cup with handle and 304 steel inner liner - 430ml / Purple
Portable cream 304 stainless steel insulated soup cup with handle for breakfast - 430ml / Yellow
Portable Insulated Soup Cup 304 Stainless Steel Breakfast Jar With Folding Spoon Handle Leakproof Thermal Food Container
$3.89
No MOQ
Transparent Glass Cold Water Pitcher With Lid Nordic Style Patterned Print Decorative Water Jug For Juice Milk Beverage
Transparent Glass Cold Water Pitcher With Lid Nordic Style Patterned Print Decorative Water Jug For Juice Milk Beverage
like
Find Similar
900ml glass water pitcher with black cat botanical print and white lid variant - Black with Letters
Glass water carafe with bright orange lid and colorful cartoon bus graphic design - Vintage Bus
Glass water pitcher with tropical green leaf prints and a flat grass green lid - Monstera Leaf
Glass pitcher with green lid and leaf pattern for cold water and herbal iced tea - Leaf
+3
Transparent Glass Cold Water Pitcher With Lid Nordic Style Patterned Print Decorative Water Jug For Juice Milk Beverage
-4%
$3.29
Mix MOQ : 10
 · 
13 views
Coffee Capsule Holder Metal Wire Storage Basket Cup Teapot Shaped Organizer Rack For Kitchen Bar Countertop Iron Art Hollow
Coffee Capsule Holder Metal Wire Storage Basket Cup Teapot Shaped Organizer Rack For Kitchen Bar Countertop Iron Art Hollow
like
Find Similar
Golden coffee cup shaped wire storage basket with metal coffee sign for capsule pods - Teapot Style / Gold
Black metal coffee capsule holder with cutout cup design and COFFEE label - Teapot Style / Black
Gold wire coffee capsule storage basket in cup shape with hollow coffee logo - Wide Mug Style / Gold
Black metal wire coffee pod organizer basket with handle and decorative sign - Wide Mug Style / Black
Coffee Capsule Holder Metal Wire Storage Basket Cup Teapot Shaped Organizer Rack For Kitchen Bar Countertop Iron Art Hollow
-5%
$1.59-2.00
No MOQ
 · 
10 views
Adjustable Pot Rack Organizer Carbon Steel Multi Tier Kitchen Storage Under Sink Cabinet Countertop Shelf Rustproof
Adjustable Pot Rack Organizer Carbon Steel Multi Tier Kitchen Storage Under Sink Cabinet Countertop Shelf Rustproof
like
Find Similar
Gunmetal grey 2-tier adjustable kitchen pot rack organizer for cabinet storage - 2-Tier / Gunmetal
Gunmetal grey 3-tier adjustable kitchen pot rack organizer in heavy duty metal - 3-Layer / Gunmetal
4-tier gunmetal gray kitchen pot rack organizer, size 230x285x520mm for cabinet storage - 4 Layers / Gunmetal
Black 2-tier adjustable carbon steel pot rack with height-adjustable shelves for kitchen - 2-Tier / Black
+2
Adjustable Pot Rack Organizer Carbon Steel Multi Tier Kitchen Storage Under Sink Cabinet Countertop Shelf Rustproof
-5%
$12.59-21.35
No MOQ
 · 
21 views
304 Stainless Steel Soup Cup Breakfast Milk Cup Portable Thermal Food Jar With Handle And Spoon Ins Style
304 Stainless Steel Soup Cup Breakfast Milk Cup Portable Thermal Food Jar With Handle And Spoon Ins Style
like
Find Similar
Portable stainless steel soup cup in yellow and blue with a white spoon inside the lid - Blue
Dark green 304 stainless steel insulated soup cup with mint lid and built-in spoon - Green
Pink double-layer stainless steel soup cup with lid and portable spoon and fork - Pink
304 Stainless Steel Soup Cup Breakfast Milk Cup Portable Thermal Food Jar With Handle And Spoon Ins Style
$3.75
Mix MOQ : 2
Refrigerator Cold Water Kettle With Tap PP Plastic Large Capacity Slim Drink Dispenser For Juice Iced Tea Milk
Refrigerator Cold Water Kettle With Tap PP Plastic Large Capacity Slim Drink Dispenser For Juice Iced Tea Milk
like
Find Similar
3.5L Large capacity cold water kettle with faucet and sealed lid for fridge juice storage - 3.5L Medium Capacity
5.0L large capacity white beverage dispenser with faucet for fridge and DIY drinks - 5.0L Large Capacity
Refrigerator Cold Water Kettle With Tap PP Plastic Large Capacity Slim Drink Dispenser For Juice Iced Tea Milk
-4%
$2.74-3.83
No MOQ
 · 
13 views
Manual Beer Beverage Opener Zinc Alloy Retro Pattern Kitchen Tool Bar Accessory Gift Case
Manual Beer Beverage Opener Zinc Alloy Retro Pattern Kitchen Tool Bar Accessory Gift Case
