Everful

Wholesale steel bottles

Factory-direct selection, vetted for quality and ready to order.

Sign Up
Steel Bottles

Find the perfect pieces: vacuum flasks & thermoses, tumblers, mugs and more

filterShow Filters
Best Seller
New Arrivals
Price Drop
Free Shipping
Cute Cartoon Baby Theme Square Pillowcase Peach Skin Decorative Cushion Cover For Nursery Living Room Bedding Home Decor
Cute Cartoon Baby Theme Square Pillowcase Peach Skin Decorative Cushion Cover For Nursery Living Room Bedding Home Decor
like
Find Similar
Cute white peach skin pillowcase with pink baby bear illustration and Baby Love text - Pink Cartoon Bear (Baby Love)
Cartoon baby bear peach skin pillowcase with Baby Love print on white background - Purple Cartoon Bear Rattle (Baby Love)
Square peach skin pillowcase with pink cartoon bird and Little Princess text on white base - Pink Cartoon Bird Flags (Little PRINCESS)
White peach skin pillowcase with cute cartoon bear and colorful star pattern - Brown Bear Stacking Toy (Hello!)
+14
Cute Cartoon Baby Theme Square Pillowcase Peach Skin Decorative Cushion Cover For Nursery Living Room Bedding Home Decor
-4%
$1.04
No MOQ
 · 
1 reviews
Watercolor Red Wine Linen Throw Pillow Cover Artistic Vineyard Grape Print Cushion Case For Sofa Home Decor
Watercolor Red Wine Linen Throw Pillow Cover Artistic Vineyard Grape Print Cushion Case For Sofa Home Decor
like
Find Similar
Linen wine bottle watercolor decorative pillow on a grey sofa for home decor - Three Colored Watercolor Bottles / 45x45cm(Cover Only)
Linen pillow cover featuring watercolor red wine bottle and grapes on a gray sofa - Wine Bottle Silhouette and Grapes / 45x45cm(Cover Only)
Linen pillow cover with vintage red wine and vineyard sketch on a gray sofa - Vintage Sketch Wine Theme / 45x45cm(Cover Only)
Macro shot of linen pillow case featuring artistic watercolor wine bottle print on sofa - Premium Wine Text Label / 45x45cm(Cover Only)
+3
Watercolor Red Wine Linen Throw Pillow Cover Artistic Vineyard Grape Print Cushion Case For Sofa Home Decor
$1.24
No MOQ
Halloween Throw Pillow Cover Linen Pumpkin Ghost Spider Web Decorative Cushion Case For Sofa Home Party Decor Haunted House Style
Halloween Throw Pillow Cover Linen Pumpkin Ghost Spider Web Decorative Cushion Case For Sofa Home Party Decor Haunted House Style
like
Find Similar
Detail of linen Halloween cushion with Trick or Treat slogan on a gray sofa - Orange Gold Slogan Black Style (1)
Halloween pumpkin linen cushion cover with Tales of Fright typography on grey sofa - Five Pumpkins Slogan Black Style (2)
Halloween linen pillowcase with Trick or Treat lettering on a grey fabric sofa - Witch Castle Orange Black White Style (3)
Detail of linen Halloween pillow cover with Let's GET spooky text and haunted castle design - Haunted Castle Ghost Illustration Style (4)
+12
Halloween Throw Pillow Cover Linen Pumpkin Ghost Spider Web Decorative Cushion Case For Sofa Home Party Decor Haunted House Style
$1.24
No MOQ
Independence Day Wooden Desktop Ornament Red White Blue Patriotic Table Decor July Fourth Statue Of Liberty Fireworks
Independence Day Wooden Desktop Ornament Red White Blue Patriotic Table Decor July Fourth Statue Of Liberty Fireworks
like
Find Similar
USA Independence Day wooden table decor with fireworks design and brown solid wood base - USA Style
Independence Day wooden desk decor with Statue of Liberty and star-spangled design - Five-pointed Star
Independence Day wooden table decor with Happy INDEPENDENCE DAY sign and patriotic star patterns - Bottle and Cake Style
4th of July wooden table sign featuring Uncle Sam hat and cupcake for home decor - Gift and Hat Style
+2
Independence Day Wooden Desktop Ornament Red White Blue Patriotic Table Decor July Fourth Statue Of Liberty Fireworks
-5%
$1.04
No MOQ
Cartoon Floral Cactus Jar Print Pillow Cover Peach Skin Velvet Decorative Cushion Case For Sofa Home Decor Nordic Style
Cartoon Floral Cactus Jar Print Pillow Cover Peach Skin Velvet Decorative Cushion Case For Sofa Home Decor Nordic Style
like
Find Similar
Floral peach skin pillowcase with hand-painted purple vase and blue flower pattern - Blue Vase Flower (1)
Square peach skin pillowcase with cartoon cactus and flower print on striped background - Yellow Stripe Cactus (2)
Peach skin pillowcase featuring a cartoon purple mason jar and green cactus design - Mason Jar and Cactus (3)
Purple peach skin pillowcase with cartoon glass jar and cactus print in modern style - Purple Base Cactus (4)
+13
Cartoon Floral Cactus Jar Print Pillow Cover Peach Skin Velvet Decorative Cushion Case For Sofa Home Decor Nordic Style
$1.09
No MOQ
Autumn Linen Throw Pillow Covers Farmhouse Decorative Cushion Case For Sofa Living Room Fall Harvest Home Decor
Autumn Linen Throw Pillow Covers Farmhouse Decorative Cushion Case For Sofa Living Room Fall Harvest Home Decor
like
Find Similar
Linen pillowcase with autumn watercolor pumpkin, orange, and cinnamon spice print - Pumpkin Citrus Style (YMF47-1)
Linen pillowcase with Home Sweet Home text and autumn fruit prints on white background - Home Sweet Home Style (YMF47-2)
Linen pillow cover with Happy Fall y'all text and autumn pine cone prints - Happy Fall y'all Style (YMF47-3)
Linen pillowcase with autumn botanical prints and berries for sofa decor - Harvest Bottle Floral Style (YMF47-4)
Autumn Linen Throw Pillow Covers Farmhouse Decorative Cushion Case For Sofa Living Room Fall Harvest Home Decor
-5%
$1.09
Mix MOQ : 2
Vintage Throw Pillow Covers Linen Decorative Pillowcases Mystic Moon Phase Moth Pattern For Sofa Home Decor Square
Vintage Throw Pillow Covers Linen Decorative Pillowcases Mystic Moon Phase Moth Pattern For Sofa Home Decor Square
like
Find Similar
Linen pillow cover with moth and moon child print in bohemian vintage style - Moth Moon Phase Style (YMW50-1)
Linen pillow cover with vintage hourglass design and BE HERE NOW print on white background - Vintage Hourglass Style (YMW50-2)
Linen Halloween pillow case with magic potion bottle print and You Are Made Of Magic text - Potion Bottle Style (YMW50-3)
Linen Halloween pillow cover with Mystic Moon and crystal ball astrological print - Astrology Crystal Ball Style (YMW50-4)
Vintage Throw Pillow Covers Linen Decorative Pillowcases Mystic Moon Phase Moth Pattern For Sofa Home Decor Square
$1.24
Mix MOQ : 2
Independence Day Linen Throw Pillow Cover 4th Of July American Flag Stars Stripes Truck Decorative Cushion Case Sofa Home Decor
Independence Day Linen Throw Pillow Cover 4th Of July American Flag Stars Stripes Truck Decorative Cushion Case Sofa Home Decor
