Everful

Wholesale plastic fruit

Factory-direct selection, vetted for quality and ready to order.

Sign Up
Plastic Fruit

Find the perfect pieces: drinkware, dinnerware & tableware, kitchen tools & gadgets and more

filterShow Filters
Best Seller
New Arrivals
Price Drop
Free Shipping
Fruit Stacked Silicone Mold For Candle Holder Strawberry Orange Grape Eggplant Shaped Realistic Texture DIY Gypsum Soap Making
Fruit Stacked Silicone Mold For Candle Holder Strawberry Orange Grape Eggplant Shaped Realistic Texture DIY Gypsum Soap Making
like
Find Similar
Stacked strawberry silicone mold for DIY candle making with precise dimensions - Stacked Strawberry
Triple stacked orange fruit candle silicone mold with clear texture for DIY resin craft - Stacked Orange
Stacked sphere silicone mold with purple textured candle outcome, 12cm height dimensions - Stacked Eggplant
Silicone mold for double-layered grape cluster candles with product size dimensions - Stacked Grape
Fruit Stacked Silicone Mold For Candle Holder Strawberry Orange Grape Eggplant Shaped Realistic Texture DIY Gypsum Soap Making
-5%
$2.74-3.42
Mix MOQ : 2
Natural Rattan Storage Basket Handwoven Round Fruit Tray Wave Edge Desktop Organizer For Bread Vegetable Kitchen Home Decor
Natural Rattan Storage Basket Handwoven Round Fruit Tray Wave Edge Desktop Organizer For Bread Vegetable Kitchen Home Decor
like
Find Similar
Set of 3 handmade woven rattan storage baskets with elegant wavy edges in natural wood color - Small (22cm x 5cm) / Wood Brown
Natural Rattan Storage Basket Handwoven Round Fruit Tray Wave Edge Desktop Organizer For Bread Vegetable Kitchen Home Decor
-5%
$7.61-28.75
No MOQ
Pine Cone Shape Silicone Mold 3D Cedar Fruit DIY Candle Making Soap Plaster Resin Christmas Home Decor Modern Craft Tool
Pine Cone Shape Silicone Mold 3D Cedar Fruit DIY Candle Making Soap Plaster Resin Christmas Home Decor Modern Craft Tool
like
Find Similar
Pinecone shaped silicone mold for DIY Christmas candles with pink pine nut finish - Small Pinecone
Pinecone silicone mold for DIY candles with 2.95x2.87 inch dimensions and green finished product - Medium Pinecone
Pinecone silicone candle mold for DIY crafts including a purple wax sample 9.2cm tall - Large Pinecone
Pine cone silicone mold for DIY candles with dimensions and a sample finished piece - Heart Pinecone
Pine Cone Shape Silicone Mold 3D Cedar Fruit DIY Candle Making Soap Plaster Resin Christmas Home Decor Modern Craft Tool
-5%
$1.51-3.78
Mix MOQ : 5
Manual Vegetable Dehydrator Salad Spinner Large Capacity Fruit Washer Dryer Basket With Scale Kitchen Tool
Manual Vegetable Dehydrator Salad Spinner Large Capacity Fruit Washer Dryer Basket With Scale Kitchen Tool
like
Find Similar
2 options
Manual Vegetable Dehydrator Salad Spinner Large Capacity Fruit Washer Dryer Basket With Scale Kitchen Tool
-4%
$7.32
No MOQ
Day Of The Dead Cake Toppers Colorful Sugar Skull Mexican Theme Cardstock Bamboo Sticks Dessert Fruit Picks Party Decoration
Day Of The Dead Cake Toppers Colorful Sugar Skull Mexican Theme Cardstock Bamboo Sticks Dessert Fruit Picks Party Decoration
like
Find Similar
Set of 8 colorful Day of the Dead sugar skull cake toppers for Mexican party decor - Day of the Dead Skull Cake Toppers
Day Of The Dead Cake Toppers Colorful Sugar Skull Mexican Theme Cardstock Bamboo Sticks Dessert Fruit Picks Party Decoration
-4%
$0.44
Mix MOQ : 5
 · 
10 sold recently
Handmade Crochet Cherry Cotton Thread DIY Jewelry Accessories For Hair Clips Phone Case Decor Sweet Fruit Woven Ornament
Handmade Crochet Cherry Cotton Thread DIY Jewelry Accessories For Hair Clips Phone Case Decor Sweet Fruit Woven Ornament
like
Find Similar
Macro view of handmade crochet cherry accessories with soft yarn texture on a ceramic plate - Cherry (One Pair Set)
Handmade Crochet Cherry Cotton Thread DIY Jewelry Accessories For Hair Clips Phone Case Decor Sweet Fruit Woven Ornament
-3%
$0.52
Mix MOQ : 2
Handmade Water Hyacinth Woven Storage Basket Round Desktop Sundries Organizer Tray For Home Decor Natural Straw Fruit Bowl
Handmade Water Hyacinth Woven Storage Basket Round Desktop Sundries Organizer Tray For Home Decor Natural Straw Fruit Bowl
like
Find Similar
Handwoven natural seagrass storage basket tray in light brown for desktop organization - Natural Large Round Tray
