Everful

Wholesale plastic fruit

Factory-direct selection, vetted for quality and ready to order.

Sign Up
Plastic Fruit

Find the perfect pieces: drinkware, dinnerware & tableware, kitchen tools & gadgets and more

filterShow Filters
Best Seller
New Arrivals
Price Drop
Free Shipping
Christmas Lantern LED Night Light Plastic Vintage Santa Snowman Hanging Lamp Battery Operated Home Holiday Desktop Decor
Christmas Lantern LED Night Light Plastic Vintage Santa Snowman Hanging Lamp Battery Operated Home Holiday Desktop Decor
like
Find Similar
Brown Christmas lantern featuring a Santa Claus graphic and warm LED light in snow - Santa Claus / Red Santa Claus
Pink Christmas lantern with snowman scene and warm LED candle light for desk decoration - Snowman / White Snowman
Vintage LED Christmas lantern with reindeer snow scene and warm glowing light effect - Elk Style / Brushed Gold Deer
Christmas Lantern LED Night Light Plastic Vintage Santa Snowman Hanging Lamp Battery Operated Home Holiday Desktop Decor
$1.38
No MOQ
Christmas Ball Ornaments Plastic Electroplated Glitter Patterns For Holiday Tree Hanging Festive Decorations
Christmas Ball Ornaments Plastic Electroplated Glitter Patterns For Holiday Tree Hanging Festive Decorations
like
Find Similar
9-piece 6cm Christmas ball set with red snowflake, green elk and silver spiral patterns - Style A Christmas Ball Set (9 Pcs/Box)
9-piece 6cm Christmas ball set with burgundy, champagne gold and silver glitter designs - Style B Christmas Ball Set (9 Pcs/Box)
9-piece 6cm assorted black and bronze Christmas ball ornaments set in display box - Style C Christmas Ball Set (9 Pcs/Box)
Christmas Ball Ornaments Plastic Electroplated Glitter Patterns For Holiday Tree Hanging Festive Decorations
$8.62
No MOQ
Mini Artificial Christmas Tree Flocked Snow Desktop Ornament Pine Cones Red Berries PE Plastic Wood Base Realistic Holiday Decoration
Mini Artificial Christmas Tree Flocked Snow Desktop Ornament Pine Cones Red Berries PE Plastic Wood Base Realistic Holiday Decoration
like
Find Similar
Mini desktop Christmas tree with snow-flocked needles, silver balls, and wood base, 30cm - 30CM Style B (Flocked with Silver Balls Wood Base)
Mini 36cm snow-flocked Christmas tree with red berries and pinecones in black pot - 36CM Style D (Flocked Red Berries Black Pot Base)
52cm frosted mini Christmas tree with red berries and pine cones in a black pot - 52CM Style E (Flocked Red Berries Black Pot Base)
Mini Artificial Christmas Tree Flocked Snow Desktop Ornament Pine Cones Red Berries PE Plastic Wood Base Realistic Holiday Decoration
$7.15-18.70
No MOQ
Retro Christmas Snow Globe Lantern Musical LED Water Swirling Lamp Holiday Home Decor Santa Snowman Tree Bronze Plastic
Retro Christmas Snow Globe Lantern Musical LED Water Swirling Lamp Holiday Home Decor Santa Snowman Tree Bronze Plastic
like
Find Similar
3 options
Retro Christmas Snow Globe Lantern Musical LED Water Swirling Lamp Holiday Home Decor Santa Snowman Tree Bronze Plastic
-4%
$27.38
Mix MOQ : 6
Christmas LED Road Sign Night Light Santa Stop Here North Pole Striped Plastic Battery Operated Home Table Decor
Christmas LED Road Sign Night Light Santa Stop Here North Pole Striped Plastic Battery Operated Home Table Decor
like
Find Similar
Christmas LED street sign night light featuring Santa Stop Here text with red stripes - Round Signpost / Battery Powered
LED Santa Stop Here sign lamp with red and white striped pole and stable base - Octagon Signpost / Battery Powered