like
Find Similar
Detail of linen pillow cover with floral wreath and God Bless America print - God Bless America Floral (23YM9-1)
Detail of linen pillowcase featuring a watercolor floral bouquet in a blue glass vase - Blue Glass Vase Floral (23YM9-2)
Close-up of linen pillowcase with blue bicycle, flowers and American flag elements - Blue Bicycle Patriotic Illustration (23YM9-3)
Linen Independence Day pillow cover featuring LAND That I Love floral print and stars - Land That I Love Floral (23YM9-4)
+26
Independence Day Linen Throw Pillow Cover 4th Of July American Flag Stars Stripes Truck Decorative Cushion Case Sofa Home Decor
$1.15
Mix MOQ : 2
Floral Peach Skin Polyester Cushion Cover Watercolor Flower Dog Animal Art Square Pillowcase French Vintage Decor
Floral Peach Skin Polyester Cushion Cover Watercolor Flower Dog Animal Art Square Pillowcase French Vintage Decor
like
Find Similar
Close-up of floral pillowcase with pink roses and iron basket print on fabric - Standard Square / Vintage Rose Basket Style ((1)DM219)
Close-up of pink watercolor flowers and Love One Another scripture text on pillowcase - Standard Square / Pink Flower Scripture Style ((2)DM219)
Floral watercolor throw pillow case featuring vintage books and pink roses print - Standard Square / Vintage Books and Rose Style ((3)DM219)
Floral watercolor throw pillow case featuring pink roses in a blue bottle with bow - Standard Square / Blue Bottle Pink Rose Style ((4)DM219)
+13
Floral Peach Skin Polyester Cushion Cover Watercolor Flower Dog Animal Art Square Pillowcase French Vintage Decor
$1.24
Mix MOQ : 3
Butterfly Moon Mystic Mushroom Hanging Tapestry Polyester Cotton Wall Art With Wood Pole And Tassels Astrology Decor
Butterfly Moon Mystic Mushroom Hanging Tapestry Polyester Cotton Wall Art With Wood Pole And Tassels Astrology Decor
like
Find Similar
Detail of moon and mushroom tapestry with wood rod and black tassels decoration - 35x50cm / Personified Crescent Moon Mushroom (Style-1)
Detail of artistic butterfly and moon tapestry with wooden rod and black tassel accents - 35x50cm / Double Butterfly Crescent Leaves (Style-2)
Detail of mystic sun and moon tapestry with wooden rod and black bottom tassels - 35x50cm / Star Moon Glass Sphere Plants (Style-3)
Detail of wooden hanging rod and black tassels on a celestial moon bottle tapestry - 35x50cm / Star Moon Potion Bottle (Style-4)
+1
Butterfly Moon Mystic Mushroom Hanging Tapestry Polyester Cotton Wall Art With Wood Pole And Tassels Astrology Decor
-4%
$2.71
Mix MOQ : 2
Christmas Tapestry Wall Hanging Polyester Peach Skin Digital Print Festive Snowflake Tree Pattern Home Decor With Nails And Clips
Christmas Tapestry Wall Hanging Polyester Peach Skin Digital Print Festive Snowflake Tree Pattern Home Decor With Nails And Clips
like
Find Similar
Christmas tree wall tapestry with fireplace and gift boxes in modern living room - 95x73cm (With Installation Kit) / Fireplace Christmas Tree (Style-1)
Christmas tree wall tapestry with Merry Christmas text on dark wood background - 95x73cm (With Installation Kit) / Wood Texture Christmas Tree (Style-2)
Close-up of Merry Christmas reindeer tapestry with gold glitter details in a cozy living room - 95x73cm (With Installation Kit) / Golden Reindeer Red Background (Style-3)
Festive Merry Christmas tapestry with green pine branches and colorful ornaments over a sofa - 95x73cm (With Installation Kit) / Pine Branches & Balls (Style-4)
+36
Christmas Tapestry Wall Hanging Polyester Peach Skin Digital Print Festive Snowflake Tree Pattern Home Decor With Nails And Clips
-4%
$2.33-6.30
Mix MOQ : 2
Halloween Tapestry Wall Hanging Polyester Cotton Scroll Painting Monster Mouth Pumpkin Print With Tassel And Wood Pole
Halloween Tapestry Wall Hanging Polyester Cotton Scroll Painting Monster Mouth Pumpkin Print With Tassel And Wood Pole
like
Find Similar
Vertical Halloween hanging flag with bloody monster mouth print and pumpkin lantern detail - 32.5x130cm / Monster Mouth Purple Tone (Style 1)
Halloween tapestry hanging scroll with creepy monster mouth design and black tassels - 32.5x130cm / Ghost Forest Teal Tone (Style 2)
Vertical Halloween wall scroll featuring a green monster mouth and pumpkin design with tassels - 32.5x130cm / Green Monster Mouth Potion Bottle (Style 3)
Halloween Tapestry Wall Hanging Polyester Cotton Scroll Painting Monster Mouth Pumpkin Print With Tassel And Wood Pole
$4.18
Mix MOQ : 2
Nordic Tropical Coconut Tree Sunset Landscape Wall Hanging Tapestry Polyester Brushed Background Cloth For Home Decor
Nordic Tropical Coconut Tree Sunset Landscape Wall Hanging Tapestry Polyester Brushed Background Cloth For Home Decor
like
Find Similar
Nordic coconut tree tapestry with tropical sunset beach landscape on a white brick wall - 95x73 / Sunset Beach (Style 1)
Nordic wall tapestry with tropical coconut palm, sea waves and beach house design - 95x73 / Island Hut (Style 2)
Nordic wall hanging tapestry featuring tropical beach scenery with coconut trees - 95x73 / Tropical Beach (Style 3)
Tropical sunset palm tree wall tapestry in rectangular shape for home decor - 95x73 / Sunset Palm (Style 4)
+48
Nordic Tropical Coconut Tree Sunset Landscape Wall Hanging Tapestry Polyester Brushed Background Cloth For Home Decor
-4%
$2.33-6.30
Mix MOQ : 2
Pillow Case Cushion Cover Blue Hydrangea Floral Letter Print Linen Texture Decorative Home Sofa
Pillow Case Cushion Cover Blue Hydrangea Floral Letter Print Linen Texture Decorative Home Sofa
like
Find Similar
Linen cushion cover with blue hydrangea floral print on cream background for sofa - Blue Hydrangea Full Print (JYM730-1)
Linen texture square pillowcase in light blue with white Flowers fresh print design - Blue Background FLOWERS Print (JYM730-2)
Blue linen hydrangea pillow cover with BLOOM with grace print for sofa decor - Light Blue BLOOM Print (JYM730-3)
Linen cushion cover with blue hydrangea in glass vase on white background - Watercolor Hydrangea In Bottle (JYM730-4)
Pillow Case Cushion Cover Blue Hydrangea Floral Letter Print Linen Texture Decorative Home Sofa
$1.15
No MOQ
Halloween Toilet Sticker PVC Waterproof Gothic Skull Ghost Black Cat Decal Bathroom Decorative Festive Atmosphere Accessory
Halloween Toilet Sticker PVC Waterproof Gothic Skull Ghost Black Cat Decal Bathroom Decorative Festive Atmosphere Accessory
like
Find Similar
Halloween toilet sticker with black cat and orange roses, waterproof PVC 27x28cm decal - Black Cat and Rose (WSJ33001)
Halloween toilet sticker with bird and orange rose design measuring 27.63x27.72cm - Bird and Rose (WSJ33002)