like
Find Similar
Detailed view of teardrop metal bottle opener with character engraving in gift tin box - Silver (Character Jiu Boxed)
Macro view of teardrop stainless steel bottle opener with engraved wine character - Silver (Character Jiu OPP Bag)
Premium silver stainless steel bottle opener in a metal gift box with black lining - Silver (Character Maofeng Boxed)
Premium teardrop metal bottle opener with traditional pattern in a silver tin gift box - Silver (Character Fu Boxed)
+7
Manual Beer Beverage Opener Zinc Alloy Retro Pattern Kitchen Tool Bar Accessory Gift Case
$0.72-1.15
No MOQ
304 Stainless Steel Thickened Soup Spoon With Pouring Spout Mirror Polished Sauce Drizzling Spoon Kitchen Cooking Utensils
304 Stainless Steel Thickened Soup Spoon With Pouring Spout Mirror Polished Sauce Drizzling Spoon Kitchen Cooking Utensils
like
Find Similar
304 stainless steel soup ladle with iridescent rainbow finish and 22cm long handle - Magic Red
304 stainless steel drizzle spoon with pour spout and long handle for kitchen - Silver
Golden 304 stainless steel oil separator spoon with 22cm length and 8.4cm width - Gold
Rainbow 304 stainless steel oil ladle with pour spout measuring 22cm and 105.3g - AB Color
+1
304 Stainless Steel Thickened Soup Spoon With Pouring Spout Mirror Polished Sauce Drizzling Spoon Kitchen Cooking Utensils
-5%
$1.70-2.51
Mix MOQ : 2
Large Capacity Borosilicate Glass Straw Cup With Stainless Steel Straw And Lid World Map Coffee Belt Design Tumbler
Large Capacity Borosilicate Glass Straw Cup With Stainless Steel Straw And Lid World Map Coffee Belt Design Tumbler
like
Find Similar
1000ml large glass tumbler with metal straw and world map design for iced coffee - Single Cup
1000ml high borosilicate glass straw cup with white leather sleeve for coffee tea - Cup with Sleeve
Large Capacity Borosilicate Glass Straw Cup With Stainless Steel Straw And Lid World Map Coffee Belt Design Tumbler
$4.90-5.48
Mix MOQ : 2
 · 
44 views
Butterfly Borosilicate Glass Straw Cup With Lid 3D Aesthetic Hammered Texture Fruit Tea Mug For Women Home Coffee Cup
Butterfly Borosilicate Glass Straw Cup With Lid 3D Aesthetic Hammered Texture Fruit Tea Mug For Women Home Coffee Cup
like
Find Similar
Detailed view of the butterfly glass cup with hammered texture and straight vertical ridges - 550ml / Black Grey Butterfly
Creative butterfly glass tumbler with straw, featuring dual-texture and 3D gradient wings - 550ml / Gradient Green Butterfly
Butterfly Borosilicate Glass Straw Cup With Lid 3D Aesthetic Hammered Texture Fruit Tea Mug For Women Home Coffee Cup
$3.46
No MOQ
 · 
25 views
Stainless Steel Food Sealing Clips Heavy Duty Bag Sealer For Kitchen Snacks Coffee Storage Moisture Proof Metal Clips
Stainless Steel Food Sealing Clips Heavy Duty Bag Sealer For Kitchen Snacks Coffee Storage Moisture Proof Metal Clips
like
Find Similar
7.8cm stainless steel wide food clip for sealing snacks with size and weight dimensions - Silver
Large gold stainless steel snack clip with brushed metal finish, size 7.8x6.3cm, 44g - Gold
Rose gold stainless steel 7.8cm sealing clip for snacks and office files - Rose Gold
Large black brushed stainless steel T-shape food sealing clip weighing 44g - Black
Stainless Steel Food Sealing Clips Heavy Duty Bag Sealer For Kitchen Snacks Coffee Storage Moisture Proof Metal Clips
$0.37-0.81
No MOQ
 · 
70 sold recently
Square Sports Water Bottle Large Capacity Portable Leakproof Plastic Drinkware For Fitness Outdoor Gym With Handle
Square Sports Water Bottle Large Capacity Portable Leakproof Plastic Drinkware For Fitness Outdoor Gym With Handle
like
Find Similar
Pink transparent square sports water bottle with orange handle on a sunny beach - Red
Flat purple gradient square sports water bottle with orange handle held by a woman - Purple
Clear square plastic fitness water bottle with blue handle and cap on beach sand - Blue
Dark grey transparent square sports water bottle with handle and internal ice element - Black
Square Sports Water Bottle Large Capacity Portable Leakproof Plastic Drinkware For Fitness Outdoor Gym With Handle