Handwoven round storage basket with two-tone white cotton rope and natural seagrass - White & Natural Large Round Tray
Handmade Water Hyacinth Woven Storage Basket Round Desktop Sundries Organizer Tray For Home Decor Natural Straw Fruit Bowl
$4.90
Mix MOQ : 50
Peach Shape Silicone Mold With Leaf 3D Longevity Fruit Fondant Chocolate Cake Decorating DIY Soap Candle Making Tool
Peach Shape Silicone Mold With Leaf 3D Longevity Fruit Fondant Chocolate Cake Decorating DIY Soap Candle Making Tool
like
Find Similar
Peach shape silicone mold for cake decorating and chocolate fondant DIY crafts - Mini
Peach-shaped silicone mold for cake decorating and DIY chocolate fondant baking - Small
Peach shaped silicone mold for DIY baking and chocolate making with size specifications - Medium
Peach shaped silicone mold for baking with detailed leaf patterns and dimensions - Large
Peach Shape Silicone Mold With Leaf 3D Longevity Fruit Fondant Chocolate Cake Decorating DIY Soap Candle Making Tool
-3%
$0.17-0.50
Mix MOQ : 2
3D Strawberry Silicone Mold Fruit Shape For Cake Decorating Fondant Chocolate Baking DIY Craft Handmade Dessert Tool
3D Strawberry Silicone Mold Fruit Shape For Cake Decorating Fondant Chocolate Baking DIY Craft Handmade Dessert Tool
like
Find Similar
3D strawberry silicone mold for baking with 4 cavities for fondant or chocolate - 1# Small - Transparent / 15-1164
Pink silicone strawberry mold for baking and crafts, size 7x7x3.7cm for 3D strawberry shapes - 2# Large - Pink / 15-823
4-cavity 3D strawberry silicone mold for DIY chocolate and resin crafts 7x7x3.7cm - 2# Large - Transparent / 15-823
Pink silicone strawberry mold with four cavities and red resin samples 5.5cm size - 1# Small - Pink / 15-1164
3D Strawberry Silicone Mold Fruit Shape For Cake Decorating Fondant Chocolate Baking DIY Craft Handmade Dessert Tool
-5%
$0.55-1.37
No MOQ
Pomegranate Napkin Ring Zinc Alloy Enamel Rhinestone Fruit Shaped Holder For Christmas Dinner Wedding Party Table Decoration
Pomegranate Napkin Ring Zinc Alloy Enamel Rhinestone Fruit Shaped Holder For Christmas Dinner Wedding Party Table Decoration
like
Find Similar
Elegant pomegranate napkin ring with red rhinestones on a luxury dining table setting - Pomegranate Style (WZW-PNR-1527)
Pomegranate Napkin Ring Zinc Alloy Enamel Rhinestone Fruit Shaped Holder For Christmas Dinner Wedding Party Table Decoration
$1.04
Mix MOQ : 12
Pineapple Napkin Rings Alloy Imitation Artificial Pearl Gold Plated Enamel Fruit Shape Table Decoration For Wedding Dinner Party
Pineapple Napkin Rings Alloy Imitation Artificial Pearl Gold Plated Enamel Fruit Shape Table Decoration For Wedding Dinner Party
like
Find Similar
2 options
Pineapple Napkin Rings Alloy Imitation Artificial Pearl Gold Plated Enamel Fruit Shape Table Decoration For Wedding Dinner Party
$0.84-1.10
Mix MOQ : 6
Woven Storage Basket Rattan Wicker With Dual Handles And Polka Dot Cloth Lining Desktop Organizer For Bread Fruit Pastoral Retro Style
Woven Storage Basket Rattan Wicker With Dual Handles And Polka Dot Cloth Lining Desktop Organizer For Bread Fruit Pastoral Retro Style
like
Find Similar
Detail of a woven storage basket with black and white polka dot lining and handles - Black White Polka Dot
Woven Storage Basket Rattan Wicker With Dual Handles And Polka Dot Cloth Lining Desktop Organizer For Bread Fruit Pastoral Retro Style
$4.32
No MOQ
Watercolor Food Stickers DIY Scrapbooking Decorative Stickers Waterproof PVC Cartoon Fruit Pizza Vegetable Journaling Stickers
Watercolor Food Stickers DIY Scrapbooking Decorative Stickers Waterproof PVC Cartoon Fruit Pizza Vegetable Journaling Stickers
like
Find Similar
Waterproof cartoon food stickers set for DIY scrapbooking and puzzle making crafts - Watercolor Food Series
Watercolor Food Stickers DIY Scrapbooking Decorative Stickers Waterproof PVC Cartoon Fruit Pizza Vegetable Journaling Stickers
$0.10
Mix MOQ : 8
Summer Beverage Bottle 3D Embossed Nail Stickers Cute Cartoon Cola Soda Fruit Juice DIY Nail Art Decoration YT5988
Summer Beverage Bottle 3D Embossed Nail Stickers Cute Cartoon Cola Soda Fruit Juice DIY Nail Art Decoration YT5988
like
Find Similar
Cute cartoon summer soda and juice bottle embossed nail stickers with watermelon icons - Embossed Style (YT5988)