Halloween toilet lid sticker with gothic skull and orange rose design for bathroom decor - Skull and Orange Rose (WSJ33003)
Gothic Halloween toilet sticker featuring skull, orange roses, and pumpkin motifs - Gothic Skull and Bottle (WSJ33004)
+3
Halloween Toilet Sticker PVC Waterproof Gothic Skull Ghost Black Cat Decal Bathroom Decorative Festive Atmosphere Accessory
-4%
$0.77
No MOQ
Cute Cartoon Black Cat Enamel Pin Alloy Brooch Glass Jar Plant Mushroom Skull Badge Kawaii Jewelry For Backpack Clothing
Cute Cartoon Black Cat Enamel Pin Alloy Brooch Glass Jar Plant Mushroom Skull Badge Kawaii Jewelry For Backpack Clothing
like
Find Similar
Cartoon enamel pin featuring a black cat in a bottle with green leaves and pink plant - Cat in Jar with Monstera / Colorful
Cartoon light bulb enamel pin with black cats and mushrooms, alloy drip oil brooch badge - Cat in Light Bulb with Mushroom / Colorful
Cartoon enamel pin featuring a black cat in a glass bottle with pink flowers and green leaves - Cat in Round Bottle with Flower / Colorful
Enamel pin featuring a black cat, skull, and tropical plants in a bottle shape - Cat in Flask with Skull / Colorful
Cute Cartoon Black Cat Enamel Pin Alloy Brooch Glass Jar Plant Mushroom Skull Badge Kawaii Jewelry For Backpack Clothing
-9%
$0.47
No MOQ
 · 
62 sold recently
Free Shipping
DIY Diamond Painting Keychain Kit Halloween Theme Acrylic Rhinestone Suncatcher Wind Chime Pendant Gnomes Pumpkins Ghosts Handmade Craft Gift
DIY Diamond Painting Keychain Kit Halloween Theme Acrylic Rhinestone Suncatcher Wind Chime Pendant Gnomes Pumpkins Ghosts Handmade Craft Gift
like
Find Similar
DIY Halloween pumpkin diamond keychain set with orange crystal wind chime charms - Demon Pumpkin Style
DIY Halloween keychain set with diamond painted Highland cow pendants and colorful beads - Halloween Highland Cow Style
5D DIY Halloween diamond painting kit featuring 3 white ghost keychains with colorful beads - White Ghost Style
DIY Halloween diamond painting keychain set with pumpkin, skull and bat pendants - Skull Bat Style
+25
DIY Diamond Painting Keychain Kit Halloween Theme Acrylic Rhinestone Suncatcher Wind Chime Pendant Gnomes Pumpkins Ghosts Handmade Craft Gift
$1.44
Mix MOQ : 50
 · 
14 views
DIY Diamond Painting Acrylic Ornament With Resin Rhinestones Desktop Decoration Handmade Craft Home Decor Sparkling
DIY Diamond Painting Acrylic Ornament With Resin Rhinestones Desktop Decoration Handmade Craft Home Decor Sparkling
like
Find Similar
DIY colorful spring birds and flower acrylic diamond painting stand with tool kit - Perfume Bottle
DIY 5D diamond painting kit featuring a lotus acrylic stand with vibrant colorful rhinestones - Lotus
DIY 5D diamond painting acrylic stand set featuring a purple butterfly and moon design - Moon Butterfly
DIY 5D diamond painting kit featuring a peacock acrylic stand and colorful rhinestone gems - Peacock
+7
DIY Diamond Painting Acrylic Ornament With Resin Rhinestones Desktop Decoration Handmade Craft Home Decor Sparkling
$5.76
Mix MOQ : 50
Rotating Photo Frame Double Sided Wooden Desktop Ornament With Mini Decorative Lamp And Resin Figurine Home Decor
Rotating Photo Frame Double Sided Wooden Desktop Ornament With Mini Decorative Lamp And Resin Figurine Home Decor
like
Find Similar
Modern 6-inch rotating wooden photo frame with cactus art and leaf-shaped LED night light - Green Shadow Double Sided - Light Coffee With Light
Modern 6-inch rotating wooden picture frame in natural wood finish with miniature figurines - Double Sided Vertical - Couple Style
Rotating wood photo frame with cartoon figures and hanging bulb ornament for 4x6 photos - Double Sided Vertical - Lovers Style
Rotating wood photo frame with 6-inch insert, night light, and cute rabbit figurine - Double Sided Vertical - Little Rabbit
+11
Rotating Photo Frame Double Sided Wooden Desktop Ornament With Mini Decorative Lamp And Resin Figurine Home Decor
-5%
$4.52-5.15
Mix MOQ : 2
Cartoon Creative 3D Earphone Cases Soft Silicone Protective Covers Shockproof Novelty Design For Wireless Earbuds
Cartoon Creative 3D Earphone Cases Soft Silicone Protective Covers Shockproof Novelty Design For Wireless Earbuds
like
Find Similar
3D cartoon dinosaur silicone case for AirPods in bean green with yellow fins - Cute Green Dragon + Carabiner / Airpods 3rd Gen
Silicone case for AirPods Pro in Nintendo Switch handheld game console style design - Game Console + Carabiner / AirPods Pro
Silicone AirPods case featuring Snorlax Pokemon character with matching finger ring strap - Snorlax + Ring / AirPods 1/2 Gen
Soot Sprite black silicone case for AirPods with large eyes and metallic carabiner - Coal Briquettes + Carabiners / AirPods 1/2 Gen
+388
Cartoon Creative 3D Earphone Cases Soft Silicone Protective Covers Shockproof Novelty Design For Wireless Earbuds
$0.46-1.21
No MOQ
 · 
27 sold recently
Humorous Enamel Pins Alloy Brooch Cartoon Badges For Clothes Backpacks Creative Laundry Detergent Spray Can Fries Gift
Humorous Enamel Pins Alloy Brooch Cartoon Badges For Clothes Backpacks Creative Laundry Detergent Spray Can Fries Gift
like
Find Similar
Funny enamel pin featuring a Bullshit REMOVER detergent bottle design in blue and pink - Bullshit REMOVER Laundry Detergent
Cartoon spray bottle enamel pin in sky blue and pink with repellent text design - Fuokboi REPELLENT Spray Bottle
French fries box enamel brooch with Fries Before Guys slogan and yellow details - FRIES BEFORE GUYS French Fries
Creative spray can enamel pin featuring Bitch Spray artistic text with colorful design - BITCH SPRAY Paint Can
+1
Humorous Enamel Pins Alloy Brooch Cartoon Badges For Clothes Backpacks Creative Laundry Detergent Spray Can Fries Gift
-10%
$0.42
No MOQ
 · 
47 sold recently
Nordic Morandi Ceramic Vase Matte Frosted Abstract Geometric Shape Modern Minimalist Home Office Desktop Ornament
Nordic Morandi Ceramic Vase Matte Frosted Abstract Geometric Shape Modern Minimalist Home Office Desktop Ornament
like
Find Similar
Nordic ceramic vase HP698-BG in beige with handcrafted texture and double handles - HP698-BG Beige / Beige
Morandi light green ceramic vase with a matte finish, sized 13.5cm by 22.5cm - HP699-YG Yellow Green Long Neck Bottle / Yellow-Green
Abstract ceramic vase in matte beige pink with 21cm height and artistic curved design - HP700-KHK Khaki 8-Shape / Khaki
Modern matte grey ceramic wall-mounted vase with organic shape 15cm x 20.5cm - HP701-GYGN Gray Green Slanted Mouth / Grey Green
+1
Nordic Morandi Ceramic Vase Matte Frosted Abstract Geometric Shape Modern Minimalist Home Office Desktop Ornament