Festive North Pole LED night light with red and white striped pole on a round base - NORTH POLE Signpost / Battery Powered
Christmas LED Road Sign Night Light Santa Stop Here North Pole Striped Plastic Battery Operated Home Table Decor
$4.03
No MOQ
Christmas Music Box Snow Globe Lantern LED Lighted Automatic Snowing House Ornament Resin Plastic Decor Santa Claus
Christmas Music Box Snow Globe Lantern LED Lighted Automatic Snowing House Ornament Resin Plastic Decor Santa Claus
like
Find Similar
Detailed view of a lit Christmas snow globe featuring Santa and a tree on a woven mat - Red Rocking Chair Santa
Macro shot of pink Christmas cake shop water globe music box with LED lights and snow - Pink Chef Santa
Close-up of a lit Christmas coffee house lantern with swirling snow and Santa - Dark Red Santa & Boy
Christmas Music Box Snow Globe Lantern LED Lighted Automatic Snowing House Ornament Resin Plastic Decor Santa Claus
$43.23
No MOQ
 · 
11 views
Christmas Musical Snow Globe Lantern Retro LED Light Plastic Rotating Glitter Festive Desktop Decor Holiday Gift
Christmas Musical Snow Globe Lantern Retro LED Light Plastic Rotating Glitter Festive Desktop Decor Holiday Gift
like
Find Similar
Vintage red Christmas music lantern with Santa and reindeer scenes and warm lighting - Wood Grain Red (Santa Claus)
Vintage red Christmas lantern with snowman family scene and swirling liquid glitter - Wood Grain Red (Snowman)
Vintage dark green Christmas lantern music box with snow globe and internal LED scene - Wood Grain Green (Christmas Tree)
Christmas Musical Snow Globe Lantern Retro LED Light Plastic Rotating Glitter Festive Desktop Decor Holiday Gift
-4%
$21.90
No MOQ
Retro Christmas Train Lantern LED Light Ornament Bronze Plastic Santa Reindeer Festive Desktop Decor Holiday
Retro Christmas Train Lantern LED Light Ornament Bronze Plastic Santa Reindeer Festive Desktop Decor Holiday
like
Find Similar
Christmas train lantern in bronze finish with Santa Claus illustration and warm light - Santa Claus
Bronze Christmas train lantern with elf pattern and gift box display decoration - Elf Girl Style
Vintage bronze train lantern with reindeer motif for Christmas home decoration - Elk Style
Retro Christmas Train Lantern LED Light Ornament Bronze Plastic Santa Reindeer Festive Desktop Decor Holiday
-4%
$3.83
No MOQ
Christmas Candy Ornaments Red White Striped Plastic Lollipop Candy Cane Pendants With Glitter For Xmas Tree Decor
Christmas Candy Ornaments Red White Striped Plastic Lollipop Candy Cane Pendants With Glitter For Xmas Tree Decor
like
Find Similar
Red and white Christmas candy cane and lollipop ornaments set in a gift box - Red and White Set A
Red and white Christmas candy cane ornament set with glitter finish for holiday trees - Red and White Set B
4-pack red and white glitter spiral candy cane Christmas tree ornaments in box - New Boxed Lollipops (4 Pcs)
Christmas Candy Ornaments Red White Striped Plastic Lollipop Candy Cane Pendants With Glitter For Xmas Tree Decor
$10.61-19.02
Mix MOQ : 3
Christmas Gnome Candy Jar Knitted Snowflake Hat Transparent Plastic Storage Bottle Novelty Holiday Decor
Christmas Gnome Candy Jar Knitted Snowflake Hat Transparent Plastic Storage Bottle Novelty Holiday Decor
like
Find Similar
Christmas gnome candy jar with red snowflake knitted hat and white beard in a sleigh - Red Forest Man Gnome Candy Jar / Red