Summer Beverage Bottle 3D Embossed Nail Stickers Cute Cartoon Cola Soda Fruit Juice DIY Nail Art Decoration YT5988
$0.72
No MOQ
Free Shipping
Stainless Steel Oval Mesh Basket Fine Wire Weaving Fruit Vegetable Draining Tray Bread Snack Kitchen Desktop Storage
Stainless Steel Oval Mesh Basket Fine Wire Weaving Fruit Vegetable Draining Tray Bread Snack Kitchen Desktop Storage
like
Find Similar
Oval stainless steel mesh basket for rinsing fruit and vegetables on wood tabletop - Oval Large
Detailed view of an oval stainless steel mesh basket on a rustic wooden dining table - Oval Small
Stainless Steel Oval Mesh Basket Fine Wire Weaving Fruit Vegetable Draining Tray Bread Snack Kitchen Desktop Storage
$1.87-2.31
No MOQ
Ceramic Dining Plate Hand-Drawn Cartoon Cat Star Creamy Beige Round Oval Salad Breakfast Fruit Dessert Dish Korean Style
Ceramic Dining Plate Hand-Drawn Cartoon Cat Star Creamy Beige Round Oval Salad Breakfast Fruit Dessert Dish Korean Style
like
Find Similar
Creamy white ceramic oval plate with hand-drawn cat and bear illustrations for breakfast - Star Cat
Ceramic Dining Plate Hand-Drawn Cartoon Cat Star Creamy Beige Round Oval Salad Breakfast Fruit Dessert Dish Korean Style
$3.17
No MOQ
Vintage Fruit Stand Scrapbooking Paper Set Botanical Floral Decorative Cardstock For Junk Journal DIY Crafting Handbooks
Vintage Fruit Stand Scrapbooking Paper Set Botanical Floral Decorative Cardstock For Junk Journal DIY Crafting Handbooks
like
Find Similar
1 option
Vintage Fruit Stand Scrapbooking Paper Set Botanical Floral Decorative Cardstock For Junk Journal DIY Crafting Handbooks
$1.21
No MOQ
Silicone Mold Fruit Ocean Animal Shape For Resin DIY Earring Pendants Handcrafted Jewelry Making Flexible Translucent
Silicone Mold Fruit Ocean Animal Shape For Resin DIY Earring Pendants Handcrafted Jewelry Making Flexible Translucent
like
Find Similar
Silicone fruit mold for DIY earrings with strawberry lemon and peach shapes - Fruit Series
Marine life silicone mold for resin pendants featuring dolphin starfish and anchor shapes - Ocean Series
Translucent silicone resin mold with 8 animal shapes including dog panda and owl designs - Animal Series
Silicone Mold Fruit Ocean Animal Shape For Resin DIY Earring Pendants Handcrafted Jewelry Making Flexible Translucent
-5%
$0.49
Mix MOQ : 5
Nordic Style Hollow Metal Wire Fruit Basket Iron Art Snack Storage Bowl For Home Kitchen Table Decoration
Nordic Style Hollow Metal Wire Fruit Basket Iron Art Snack Storage Bowl For Home Kitchen Table Decoration
like
Find Similar
Gold Nordic iron fruit basket with minimalist wire design and dimensions 18.5x7cm - Small Round Fruit Plate-Gold
Modern black metal wire fruit basket for snacks, 18.5cm diameter minimalist design - Small Round Fruit Plate-Black
Black iron wire fruit bowl with Nordic minimalist design, 25cm diameter snack basket - Large Round Fruit Plate-Black
Nordic Style Hollow Metal Wire Fruit Basket Iron Art Snack Storage Bowl For Home Kitchen Table Decoration
-5%
$2.74-3.29
No MOQ
Hand-Woven Willow Storage Basket Rustic Wicker Fruit Bread Tray Miscellaneous Items Organizer For Home Kitchen Decoration
Hand-Woven Willow Storage Basket Rustic Wicker Fruit Bread Tray Miscellaneous Items Organizer For Home Kitchen Decoration
like
Find Similar
Detail view of woven willow storage basket with dimensions 40x30x10cm and weight 306g - Oval 40*30*10
Detail of hand-woven wicker basket showing dimensions 40x30x10cm and weight 359g - Rectangular 40*30*10
Macro detail of large rectangular wicker basket showing natural willow weave and 80cm dimensions - Large Rectangular 80*30*10
Hand-Woven Willow Storage Basket Rustic Wicker Fruit Bread Tray Miscellaneous Items Organizer For Home Kitchen Decoration
$10.09-25.65
No MOQ
Retro Food Vegetable Fruit Pattern Scrapbook Paper Pad Vintage Junk Journal DIY Decorative Material Paper For Hand Account
Retro Food Vegetable Fruit Pattern Scrapbook Paper Pad Vintage Junk Journal DIY Decorative Material Paper For Hand Account
like
Find Similar
1 option
Retro Food Vegetable Fruit Pattern Scrapbook Paper Pad Vintage Junk Journal DIY Decorative Material Paper For Hand Account
$1.21
No MOQ