$8.36-19.02
Mix MOQ : 2
 · 
13 views
Mini Vase Incense Holder Zinc Alloy Copper Plated Miniature Desktop Ornament Gourd Shape Vintage Chinese Style Decor
Mini Vase Incense Holder Zinc Alloy Copper Plated Miniature Desktop Ornament Gourd Shape Vintage Chinese Style Decor
like
Find Similar
Macro shot of a golden brass gourd incense holder showing 17.2g weight on a scale - Bottle A / Gourd Shape
Bottle B / Round Belly Shape
Miniature gold Ruyi vase incense holder weighing 18.0g on a digital scale - Bottle C / Long Neck Shape
Miniature gold Ruyi vase incense holder made of copper, 17.9g desktop ornament - Bottle D / Pure Water Bottle Shape
Mini Vase Incense Holder Zinc Alloy Copper Plated Miniature Desktop Ornament Gourd Shape Vintage Chinese Style Decor
$0.39
No MOQ
 · 
22 views
Miniature Christmas Decorations Dollhouse Accessories Wood Resin Plastic Ornaments DIY Micro Landscape Snow Scene Festive Decor
Miniature Christmas Decorations Dollhouse Accessories Wood Resin Plastic Ornaments DIY Micro Landscape Snow Scene Festive Decor
like
Find Similar
Miniature white artificial snow powder in PE bag, 13g pack for DIY Christmas decor - No.1 - 13g White Artificial Snow Powder Bag
Miniature white wooden snowflake ornament 3cm for DIY Christmas dollhouse decor - No.3 - 3cm Wooden Snowflake Ornament
Miniature white wooden snowflake ornament for Christmas DIY crafts and 3cm snow decor - No.4 - 3cm Thick Wooden Snowflake
Miniature resin snowflake ornament with glitter finish for DIY Christmas tree decor - No.5 - 2.8cm Resin Glitter Snowflake
+100
Miniature Christmas Decorations Dollhouse Accessories Wood Resin Plastic Ornaments DIY Micro Landscape Snow Scene Festive Decor
-91%
$0.05-2.08
No MOQ
 · 
340 sold recently
Artificial Snow Powder For Flower Bouquet Decoration DIY Christmas Spray Frost Effect Realistic PE Material Winter Party
Artificial Snow Powder For Flower Bouquet Decoration DIY Christmas Spray Frost Effect Realistic PE Material Winter Party
like
Find Similar
DIY Christmas red roses decorated with fine and coarse artificial snow powder effects - Coarse Snow Spray 4 Bottles 280ml
Fine white PE artificial snow powder for professional Christmas DIY decor and displays - Fine White Snow 100g
Artificial ice crush heavy snow powder for Christmas DIY strawberry rose decoration - Coarse White Snow 100g
Pink roses and orchids with pearls in pink matte wrapping paper for DIY decoration - Matte Flamingo Pink 450ml
+18
Artificial Snow Powder For Flower Bouquet Decoration DIY Christmas Spray Frost Effect Realistic PE Material Winter Party
$0.81-8.36
Mix MOQ : 2
Artificial Snow Powder Spray Glitter Sequins For DIY Christmas Rose Flower Decoration Ice Frost Effect Plastic Materials
Artificial Snow Powder Spray Glitter Sequins For DIY Christmas Rose Flower Decoration Ice Frost Effect Plastic Materials
like
Find Similar
DIY Christmas red roses decorated with fine and coarse artificial snow powder effects - Snow Spray Coarse Snow/4 Bottles 280ml
Fine white PE artificial snow powder for professional Christmas DIY decor and displays - Fine Snow White/100g
Artificial ice crush heavy snow powder for Christmas DIY strawberry rose decoration - Coarse Snow White/100g
Pink roses and orchids with pearls in pink matte wrapping paper for DIY decoration - Matte Flamingo Pink/450ml
+18
Artificial Snow Powder Spray Glitter Sequins For DIY Christmas Rose Flower Decoration Ice Frost Effect Plastic Materials
$0.81-8.36
Mix MOQ : 2
 · 
14 views
Christmas Tree LED Night Light Ceramic Frosted Glowing Tabletop Ornament Battery Operated Festive Home Decor Gift
Christmas Tree LED Night Light Ceramic Frosted Glowing Tabletop Ornament Battery Operated Festive Home Decor Gift
like
Find Similar
Conical black reindeer Christmas lamp with warm LED light and snowflake cutout patterns - Cone / Black
Dark green frosted Christmas LED candle with tree cutouts and warm glowing light effect - Short Candle Shape / Green
Black LED Christmas candle with reindeer cutout and warm glow on snowy background - Short Candle Shape / Black
Red Christmas LED candle lamp with hollow tree pattern and festive bokeh effect - Short Candle Shape / Red
+15
Christmas Tree LED Night Light Ceramic Frosted Glowing Tabletop Ornament Battery Operated Festive Home Decor Gift
$2.88-7.20
No MOQ
 · 
18 sold recently
Miniature Christmas Dollhouse Accessories Resin Plastic Candy Jar Gingerbread Man Snowman DIY Scene Decor Festive Figurines
Miniature Christmas Dollhouse Accessories Resin Plastic Candy Jar Gingerbread Man Snowman DIY Scene Decor Festive Figurines
like
Find Similar
Miniature resin gingerbread man charms for dollhouse decor and DIY crafts, 1.5cm size - Mini Gingerbread Man Set (2 Pcs)
Miniature resin gingerbread man figures with red Santa hats for Christmas dollhouse decor - Standing and Lying Gingerbread Man with Hat Set (2 Pcs)
Miniature Christmas resin figurine set featuring a vintage brown train and a tiny deer - Christmas Train and Reindeer Set (2 Pcs)
Miniature Christmas resin wreath and golden bell set for DIY dollhouse decoration - Wreath and Bells Set (2 Pcs)
+7
Miniature Christmas Dollhouse Accessories Resin Plastic Candy Jar Gingerbread Man Snowman DIY Scene Decor Festive Figurines
-5%
$0.33-8.19
Mix MOQ : 2
 · 
60 sold recently
Free Shipping
Mini Christmas Hat Red White Velvet Fabric Cutlery Holder Lollipop Decoration Holiday Table Accessory Ornament
Mini Christmas Hat Red White Velvet Fabric Cutlery Holder Lollipop Decoration Holiday Table Accessory Ornament
like
Find Similar
Close-up of mini red and white plush Christmas hat for wine bottles and cutlery decor - 4*7cm (Lollipop Hat)
Close-up of a red and white mini plush Christmas hat on a green festive background - 6*12cm (Wine Bottle Hat/Cutlery Set)
Mini Christmas Hat Red White Velvet Fabric Cutlery Holder Lollipop Decoration Holiday Table Accessory Ornament
$0.07-0.10
Mix MOQ : 2
Vintage Christmas LED Lantern Retro Antique Bronze Night Light With Santa Snowman Reindeer For Holiday Home Tabletop Decor
Vintage Christmas LED Lantern Retro Antique Bronze Night Light With Santa Snowman Reindeer For Holiday Home Tabletop Decor
like
Find Similar
Vintage bronze Christmas lantern with a snowman figurine and warm white LED lights - Bronze Bottle Snowman
Bronze Christmas lantern with LED deer scene and warm lights for festive decor - Bronze Bottle Reindeer
Vintage bronze Christmas lantern with LED Santa scene and warm glowing lights - Bronze Bottle Christmas Tree Child
Vintage Christmas LED Lantern Retro Antique Bronze Night Light With Santa Snowman Reindeer For Holiday Home Tabletop Decor