$3.40
Mix MOQ : 2
 · 
12 views
Coffee Capsule Storage Basket Iron Wire Rack Hollow Design Metal Organizer For Kitchen Countertop Espresso Pod Holder
Coffee Capsule Storage Basket Iron Wire Rack Hollow Design Metal Organizer For Kitchen Countertop Espresso Pod Holder
like
Find Similar
Golden iron wire coffee capsule storage basket with COFFEE logo, size 18x23cm - Large / Gold
Brown iron wire coffee capsule storage basket with COFFEE metal plaque 18x23cm - Large / Coffee
Golden iron mesh coffee capsule storage basket with COFFEE cutout logo, 15cm height - Small / Gold
Nordic black metal wire coffee pod basket with COFFEE cutout, 14cm wide by 15cm high - Small / Black
+4
Coffee Capsule Storage Basket Iron Wire Rack Hollow Design Metal Organizer For Kitchen Countertop Espresso Pod Holder
-5%
$2.74-4.19
Mix MOQ : 2
Wall Mounted Bottle Opener Wood And Metal With Cap Collector Basket Retro Bottle Shape Creative Kitchen Bar Decoration
Wall Mounted Bottle Opener Wood And Metal With Cap Collector Basket Retro Bottle Shape Creative Kitchen Bar Decoration
like
Find Similar
Wall-mounted wooden beer bottle opener with vintage bronze hardware and cap catcher basket - Retro Color
Wall Mounted Bottle Opener Wood And Metal With Cap Collector Basket Retro Bottle Shape Creative Kitchen Bar Decoration
-4%
$8.38
Mix MOQ : 2
 · 
15 sold recently
Stainless Steel Food Tongs Slotted Kitchen Cooking Clips BBQ Steak Bread Salad Serving Heat Resistant Mirror Polished
Stainless Steel Food Tongs Slotted Kitchen Cooking Clips BBQ Steak Bread Salad Serving Heat Resistant Mirror Polished
like
Find Similar
12-inch SUS 304 stainless steel food tongs with slotted head and 290mm length - 304 Thick 12 Inch (0.8mm)
9-inch 304 stainless steel food tongs with specific size and 75g weight specifications - 304 Thick 9 Inch (0.8mm)
9-inch 304 stainless steel food tongs with hollow-out design for BBQ and serving - 304 Extra Thick 9 Inch (1.2mm)
12-inch 304 stainless steel food tongs for BBQ and steak, length 287mm, weight 130g - 304 Extra Thick 12 Inch (1.2mm)
+11
Stainless Steel Food Tongs Slotted Kitchen Cooking Clips BBQ Steak Bread Salad Serving Heat Resistant Mirror Polished
-5%
$0.41-1.79
Mix MOQ : 2
 · 
10 views
Deer Head Wine Bottle Stopper Zinc Alloy Silver Reusable Leak-Proof Beverage Sealer Decorative Christmas Bar Accessories
Deer Head Wine Bottle Stopper Zinc Alloy Silver Reusable Leak-Proof Beverage Sealer Decorative Christmas Bar Accessories
like
Find Similar
Elegant silver reindeer head wine stopper with leak-proof rubber seals on a ceramic plate - Deer Head (JS-003)
Deer Head Wine Bottle Stopper Zinc Alloy Silver Reusable Leak-Proof Beverage Sealer Decorative Christmas Bar Accessories
$1.87
Mix MOQ : 12
Sports Water Bottles Plastic Gradient Color Leakproof Large Capacity Motivational With Straw For Gym Outdoor Fitness Adult
Sports Water Bottles Plastic Gradient Color Leakproof Large Capacity Motivational With Straw For Gym Outdoor Fitness Adult
like
Find Similar
Set of 4 gradient orange to purple sports water bottles in 3300ml to 300ml sizes - Pink-Purple Gradient (KX-8041)
Set of 4 gradient orange and blue sports water bottles with straw and 3300ml capacity - Orange-Blue Gradient (KX-8041)
Set of 4 gradient teal plastic water bottles in 3300ml, 1500ml, 700ml and 300ml sizes - Green-Cyan Gradient (KX-8041)
Set of four gradient pink and white matte sports water bottles in various sizes - White-Pink Gradient (KX-8041)
Sports Water Bottles Plastic Gradient Color Leakproof Large Capacity Motivational With Straw For Gym Outdoor Fitness Adult
-4%
$6.28
Mix MOQ : 2
 · 
15 views
Go to

More in home & kitchen

Explore more in steel bottles

steeldoubledisplaymagnetickidsstrapdiywidetitaniumgirls
304 stainless steel316 stainless steelnaturalstylebarplasticmetalpolishedshapenecklace stainless steel

Ready to source like an insider

Get a direct line to the factory floor — no minimums, no middlemen, no guesswork.
iconReal factory pricing, no markup in betweeniconEvery order hand-inspected before it shipsicon5,000+ new products added daily
Get Inside Access