Baseball Bat Cocktail Muddler Spiked Ice Crusher Long Handle PC Nylon ABS Bartender Tool For Drinks Fruit Juicing
Baseball Bat Cocktail Muddler Spiked Ice Crusher Long Handle PC Nylon ABS Bartender Tool For Drinks Fruit Juicing
like
Find Similar
Clear plastic cocktail muddler with beige textured head and silver metal cap - Baseball Ice Hammer / Transparent Milk White Silver
Baseball Bat Cocktail Muddler Spiked Ice Crusher Long Handle PC Nylon ABS Bartender Tool For Drinks Fruit Juicing
-5%
$2.41
No MOQ
 · 
22 views
DIY Silicone Mold Crystal Resin Epoxy Casting Multi Shapes Heart Star Animal Fruit Handmade Jewelry Making Tools
DIY Silicone Mold Crystal Resin Epoxy Casting Multi Shapes Heart Star Animal Fruit Handmade Jewelry Making Tools
like
Find Similar
DIY silicone mold with 14 cute shapes like rabbits and apples for resin jewelry making - Cute Apple & Star Large Mold
16-cavity silicone mold featuring hearts, rabbits, and stars for DIY resin and jewelry craft - Cute Apple & Star Small Mold
Translucent silicone DIY mold featuring 16 shapes like hearts, stars, and strawberries - Small Strawberry & Bow Mold
DIY Silicone Mold Crystal Resin Epoxy Casting Multi Shapes Heart Star Animal Fruit Handmade Jewelry Making Tools
$0.55-1.15
No MOQ
Fruit Shape Silicone Mold 3D Strawberry Blueberry Orange For Cake Decoration DIY Baking Chocolate Candy Tools
Fruit Shape Silicone Mold 3D Strawberry Blueberry Orange For Cake Decoration DIY Baking Chocolate Candy Tools
like
Find Similar
3D pink silicone mold for berry candies and chocolates with 9-cavity round design - Blueberry Raspberry Style(1)
3D silicone strawberry blueberry mold for chocolate cake decoration with 8 cavities - Textured Petal Style(2)
Pink 3D silicone strawberry blueberry gummy mold with measurements 10.6x5x2cm - Orange Segment Style(3)
3D pink silicone strawberry mold with four cavities for cake decorating and chocolate - Strawberry Style(4)
Fruit Shape Silicone Mold 3D Strawberry Blueberry Orange For Cake Decoration DIY Baking Chocolate Candy Tools
-4%
$0.69-1.76
Mix MOQ : 2
Snowman Gnome Silicone Cake Mold Layered Fruit Shape 3D Relief DIY Baking Decorating Tool Flexible Pink Heat Resistant
Snowman Gnome Silicone Cake Mold Layered Fruit Shape 3D Relief DIY Baking Decorating Tool Flexible Pink Heat Resistant
like
Find Similar
3D gnome silicone mold for DIY baking and crafts featuring a textured snowman shape - Snowman/Cartoon Gnome Style
Pink cylindrical silicone snowman cake mold with textured 3D finished wax model - Three-layer Cake Style
Snowman Gnome Silicone Cake Mold Layered Fruit Shape 3D Relief DIY Baking Decorating Tool Flexible Pink Heat Resistant
-4%
$0.47-0.58
Mix MOQ : 2
Ceramic Bowl Irregular Hammered Texture White Noodle Soup Salad Fruit Nordic Minimalist Design Underglaze
Ceramic Bowl Irregular Hammered Texture White Noodle Soup Salad Fruit Nordic Minimalist Design Underglaze
like
Find Similar
Detail of white ceramic bowl with unique hammer texture finish and irregular wavy rim - 6.5 Inch Bowl (16.5*6.3cm)
Ceramic Bowl Irregular Hammered Texture White Noodle Soup Salad Fruit Nordic Minimalist Design Underglaze
$3.17
No MOQ
Handmade Knitted Strawberry Crochet Accessory For DIY Jewelry Hair Clip Clothing Decoration Cute Fruit Craft Material
Handmade Knitted Strawberry Crochet Accessory For DIY Jewelry Hair Clip Clothing Decoration Cute Fruit Craft Material
like
Find Similar
Macro detail of hand-knitted strawberry charms in red and green yarn on white ceramic - Big Strawberry
Handmade Knitted Strawberry Crochet Accessory For DIY Jewelry Hair Clip Clothing Decoration Cute Fruit Craft Material
-5%
$0.71
Mix MOQ : 2
Free Shipping
Summer Beach Watercolor Transparent PET Stickers Waterproof Tropical Fruit Vacation Stickers For Scrapbook Journal Guitar
Summer Beach Watercolor Transparent PET Stickers Waterproof Tropical Fruit Vacation Stickers For Scrapbook Journal Guitar
like
Find Similar
50 pieces of waterproof transparent PET summer beach watercolor stickers for scrapbooking - Summer Beach
Summer Beach Watercolor Transparent PET Stickers Waterproof Tropical Fruit Vacation Stickers For Scrapbook Journal Guitar
$1.04
No MOQ
Strawberry Fruit Shape Silicone Mold For Fondant Chocolate Cake Decoration Handmade DIY Baking Craft Pink Tool