$3.03
Mix MOQ : 2
Artificial Snow Spray Christmas Decoration Instant Foam For Flower Tree Window Winter Holiday Party Prop Novelty
Artificial Snow Spray Christmas Decoration Instant Foam For Flower Tree Window Winter Holiday Party Prop Novelty
like
Find Similar
Artificial snow spray for Christmas roses and flower bouquets in 250ml canister - Coarse Snow 6 Bottles 250ml/Bottle
Artificial fine snow spray 280ml for Christmas roses with white flake texture - Fine Snow 6 Bottles 280ml/Bottle
Christmas snow spray set with artificial red roses and decorative aerosol cans for holiday scene - 3 Coarse + 3 Fine Snow Bottles
Artificial Snow Spray Christmas Decoration Instant Foam For Flower Tree Window Winter Holiday Party Prop Novelty
$5.48
No MOQ
Artificial Snow Spray Christmas Decoration Floral Frost Effect Aerosol White Paint For Flowers Trees Party Supplies
Artificial Snow Spray Christmas Decoration Floral Frost Effect Aerosol White Paint For Flowers Trees Party Supplies
like
Find Similar
Christmas bouquet snow spray on red roses showing fine and coarse snow effects - Set of 4 Bottles / White Coarse and Fine Snow Mix Set
Red rose bouquet with realistic artificial snow spray texture for Christmas floral decor - Set of 4 Bottles / White Coarse Snow
Dark red spray painted roses for bouquets with a frosted snow effect finish - Set of 4 Bottles / White Fine Snow
Artificial Snow Spray Christmas Decoration Floral Frost Effect Aerosol White Paint For Flowers Trees Party Supplies
$5.19
No MOQ
 · 
15 views
Christmas Tree Hanging Ornaments Painted Glass Creative Food Fruit Vegetable Pendants Holiday Festive Party Decoration Novelty
Christmas Tree Hanging Ornaments Painted Glass Creative Food Fruit Vegetable Pendants Holiday Festive Party Decoration Novelty
like
Find Similar
Yellow lemon glass slice Christmas ornament with glitter finish and 7cm dimensions - Half-cut Lemon
Glittery pomegranate glass ornament in red orange gradient for Christmas tree decoration - Pomegranate
Glass strawberry Christmas ornament with 8x9cm size markers on white background - Strawberry
Watermelon shaped painted glass Christmas ornament with glitter finish and gold string - Watermelon Slice
+10
Christmas Tree Hanging Ornaments Painted Glass Creative Food Fruit Vegetable Pendants Holiday Festive Party Decoration Novelty
$5.71-19.83
Mix MOQ : 2
 · 
11 views
Free Shipping
Christmas Table Runner Polyester Jacquard Weaving Reindeer Snowman Pattern With Tassels Holiday Dining Decoration
Christmas Table Runner Polyester Jacquard Weaving Reindeer Snowman Pattern With Tassels Holiday Dining Decoration
like
Find Similar
Green Christmas table runner with snowman pattern and festive tassels in woven fabric - Green Box With Green Tassels (do Not Machine Wash) / 35x300cm
Green Christmas table runner with floral jacquard patterns and elegant hanging tassels - Green Plants + Green Tassels (do Not Machine Wash) / 35x300cm
Dark green Christmas table runner with jacquard snowman tree motifs and elegant tassels - Dark Green Christmas Tree With Green Tassels (do Not Machine Wash) / 35x300cm
Christmas table runner with green tassels, featuring festive tree and star patterns - Light Green Christmas Tree With Green Tassels (do Not Machine Wash) / 35x300cm
+316
Christmas Table Runner Polyester Jacquard Weaving Reindeer Snowman Pattern With Tassels Holiday Dining Decoration
$6.92-14.41
No MOQ
Christmas Glass Dome Ornament With LED Light Luminous Wood Base Hanging Pendant Night Light Desktop Festive Decor
Christmas Glass Dome Ornament With LED Light Luminous Wood Base Hanging Pendant Night Light Desktop Festive Decor
like
Find Similar
Luminous glass Christmas ornament with Santa and tree inside on wood base, 10cm height - Red Pillar Santa Front
Nordic Christmas glass dome lamp with Santa and LED light on a wooden base - Red Pillar Santa Side
Luminous glass Christmas ornament with wooden reindeer scenery and LED warm light inside - Blue Pillar Reindeer
Nordic glass snowman night light with LED tree and artificial snow decoration - Blue Pillar Snowman
+4
Christmas Glass Dome Ornament With LED Light Luminous Wood Base Hanging Pendant Night Light Desktop Festive Decor
-5%
$4.05-7.88
Mix MOQ : 2
Mini Paper Gift Boxes Candy Packaging Gold Stamping Ribbon Merci Pattern For Wedding Christmas Party Supplies
Mini Paper Gift Boxes Candy Packaging Gold Stamping Ribbon Merci Pattern For Wedding Christmas Party Supplies
like
Find Similar
Elegant black Christmas candy box with golden reindeer illustrations and glittery ribbon - Black Reindeer with Gold Ribbon
White Christmas gift box with polar bear illustration and golden glitter mesh ribbon - White Gift Bear with Gold Ribbon
White trapezoid gift box with gold star moon jar pattern and Merci gold ribbon - White Wishing Bottle with Gold Ribbon
Mini Paper Gift Boxes Candy Packaging Gold Stamping Ribbon Merci Pattern For Wedding Christmas Party Supplies
$0.17
Mix MOQ : 20
LED Light Up Christmas Hat Plush Santa Hats For Holiday Party Decoration Colorful Glow Adults Kids Soft Plush
LED Light Up Christmas Hat Plush Santa Hats For Holiday Party Decoration Colorful Glow Adults Kids Soft Plush
like
Find Similar
Classic red and white plush Christmas hat with LED lights for festive holiday party decor - Adult Single-Layer Plush
Red plush Christmas hat with warm glowing LED lights and soft white faux fur trim - Glowing Adult Style / Adult Warm White
Classic red plush Christmas hat with colorful LED lights and white fluffy trim - Glowing Adult Style / Adult Colorful Lights
Classic red plush Christmas hat with white LED lights for festive holiday party decor - Adult Double-Layer Plush
+13
LED Light Up Christmas Hat Plush Santa Hats For Holiday Party Decoration Colorful Glow Adults Kids Soft Plush
-4%
$0.36-3.71
No MOQ
 · 
12 views
Glowing LED Christmas Hat Long Plush Knit Santa Hats Festive Party Decor Costume Headwear For Adults And Children
Glowing LED Christmas Hat Long Plush Knit Santa Hats Festive Party Decor Costume Headwear For Adults And Children
like
Find Similar
Classic red plush Christmas hat with white LED lights for festive holiday party decor - Baby Double Layer Fleece / Red
Red plush Christmas hat with warm glowing LED lights and soft white faux fur trim - Adult Warm White Light / Red
Classic red plush Christmas hat with colorful LED lights and white fluffy trim - Adult Colorful Light / Red
Red and white knitted Christmas hat with LED lights and a white fuzzy pom-pom top - Knitted Style - Adult / Red
+32