Strawberry Fruit Shape Silicone Mold For Fondant Chocolate Cake Decoration Handmade DIY Baking Craft Pink Tool
like
Find Similar
Detailed view of pink 3-cavity strawberry silicone mold for fondant and chocolate DIY - 3-Hole Fruit Style / Pink
Detailed pink silicone strawberry mold with textured fruit resin craft project - Single Strawberry Style / Pink
Strawberry Fruit Shape Silicone Mold For Fondant Chocolate Cake Decoration Handmade DIY Baking Craft Pink Tool
-6%
$0.27-0.54
Mix MOQ : 2
Microfiber Printed Beach Towel Quick Dry Summer Citrus Fruit Pattern Bath Towel Absorbent Travel Sport Towel Pool Party
Microfiber Printed Beach Towel Quick Dry Summer Citrus Fruit Pattern Bath Towel Absorbent Travel Sport Towel Pool Party
like
Find Similar
Microfiber beach towel with citrus fruit print held by a model on a sunny pier beach - 70x150cm / Fresh Citrus
Microfiber Printed Beach Towel Quick Dry Summer Citrus Fruit Pattern Bath Towel Absorbent Travel Sport Towel Pool Party
-5%
$2.60
No MOQ
Cartoon Fruit Vegetable Pattern Decorative Stickers Set Realistic Hand-Drawn Self-Adhesive Labels For DIY Scrapbooking Gift Box Decor
Cartoon Fruit Vegetable Pattern Decorative Stickers Set Realistic Hand-Drawn Self-Adhesive Labels For DIY Scrapbooking Gift Box Decor
like
Find Similar
Roll of 500 fruit and vegetable theme stickers including strawberry and banana - 1000 Stickers - 3 Rolls / ZE36
Cartoon Fruit Vegetable Pattern Decorative Stickers Set Realistic Hand-Drawn Self-Adhesive Labels For DIY Scrapbooking Gift Box Decor
-4%
$1.10
No MOQ
Japanese Vintage Ceramic Underglaze Apple Shaped Plate Fruit Salad Plate Soup Cup Embossed Pastoral Kitchen Tableware Set
Japanese Vintage Ceramic Underglaze Apple Shaped Plate Fruit Salad Plate Soup Cup Embossed Pastoral Kitchen Tableware Set
like
Find Similar
Japanese style apple shaped ceramic bowl with blue floral and red apple pattern - Apple Shaped Plate
Japanese retro ceramic oval serving plate with blue apple motif on a wooden table - Apple Square Plate / 1
Blue ceramic apple pattern breakfast mug with handle on a rustic wooden table - Apple Soup Cup / 1
Japanese Vintage Ceramic Underglaze Apple Shaped Plate Fruit Salad Plate Soup Cup Embossed Pastoral Kitchen Tableware Set
$4.61-5.19
Mix MOQ : 10
3D Geometric Fruit Silicone Mold Apple Pear Shape DIY Handmade Scented Candle Resin Plaster Crafts Soap Making Tool Modern Minimalist
3D Geometric Fruit Silicone Mold Apple Pear Shape DIY Handmade Scented Candle Resin Plaster Crafts Soap Making Tool Modern Minimalist
like
Find Similar
Faceted pear silicone mold for candles and resin crafts with dimensions 10.3x7.7x7.5cm - Geometric Pear Shape / White
Faceted apple silicone mold for DIY candles with dimensions 7.5x8.9 cm - Geometric Apple Shape / White
3D Geometric Fruit Silicone Mold Apple Pear Shape DIY Handmade Scented Candle Resin Plaster Crafts Soap Making Tool Modern Minimalist
-5%
$2.05
Mix MOQ : 2
Tiered Iron Fruit Basket Metal Leaf Hollow Serving Stand For Home Living Room Tabletop Decor Modern Nordic Style
Tiered Iron Fruit Basket Metal Leaf Hollow Serving Stand For Home Living Room Tabletop Decor Modern Nordic Style
like
Find Similar
Golden 3-tier metal fruit basket with elegant hollow leaf design and 32cm height frame - Gold
Black 3-tier metal wire fruit basket stand with hollow petal-shaped trays and round base - Black
Tiered Iron Fruit Basket Metal Leaf Hollow Serving Stand For Home Living Room Tabletop Decor Modern Nordic Style
-5%
$6.79-7.26
No MOQ
Cherry Silicone Mold For DIY Cake Decorating Chocolate Candy Resin Art Craft Baking Tool Non-Stick Fruit Shape
Cherry Silicone Mold For DIY Cake Decorating Chocolate Candy Resin Art Craft Baking Tool Non-Stick Fruit Shape
like
Find Similar
Dual cherry silicone DIY cake mold with 3D resin fruit samples on a floral backdrop - Cherry Shape (601)
NewCherry Silicone Mold For DIY Cake Decorating Chocolate Candy Resin Art Craft Baking Tool Non-Stick Fruit Shape
$0.29
Mix MOQ : 2
Summer Fruit Laser Glitter Stickers Waterproof Self Adhesive DIY Decorative Labels For Scrapbooking Journaling Kids Birthday Party Gift Decor
Summer Fruit Laser Glitter Stickers Waterproof Self Adhesive DIY Decorative Labels For Scrapbooking Journaling Kids Birthday Party Gift Decor
like
Find Similar
500pcs laser fruit stickers roll with holographic glitter apple and lemon designs - Summer Fruit Series (ZB47) / 500 Pieces/Pack (3cm)
Summer Fruit Laser Glitter Stickers Waterproof Self Adhesive DIY Decorative Labels For Scrapbooking Journaling Kids Birthday Party Gift Decor
-4%
$0.96
No MOQ
Stainless Steel Dessert Spoon Leaf Shaped Handle Coffee Stirring Scoop For Ice Cream Fruit Dumpling Filling Multi-purpose Kitchen Tool
Stainless Steel Dessert Spoon Leaf Shaped Handle Coffee Stirring Scoop For Ice Cream Fruit Dumpling Filling Multi-purpose Kitchen Tool
like
Find Similar
Detail of leaf pattern engraving and SUS 304 stamp on stainless steel spoon handle - Fine Polished [Bagged]
Macro detail of leaf-shaped stainless steel spoons with 304 food grade engraving - Water Polished [Bulk]
Stainless Steel Dessert Spoon Leaf Shaped Handle Coffee Stirring Scoop For Ice Cream Fruit Dumpling Filling Multi-purpose Kitchen Tool
$0.04-0.17
Mix MOQ : 2
Napkin Rings Artificial Olive Branch Twine Wrapped Table Decoration Pastoral Green Leaves Purple Fruits Mediterranean
Napkin Rings Artificial Olive Branch Twine Wrapped Table Decoration Pastoral Green Leaves Purple Fruits Mediterranean
like
Find Similar
Handmade olive leaf napkin ring with natural twine wrap and artificial berries - Default
Napkin Rings Artificial Olive Branch Twine Wrapped Table Decoration Pastoral Green Leaves Purple Fruits Mediterranean
$2.25
Mix MOQ : 12
Reward Stickers Cartoon Animal Fruit For Kids Teachers Classroom School Motivation Encouragement Round Self Adhesive
Reward Stickers Cartoon Animal Fruit For Kids Teachers Classroom School Motivation Encouragement Round Self Adhesive
like
Find Similar
1 option
Reward Stickers Cartoon Animal Fruit For Kids Teachers Classroom School Motivation Encouragement Round Self Adhesive
-3%
$0.26
No MOQ
Creative Apple Shaped Plush Tissue Cover Cartoon Fruit Hanging Tissue Holder For Car Home Desktop Dormitory
Creative Apple Shaped Plush Tissue Cover Cartoon Fruit Hanging Tissue Holder For Car Home Desktop Dormitory
like
Find Similar
Close-up of cute plush red apple tissue box holder with checkered handle and star detail - Star Apple
Creative Apple Shaped Plush Tissue Cover Cartoon Fruit Hanging Tissue Holder For Car Home Desktop Dormitory
$3.75
No MOQ
Strawberry Silicone Mold Fruit Shape For Cake Decorating Fondant Chocolate Baking DIY Sugar Craft Pink Flexible
Strawberry Silicone Mold Fruit Shape For Cake Decorating Fondant Chocolate Baking DIY Sugar Craft Pink Flexible
like
Find Similar
Pink silicone strawberry cake mold with three cavities on a bright blue background - Three Cavity Strawberry Style
Strawberry Silicone Mold Fruit Shape For Cake Decorating Fondant Chocolate Baking DIY Sugar Craft Pink Flexible
$0.40
Mix MOQ : 2
Lychee Shape Silicone Mold 3D Fruit Multi Cavity For DIY Baking Chocolate Aromatherapy Candle Plaster Crafts
Lychee Shape Silicone Mold 3D Fruit Multi Cavity For DIY Baking Chocolate Aromatherapy Candle Plaster Crafts
like
Find Similar
Silicone mold with 4 cavities for lychee-shaped candles, soaps and resin crafts - Lychee / White
Lychee Shape Silicone Mold 3D Fruit Multi Cavity For DIY Baking Chocolate Aromatherapy Candle Plaster Crafts
-4%
$1.37
Mix MOQ : 2
3D Relief Nail Art Stickers Summer Drink Cocktail Fruit Lemon Pattern Self Adhesive Nail Decals For Women DIY Decoration
3D Relief Nail Art Stickers Summer Drink Cocktail Fruit Lemon Pattern Self Adhesive Nail Decals For Women DIY Decoration
like
Find Similar
Summer cocktail and lemon themed embossed nail art stickers with 3D relief texture - Relief YT5958
3D Relief Nail Art Stickers Summer Drink Cocktail Fruit Lemon Pattern Self Adhesive Nail Decals For Women DIY Decoration
$0.72
No MOQ
Free Shipping
Handmade Round Woven Wicker Storage Tray With Handles For Fruit Vegetable Bread Rustic Decorative Home Kitchen Organizer Basket
Handmade Round Woven Wicker Storage Tray With Handles For Fruit Vegetable Bread Rustic Decorative Home Kitchen Organizer Basket
like
Find Similar
Detailed top view of a hand-woven round rattan tray with sturdy handles on a wooden table - Small (29cm*4cm) / Wood Brown
Handmade Round Woven Wicker Storage Tray With Handles For Fruit Vegetable Bread Rustic Decorative Home Kitchen Organizer Basket
-12%