Glowing LED Christmas Hat Long Plush Knit Santa Hats Festive Party Decor Costume Headwear For Adults And Children
-8%
$0.11-3.97
No MOQ
 · 
80 views
Christmas Tree Hanging Ornaments Rose Gold Plastic Glitter Festive Holiday Party Decor Trains Nutcracker Candy Shapes
Christmas Tree Hanging Ornaments Rose Gold Plastic Glitter Festive Holiday Party Decor Trains Nutcracker Candy Shapes
like
Find Similar
Champagne rose gold gift box Christmas tree ornaments in a 2-piece set with glitter finish - Gift Box Style/2 Pcs
Champagne gold acorn Christmas ornaments set of 2 in clear box with snowflake detail - Pine Cone Style/2 Pcs
Champagne gold Christmas bell ornaments in rose gold glossy and matte glitter finish - Bell Style/2 Pcs
Champagne gold candy cane Christmas ornaments with rose gold stripes and size details - Candy Cane Style/4 Pcs
+13
Christmas Tree Hanging Ornaments Rose Gold Plastic Glitter Festive Holiday Party Decor Trains Nutcracker Candy Shapes
-5%
$1.37-3.42
No MOQ
 · 
10 views
Embroidery Patches Food Drink Cupcake Sushi Cocktail Ice Cream DIY Sew Iron On Applique For Clothes Bags
Embroidery Patches Food Drink Cupcake Sushi Cocktail Ice Cream DIY Sew Iron On Applique For Clothes Bags
like
Find Similar
Cupcake embroidered patch for clothing DIY decoration with 5.5cm height and precise stitching - Cupcake
Embroidered drink patch with straw and heart-eye smiley face for DIY clothing decor - Smiling Milkshake
White jar embroidery patch with Feelings text and pink cap for DIY clothing decoration - Feelings Pink Bottle
Pink milkshake embroidery patch for DIY clothing decor, size 2.9cm by 6.6cm - Tri-color Milkshake
+12
Embroidery Patches Food Drink Cupcake Sushi Cocktail Ice Cream DIY Sew Iron On Applique For Clothes Bags
$0.09-2.31
Mix MOQ : 10
 · 
187 sold recently
Free Shipping
Happy New Year Hanging Door Sign Glitter Paper Cardboard Ornament For Party Celebration Atmosphere Decoration
Happy New Year Hanging Door Sign Glitter Paper Cardboard Ornament For Party Celebration Atmosphere Decoration
like
Find Similar
Golden glitter Happy New Year clock hanging ornament with black ribbon and white dial - Clock Style
Festive black truck Happy New Year hanging ornament with gold glitter and champagne details - Car Style
New Year party door hanger featuring a black top hat design with Happy New Year text - Hat Style
Golden and green Happy New Year party hanging decoration on a clean white background - Wine Bottle Style
Happy New Year Hanging Door Sign Glitter Paper Cardboard Ornament For Party Celebration Atmosphere Decoration
-5%
$0.52
Mix MOQ : 5
Toilet Paper Holder With Storage Shelf Wall Mounted Space Aluminum Punch Free Waterproof Bathroom Roll Rack Modern
Toilet Paper Holder With Storage Shelf Wall Mounted Space Aluminum Punch Free Waterproof Bathroom Roll Rack Modern
like
Find Similar
Gunmetal gray wall-mounted toilet paper holder with top shelf made of space aluminum - Space Aluminum / Gun Grey Bordered Double Layer
Matte black wall-mounted toilet paper holder with storage shelf in premium space aluminum - Space Aluminum / Elegant Black Bordered Double Layer
Space aluminum silver wall-mounted toilet paper holder with phone storage shelf - Space Aluminum / Elegant Silver Bordered Double Layer
Gunmetal wall mount toilet paper holder with top shelf and matte metal finish - Space Aluminum / Gun Grey Extra Large Bordered With Lid
+2
Toilet Paper Holder With Storage Shelf Wall Mounted Space Aluminum Punch Free Waterproof Bathroom Roll Rack Modern
-5%
$4.38-7.67
No MOQ
 · 
10 views
Cute Cartoon Cow Embroidery Patches Polyester Fabric DIY Sewing Appliques For Clothes Bags Decoration Animal Motif
Cute Cartoon Cow Embroidery Patches Polyester Fabric DIY Sewing Appliques For Clothes Bags Decoration Animal Motif
like
Find Similar
Daisy embroidery patch double-sided adhesive sheets CROWN #513L size 10x20cm - Embroidery Auxiliary Strong Adhesive Sheet
Cute cartoon cow embroidery patches in black and white for clothing and bag decoration - Set of 25Pcs
Variety set of cartoon cow embroidered patches in black and white for DIY clothing - Cute Cow Embroidery Assorted Set
Detailed view of cartoon cow embroidery patch showing 6.7x6cm dimensions and texture - Large Black and White Spotted Cow (No. 1)
+24
Cute Cartoon Cow Embroidery Patches Polyester Fabric DIY Sewing Appliques For Clothes Bags Decoration Animal Motif
$0.22-7.19
No MOQ
 · 
1 reviews
Free Shipping
Miniature Food Fridge Magnets Resin Simulation Bread Wine Breakfast 3D Small Models DIY Home Decor Accessories Novelty
Miniature Food Fridge Magnets Resin Simulation Bread Wine Breakfast 3D Small Models DIY Home Decor Accessories Novelty
like
Find Similar
Resin breakfast toast and bread fridge magnets set on a blue tray with pink background - Toast / No Magnet
Miniature white resin coffee cup and saucer set with blue trim and golden spoon - Espresso Coffee / No Magnet
Detailed close-up of a resin food magnet featuring a mini cutting board and bread decoration - Tray Bread / No Magnet
Top view of realistic miniature resin bread basket magnet with croissant and baguette - Bread Basket / No Magnet
+8
Miniature Food Fridge Magnets Resin Simulation Bread Wine Breakfast 3D Small Models DIY Home Decor Accessories Novelty
$0.52-0.69
No MOQ
 · 
15 views
Cartoon Medical Polyester Embroidery Patches Nurse Theme Organ Heart Brain Iron On Sewing Badges For Clothing Backpacks Decoration DIY
Cartoon Medical Polyester Embroidery Patches Nurse Theme Organ Heart Brain Iron On Sewing Badges For Clothing Backpacks Decoration DIY
like
Find Similar
Daisy embroidery patch double-sided adhesive sheets CROWN #513L size 10x20cm - Strong Adhesive Film (XT305-Film)
Cute medical themed cartoon embroidery patches set with nurse and organ icons - Full Medical Embroidery Patch Collection (XT305-Full Set)
Detailed embroidery patch of cartoon pink intestines showing 6cm x 6cm dimensions - Intestinal Shape (No. 1)
Detailed view of a thermometer shaped embroidery patch with size dimensions 5.5cm x 1.5cm - Thermometer Shape (No. 2)
+42
Cartoon Medical Polyester Embroidery Patches Nurse Theme Organ Heart Brain Iron On Sewing Badges For Clothing Backpacks Decoration DIY
$0.16-11.89
No MOQ
 · 
62 sold recently
Free Shipping
Western Cowgirl Embroidered Patches Iron On Sew On Decorative Badges For Clothes Bags DIY Appliques
Western Cowgirl Embroidered Patches Iron On Sew On Decorative Badges For Clothes Bags DIY Appliques
like
Find Similar
Detail view of red and pink U-shaped embroidery patch with 5.8cm size measurements - 1# Horseshoe
Detailed view of red panty-shaped embroidery patch with precise size dimensions - 2# Briefs
Detail showing pink lip embroidery patch with dimensions 6.6cm x 3.3cm on white background - 3# Lips
Detail view of hexagram embroidered patch with dimensions 6.7cm x 6cm for DIY apparel - 4# Hexagram
+9
Western Cowgirl Embroidered Patches Iron On Sew On Decorative Badges For Clothes Bags DIY Appliques
$0.17-3.00
No MOQ
 · 
36 sold recently
Free Shipping
Wall Mounted Bathroom Tissue Box Space Aluminum No Drill Toilet Paper Holder Rustproof Shelf For Washroom Gun Grey Modern Minimalist
Wall Mounted Bathroom Tissue Box Space Aluminum No Drill Toilet Paper Holder Rustproof Shelf For Washroom Gun Grey Modern Minimalist
like
Find Similar
Dark grey carbon steel wall-mounted storage rack with open wire design and adhesive - Ordinary-Carbon Steel-Rectangular / Gunmetal
Space aluminum wall-mounted rectangular storage basket in matte grey for bathroom tissue - Upgrade-Space Aluminum-Rectangular / Gunmetal
Gunmetal grey wall-mounted tissue holder made of space aluminum with no-drill adhesive - Upgrade-Space Aluminum-Square / Gunmetal
Wall Mounted Bathroom Tissue Box Space Aluminum No Drill Toilet Paper Holder Rustproof Shelf For Washroom Gun Grey Modern Minimalist
-5%
$3.83-5.20
No MOQ
Yellow Cartoon Embroidered Patches Polyester Fabric Iron On Appliques For Clothing Backpacks DIY Decoration Cute Shapes
Yellow Cartoon Embroidered Patches Polyester Fabric Iron On Appliques For Clothing Backpacks DIY Decoration Cute Shapes
like
Find Similar
Daisy embroidery patch double-sided adhesive sheets CROWN #513L size 10x20cm - One Sheet Strong Adhesive 20*10CM
Detailed embroidery patch of a lemon drink cup with dimensions of 6cm by 5cm in vivid colors - Lemon Cold Drink Style (X15SD-095-07)
Close-up of yellow duck embroidery patch showing 5.5cm dimensions on white background - Yellow Duck Style (X15SD-095-22)
Detail view of yellow crown embroidered patch with precise 5.5cm width measurement - Crown Style (X15SD-078-23)
+18
Yellow Cartoon Embroidered Patches Polyester Fabric Iron On Appliques For Clothing Backpacks DIY Decoration Cute Shapes
$0.16-5.61
No MOQ
 · 
182 sold recently
Free Shipping
Medical Theme Embroidery Patches Iron On Applique Cartoon Decorative Medical Symbols For Clothes Bags Nurse Ambulance Style
Medical Theme Embroidery Patches Iron On Applique Cartoon Decorative Medical Symbols For Clothes Bags Nurse Ambulance Style
like
Find Similar
Daisy embroidery patch double-sided adhesive sheets CROWN #513L size 10x20cm - One Sheet Strong Adhesive 20*10CM
23pcs medical themed embroidered patches set with ambulance and nurse icons for clothing - Medical Rescue Theme Full Set
Detailed view of 8-piece medical embroidery patches including ambulance and nurse designs - Red
8-piece medical nursing theme embroidery patches kit featuring blue first aid icons - Medical Rescue Theme Set / Blue
+25
Medical Theme Embroidery Patches Iron On Applique Cartoon Decorative Medical Symbols For Clothes Bags Nurse Ambulance Style
$0.20-6.80
No MOQ
 · 
10 sold recently
Free Shipping
Cartoon Black Cat Enamel Brooch Alloy Pin Coffee Wine Cup Novelty Fashion Badge For Clothes Bag Jacket
Cartoon Black Cat Enamel Brooch Alloy Pin Coffee Wine Cup Novelty Fashion Badge For Clothes Bag Jacket
like
Find Similar
Cartoon black cat enamel pin with wine glass and bottle halloween accessory - Black Cat With Wine Bottle
Cartoon black cat in a white coffee cup enamel pin with cute paw prints for backpacks - Black Cat In Coffee Cup
Cute black cat enamel pin with white wine bottle and glass design on white background - Black Cat Carrying Wine Set
Cartoon enamel pin featuring a cute black cat hidden inside a white straw cup - Black Cat In Straw Cup
Cartoon Black Cat Enamel Brooch Alloy Pin Coffee Wine Cup Novelty Fashion Badge For Clothes Bag Jacket
-9%
$0.39
No MOQ
Free Shipping
Mystic Gothic Embroidery Patches Crystal Moon Cat Eye Iron On Sew On Embroidered Appliques For Clothing Bag DIY Decor
Mystic Gothic Embroidery Patches Crystal Moon Cat Eye Iron On Sew On Embroidered Appliques For Clothing Bag DIY Decor
like
Find Similar
Daisy embroidery patch double-sided adhesive sheets CROWN #513L size 10x20cm - Strong Adhesive Sheet (20x10cm)
Mystical crystal and evil eye embroidered patches in a colorful 10-piece set collection - Full Set of 10 Pieces (C31GS-179-YT)
Detailed view of evil eye embroidery patch with dimensions 8x9cm on white background - Mystic Eye (C31GS-28-01)
Detail view of moon and hand embroidery patch showing 8.5cm x 5.5cm size dimensions - Moon Phase Hand (C31GS-2-02)
+8
Mystic Gothic Embroidery Patches Crystal Moon Cat Eye Iron On Sew On Embroidered Appliques For Clothing Bag DIY Decor
$0.35-5.16
No MOQ
 · 
33 sold recently
Free Shipping
Cartoon Baby Theme Embroidered Patches Polyester Sewing Appliques For Clothing Decoration Blue Yellow Animals Cute Style
Cartoon Baby Theme Embroidered Patches Polyester Sewing Appliques For Clothing Decoration Blue Yellow Animals Cute Style
like
Find Similar
Daisy embroidery patch double-sided adhesive sheets CROWN #513L size 10x20cm - 1Pc Strong Adhesive Sheet 10x20cm
Baby rattle embroidery patch with dimensions 5.5x3.3cm for cute infant clothing repair - Baby Rattle Style (C23XX-066-09)
Detail showing rainbow and cloud embroidery patch with precise size measurements 6x4cm - Rainbow Cloud Style (C23XX-066-17)
Set of 25 blue baby embroidery patches with bottle and stroller for nursery crafts - Set of 24 Girl (C23XX-210-YT)
+23
Cartoon Baby Theme Embroidered Patches Polyester Sewing Appliques For Clothing Decoration Blue Yellow Animals Cute Style
$0.15-6.33
No MOQ
 · 
15 views
Free Shipping
Cartoon Cat Enamel Pins Funny Meme Animals Zinc Alloy Brooches For Clothes Bags Backpacks Lapel Badges Decor Gifts
Cartoon Cat Enamel Pins Funny Meme Animals Zinc Alloy Brooches For Clothes Bags Backpacks Lapel Badges Decor Gifts
like
Find Similar
Round metal enamel pin with three cartoon cats and Certified Cat Lady text on white - Round Tri-color Cats (Cat Lady) (qhxz771)
Pink cat antidepressant enamel pin featuring cartoon cats in a decorative metal badge - Pink Potion Bottle Cat Can (QHXZ772)
Orange cat badge with heart sunglasses and Meow Meow Catitude text enamel pin - Heart Sunglasses Orange Cat (Catitude) (QHXZ773)
Cartoon enamel pin featuring black cats peeking out of a vintage brown book design - Retro Book Black Cats (xz9951)
+4
Cartoon Cat Enamel Pins Funny Meme Animals Zinc Alloy Brooches For Clothes Bags Backpacks Lapel Badges Decor Gifts
-9%
$0.45-0.63
No MOQ
 · 
16 views
Free Shipping