$9.89-21.56
No MOQ
Cartoon Fruit Adhesive Stickers For Gift Sealing Cute Strawberry Apple Pattern Labels For Kids Scrapbooking And Decoration
Cartoon Fruit Adhesive Stickers For Gift Sealing Cute Strawberry Apple Pattern Labels For Kids Scrapbooking And Decoration
like
Find Similar
500pcs roll of 8 assorted fruit cartoon stickers for gift sealing and decoration - 500 Sheets Per Roll (Item F130) / Diameter 2.5cm
NewCartoon Fruit Adhesive Stickers For Gift Sealing Cute Strawberry Apple Pattern Labels For Kids Scrapbooking And Decoration
-5%
$0.33
Mix MOQ : 10
Avocado Shaped Silicone Mold DIY Baking Cake Mousse Chocolate 3D Fruit Design Kitchen Tools Pink
Avocado Shaped Silicone Mold DIY Baking Cake Mousse Chocolate 3D Fruit Design Kitchen Tools Pink
like
Find Similar
Avocado-shaped silicone mold for DIY baking, cakes, and mousse crafts in pink finish - Pink Avocado (752)
Avocado Shaped Silicone Mold DIY Baking Cake Mousse Chocolate 3D Fruit Design Kitchen Tools Pink
$0.61
Mix MOQ : 2
Vintage Fruit Tree Botanical Illustration Material Paper For Junk Journal Scrapbooking DIY Craft Decorative Paper
Vintage Fruit Tree Botanical Illustration Material Paper For Junk Journal Scrapbooking DIY Craft Decorative Paper
like
Find Similar
1 option
Vintage Fruit Tree Botanical Illustration Material Paper For Junk Journal Scrapbooking DIY Craft Decorative Paper
$1.10
No MOQ
Waterproof PVC Cartoon Vegetable Fruit Personified Stickers DIY Decorative Decals For Journaling Laptop Luggage Kids Gift
Waterproof PVC Cartoon Vegetable Fruit Personified Stickers DIY Decorative Decals For Journaling Laptop Luggage Kids Gift
like
Find Similar
50pcs cute waterproof cartoon vegetable doll stickers for laptop guitar and luggage DIY deco - Vegetable Doll
Waterproof PVC Cartoon Vegetable Fruit Personified Stickers DIY Decorative Decals For Journaling Laptop Luggage Kids Gift
$0.98
Mix MOQ : 3
Fruit Shape Silicone Mold Pear Lemon DIY Baking Soap Candle Wax Plaster Handmade Craft Kitchen Tool
Fruit Shape Silicone Mold Pear Lemon DIY Baking Soap Candle Wax Plaster Handmade Craft Kitchen Tool
like
Find Similar
Pear shaped silicone mold for DIY soap and candles with translucent finish and dimensions - Pear Shape (417-1)
Pear and lemon shaped DIY silicone mold for baking, soap making, and plaster crafts - Lemon Shape (417-2)
Fruit Shape Silicone Mold Pear Lemon DIY Baking Soap Candle Wax Plaster Handmade Craft Kitchen Tool
-5%
$0.90-1.12
Mix MOQ : 2
Creative Slanted Handle Dessert Spoon And Fork Stainless Steel Mirror Polished Cake Coffee Stirring Yogurt Fruit Ice Cream
Creative Slanted Handle Dessert Spoon And Fork Stainless Steel Mirror Polished Cake Coffee Stirring Yogurt Fruit Ice Cream
like
Find Similar
Polished silver stainless steel dessert fork measuring 13.2cm long and weighing 15g - Fork / Silver
Golden stainless steel dessert fork measuring 13.2cm long and weighing 15g - Fork / Gold
Creative Slanted Handle Dessert Spoon And Fork Stainless Steel Mirror Polished Cake Coffee Stirring Yogurt Fruit Ice Cream
$0.20-0.27
No MOQ
Cartoon Pixel Art Fruit Vegetable Stickers Waterproof PVC DIY Decals For Luggage Water Bottle Phone Case Scrapbooking Decor
Cartoon Pixel Art Fruit Vegetable Stickers Waterproof PVC DIY Decals For Luggage Water Bottle Phone Case Scrapbooking Decor
like
Find Similar
Cute pixel art fruit and vegetable cartoon stickers set for DIY laptops and luggage - Anthropomorphic Pixel Fruit Vegetable Set / Pack of 100
Cartoon Pixel Art Fruit Vegetable Stickers Waterproof PVC DIY Decals For Luggage Water Bottle Phone Case Scrapbooking Decor
$0.95
No MOQ
Sweet Red Wine Red Velvet Bow Cherry Pendants For DIY Earring Hair Accessory Making Cute Fruit Design Handmade Jewelry Supplies
Sweet Red Wine Red Velvet Bow Cherry Pendants For DIY Earring Hair Accessory Making Cute Fruit Design Handmade Jewelry Supplies
like
Find Similar
Detail of glossy red cherry hair accessory with a sparkling bow on a white plate - Bright Red Bow Cherry
Detail of red velvet bow and cherry accessory on a minimalist white card background - Wine Red Bow Cherry
Sweet Red Wine Red Velvet Bow Cherry Pendants For DIY Earring Hair Accessory Making Cute Fruit Design Handmade Jewelry Supplies
-13%
$0.25
Mix MOQ : 2