Spiral Drying Rack Metal Space Saving Bed Sheet Quilt Hanger Rotatable Heavy Duty Laundry Rack Indoor Outdoor
Spiral Drying Rack Metal Space Saving Bed Sheet Quilt Hanger Rotatable Heavy Duty Laundry Rack Indoor Outdoor
like
Find Similar
Spiral drying rack for bedsheets and quilts with 9.9mm thickened frame - Oval White / 9.9mm Tube / 500x210x190mm
Set of 2 spiral quilt drying racks with 9.9mm thickened metal tube and dimension markings - Oval White / 9.9mm Tube / 500x210x190mm
Set of 3 durable spiral quilt hangers with 9.9mm thickened steel tube for sheets - Oval White / 9.9mm Tube / 500x210x190mm
Space-saving 500mm foldable oval spiral drying rack for bedsheets and quilts - Oval Foldable White / 9.9mm Tube / 500x210x190mm
+12
Spiral Drying Rack Metal Space Saving Bed Sheet Quilt Hanger Rotatable Heavy Duty Laundry Rack Indoor Outdoor
-5%
$2.05-6.03
No MOQ
Cartoon Cow Embroidery Patches Polyester Cute Cow Baby Animal DIY Clothing Decorative Applique Badges For Shirts Bags
Cartoon Cow Embroidery Patches Polyester Cute Cow Baby Animal DIY Clothing Decorative Applique Badges For Shirts Bags
like
Find Similar
Daisy embroidery patch double-sided adhesive sheets CROWN #513L size 10x20cm - Strong Adhesive Sheet (One Sheet 20*10CM)
Variety set of cartoon cow embroidered patches in black and white for DIY clothing - Cow Print Patch Set (24 Pcs)
Cute cartoon cow embroidery patches in black and white for clothing and bag decoration - Set of 25Pcs
Detailed embroidery texture of a cute black and white cow patch with dimensions - Sitting Cow (No. 1)
+23
Cartoon Cow Embroidery Patches Polyester Cute Cow Baby Animal DIY Clothing Decorative Applique Badges For Shirts Bags
$0.20-7.19
No MOQ
 · 
10 sold recently
Free Shipping
Medical Nursing Embroidered Patches Cartoon Ambulance Nurse Hat Heart Organ Fabric Applique DIY Clothing Decoration
Medical Nursing Embroidered Patches Cartoon Ambulance Nurse Hat Heart Organ Fabric Applique DIY Clothing Decoration
like
Find Similar
Daisy embroidery patch double-sided adhesive sheets CROWN #513L size 10x20cm - 1pc Adhesive Sheet 20x10cm
15-piece medical nursing embroidery patches set featuring ambulance and nurse cap designs - Set of 15 (X30AX-142-YT)
Set of 10 medical themed cartoon embroidery patches including nurse hat and heart icons - Set of 10 (X30AX-102-YT)
Detailed embroidery texture and dimensions of the cartoon ambulance patch - Ambulance (X30AX-12-01)
+14
Medical Nursing Embroidered Patches Cartoon Ambulance Nurse Hat Heart Organ Fabric Applique DIY Clothing Decoration
$0.16-4.09
No MOQ
 · 
25 views
Free Shipping
Embroidered Patches Outdoor Camping Theme Iron On Appliques For Backpack Jacket Clothing Decoration Adventure Hiking
Embroidered Patches Outdoor Camping Theme Iron On Appliques For Backpack Jacket Clothing Decoration Adventure Hiking
like
Find Similar
Daisy embroidery patch double-sided adhesive sheets CROWN #513L size 10x20cm - Strong Adhesive Sheet
Close-up of binoculars embroidery patch showing detailed stitching and 7.3cm x 4.5cm size - Binoculars Style
Detailed embroidery patch of an outdoor boot with 7.2cm by 5.1cm dimension labels - No.2 Hiking Boots
Teal embroidered flashlight patch measuring 7.3cm x 4.4cm on a plain white background - Flashlight Style
+21
Embroidered Patches Outdoor Camping Theme Iron On Appliques For Backpack Jacket Clothing Decoration Adventure Hiking
$0.20-0.43
No MOQ
 · 
82 sold recently
Top 10% Best Sellers
in Arts, Crafts & Sewing
Free Shipping
Melting Art Embroidered Patches Heart Banana Yin Yang Iron On Badges DIY Clothing Decoration Stickers
Melting Art Embroidered Patches Heart Banana Yin Yang Iron On Badges DIY Clothing Decoration Stickers
like
Find Similar
Detailed view of melting heart embroidery patch with size measurements 7.8cm by 5.6cm - Multi-colored Heart Patch
Melting Yin Yang embroidered patch in mint green and purple, 7.6cm by 5.3cm DIY patch - Yin Yang Patch
Detailed view of melting LOVE heart embroidery patch showing 6.3cm x 6.8cm size and 2.4g weight - Love Letter Patch
Detail showing embroidered banana patch dimensions 7.9cm by 4.5cm on white background - Banana Patch
+5
Melting Art Embroidered Patches Heart Banana Yin Yang Iron On Badges DIY Clothing Decoration Stickers
$0.24-2.39
No MOQ
 · 
149 sold recently
Free Shipping
Embroidery Patches Cartoon Plants Cactus Animal Iron On Sew On Decorative Apparel Accessories Polyester
Embroidery Patches Cartoon Plants Cactus Animal Iron On Sew On Decorative Apparel Accessories Polyester
like
Find Similar
Close-up of yellow smiley face embroidery patch with Always Be Kind text and flower - Plant Travel Style 1 (Smile Daisy)
Detailed size chart for succulent cactus embroidery patch with height and width dimensions - Plant Travel Style 2 (Succulent Pot)
Detail of a 6.6 cm round embroidery patch with peace sign and colorful floral patterns - Plant Travel Style 3 (Colorful Peace Flower)
Detailed view of smiling star and rainbow embroidery patch showing 6.5x3.5cm dimensions - Plant Travel Style 4 (Smile Rainbow Star)
+17
Embroidery Patches Cartoon Plants Cactus Animal Iron On Sew On Decorative Apparel Accessories Polyester
$0.13-5.60
No MOQ
 · 
136 sold recently
Top 10% Best Sellers
in Arts, Crafts & Sewing
Free Shipping
Punk Gothic Horror Black White Embroidery Patches Iron On Sew On Embroidered Appliques For Clothing DIY Accessories
Punk Gothic Horror Black White Embroidery Patches Iron On Sew On Embroidered Appliques For Clothing DIY Accessories
like
Find Similar
Punk style black and white embroidered eye lip patch with size and weight dimensions - Lips Patch 1#
Punk style black and white embroidery patch featuring a weeping woman face and rose design - Beauty Face Patch 2#
Detail shot of punk skull and lily embroidery patch with 7.1cm size measurement - Skull Head Patch 3#
Detail of skull in bottle embroidered patch with size dimensions 7.3cm x 4.2cm - Bottle Skull Patch 4#
+9
Punk Gothic Horror Black White Embroidery Patches Iron On Sew On Embroidered Appliques For Clothing DIY Accessories
$0.22-3.99
No MOQ
 · 
94 sold recently
Top 5% Best Sellers
in Arts, Crafts & Sewing
Free Shipping
Go to

More in home & kitchen

Explore more in steel bottles

steeldoubledisplaymagnetickidsstrapdiywidetitaniumgirls
304 stainless steel316 stainless steelnaturalstylebarplasticmetalpolishedshapenecklace stainless steel

Ready to source like an insider

Get a direct line to the factory floor — no minimums, no middlemen, no guesswork.
iconReal factory pricing, no markup in betweeniconEvery order hand-inspected before it shipsicon5,000+ new products added daily
Get Inside Access