Cute Cartoon Animal Fruit Vegetable Stickers For Kids Reward PVC Waterproof Decals For Phone Case Luggage DIY Decoration
Cute Cartoon Animal Fruit Vegetable Stickers For Kids Reward PVC Waterproof Decals For Phone Case Luggage DIY Decoration
like
Find Similar
Vibrant bulk set of cute cartoon animal and fruit stickers for phone cases and luggage decoration - Cute Cartoon Series
Cute Cartoon Animal Fruit Vegetable Stickers For Kids Reward PVC Waterproof Decals For Phone Case Luggage DIY Decoration
$7.15
No MOQ
Cute Cartoon Watercolor Fruit Floral PVC Stickers Roll For Scrapbooking DIY Journaling Decorative Envelope Seals Gift
Cute Cartoon Watercolor Fruit Floral PVC Stickers Roll For Scrapbooking DIY Journaling Decorative Envelope Seals Gift
like
Find Similar
Roll of 500 hand-drawn watercolor fruit and floral stickers for scrapbooking and gifts - Fresh Watercolor Fruit Floral Sticker Roll
Cute Cartoon Watercolor Fruit Floral PVC Stickers Roll For Scrapbooking DIY Journaling Decorative Envelope Seals Gift
$0.86
No MOQ
Pineapple Napkin Ring Alloy Enamel Rhinestone Tropical Fruit Design Table Decor For Wedding Party Dinner Gold Green
Pineapple Napkin Ring Alloy Enamel Rhinestone Tropical Fruit Design Table Decor For Wedding Party Dinner Gold Green
like
Find Similar
1 option
Pineapple Napkin Ring Alloy Enamel Rhinestone Tropical Fruit Design Table Decor For Wedding Party Dinner Gold Green
$1.12
Mix MOQ : 12
Pineapple Shape Silicone Mold Flexible 3D Fruit Pattern For DIY Cake Baking Chocolate Pudding Soap Candle Crafting
Pineapple Shape Silicone Mold Flexible 3D Fruit Pattern For DIY Cake Baking Chocolate Pudding Soap Candle Crafting
like
Find Similar
Pineapple shaped silicone mold for DIY handmade soap and chocolate baking on stone texture - Pink Pineapple Style
Pineapple Shape Silicone Mold Flexible 3D Fruit Pattern For DIY Cake Baking Chocolate Pudding Soap Candle Crafting
$0.98
Mix MOQ : 2
Round Cartoon Fruit Dessert Reward Stickers Adhesive Label For Teacher Classroom Student Gift Sealing Scrapbooking Decoration
Round Cartoon Fruit Dessert Reward Stickers Adhesive Label For Teacher Classroom Student Gift Sealing Scrapbooking Decoration
like
Find Similar
1 option
Round Cartoon Fruit Dessert Reward Stickers Adhesive Label For Teacher Classroom Student Gift Sealing Scrapbooking Decoration
$1.04
No MOQ
Fruit Shape Silicone Mold For DIY Cake Decoration Resin Casting Aromatherapy Plaster Strawberry Pineapple Novelty
Fruit Shape Silicone Mold For DIY Cake Decoration Resin Casting Aromatherapy Plaster Strawberry Pineapple Novelty
like
Find Similar
Silicone fruit mold for DIY crafts including strawberry pineapple and watermelon shapes - Multi-Grid Fruit Shape
Fruit Shape Silicone Mold For DIY Cake Decoration Resin Casting Aromatherapy Plaster Strawberry Pineapple Novelty
$0.58
Mix MOQ : 2
Cartoon Food Fruit PVC Stickers Waterproof Decorative Decals For Laptop Suitcase Guitar Cup Journal DIY Scrapbooking For Kids Gift
Cartoon Food Fruit PVC Stickers Waterproof Decorative Decals For Laptop Suitcase Guitar Cup Journal DIY Scrapbooking For Kids Gift
like
Find Similar
Vibrant cartoon food and fruit stickers set with donuts and sandwiches on white background - Cartoon Food Fruit Pattern
Cartoon Food Fruit PVC Stickers Waterproof Decorative Decals For Laptop Suitcase Guitar Cup Journal DIY Scrapbooking For Kids Gift
$0.96
No MOQ
Round Decorative Stickers Cartoon Fruit Cake Pattern Adhesive Labels For Scrapbooking Journaling Phone Case Water Cup
Round Decorative Stickers Cartoon Fruit Cake Pattern Adhesive Labels For Scrapbooking Journaling Phone Case Water Cup
like
Find Similar
500pcs roll of 2.5cm cute Korean style cartoon stickers for cups and phone cases - Mixed Patterns (C182)
Round Decorative Stickers Cartoon Fruit Cake Pattern Adhesive Labels For Scrapbooking Journaling Phone Case Water Cup
-3%
$0.26
No MOQ
Go to

More in home & kitchen

Explore more in plastic fruit

plastichomestoragestudentsgelstyledesignpetdecorativewhite
kidstoolartificialshapediyclawcakehangingroundwire

Ready to source like an insider

Get a direct line to the factory floor — no minimums, no middlemen, no guesswork.
iconReal factory pricing, no markup in betweeniconEvery order hand-inspected before it shipsicon5,000+ new products added daily
Get Inside Access