Grey knitted forest gnome candy jar with snowflake hat on a red vintage truck - Grey Forest Man Gnome Candy Jar / Gray
Christmas gnome candy jar with green snowflake knit hat on a festive red iron cart - Green Forest Man Gnome Candy Jar / Green
Christmas Gnome Candy Jar Knitted Snowflake Hat Transparent Plastic Storage Bottle Novelty Holiday Decor
-5%
$1.51
No MOQ
Christmas Tree Snowflake Ornaments Glitter Plastic Sparkling Hanging Decorations For Holiday Party Winter Wonderland Theme
Christmas Tree Snowflake Ornaments Glitter Plastic Sparkling Hanging Decorations For Holiday Party Winter Wonderland Theme
like
Find Similar
Set of 6 champagne gold glitter snowflake Christmas tree ornaments measuring 10x9cm - Champagne Snowflake / 6Pcs
Set of 6 gold glitter plastic snowflake ornaments for Christmas tree decor, 10x9cm size - Gold Snowflake / 6Pcs
Set of 6 white Christmas snowflake ornaments with silver glitter and hanging strings - White Snowflake / 6Pcs
Christmas Tree Snowflake Ornaments Glitter Plastic Sparkling Hanging Decorations For Holiday Party Winter Wonderland Theme
-5%
$1.59-2.05
No MOQ
Christmas Ball Ornaments Glitter Beads Xmas Tree Hanging Decorations Champagne Gold White Plastic Foam
Christmas Ball Ornaments Glitter Beads Xmas Tree Hanging Decorations Champagne Gold White Plastic Foam
like
Find Similar
Set of 9 champagne gold 6cm Christmas ornaments with glitter patterns in gift box - 6CM/121g / Champagne Gold 6CM (Set of 9)
Set of 9 iridescent and white 8cm Christmas foam ball ornaments in a display box - 8CM/260g / White 8CM (Set of 9)
Champagne gold Christmas ball set with glitter patterns in a festive reindeer box - 8CM/260g / Champagne Gold 8CM (Set of 9)
Christmas Ball Ornaments Glitter Beads Xmas Tree Hanging Decorations Champagne Gold White Plastic Foam
-4%
$6.44-11.65
No MOQ
Mermaid Birthday Happy Birthday Banner Hanging Swirls Party Decorations Paper Plastic Watercolor Glitter Scale Sea Animal Theme
Mermaid Birthday Happy Birthday Banner Hanging Swirls Party Decorations Paper Plastic Watercolor Glitter Scale Sea Animal Theme
like
Find Similar
Mermaid happy birthday banner with sea shell and starfish design for party decoration - Mermaid Banner
Size chart for mermaid birthday banners featuring seahorse, sea turtle and starfish - Mermaid Swirls 8Pcs
Mermaid happy birthday banner set with starfish sea turtle and spiral ocean ornaments - Mermaid Banner & Swirls Set
Mermaid Birthday Happy Birthday Banner Hanging Swirls Party Decorations Paper Plastic Watercolor Glitter Scale Sea Animal Theme
-5%
$0.49-1.53
Mix MOQ : 2
Christmas Tree Hanging Ornaments Plastic Balls Champagne Rose Gold Stars Snowflakes Snowman Candy Cane Icicles Holiday Decor
Christmas Tree Hanging Ornaments Plastic Balls Champagne Rose Gold Stars Snowflakes Snowman Candy Cane Icicles Holiday Decor
like
Find Similar
Christmas hanging ornament set Style C in pink and gold featuring 29 assorted pieces - Champagne 29pcs Set (Style C)
Set of 20 rose gold Christmas ornaments in candy and star shapes with varied finishes - Champagne 20pcs Set (Gourd Style)
20-piece champagne gold Christmas ornament set with glitter snowmen and snowflakes - Champagne 20pcs Set (Candy Cane Style)
Christmas Tree Hanging Ornaments Plastic Balls Champagne Rose Gold Stars Snowflakes Snowman Candy Cane Icicles Holiday Decor
$4.47-7.35
No MOQ
Christmas Bell Hanging Ornaments Merry Christmas Letter Plate Plastic Metal Bells Holiday Tree Home Decor
Christmas Bell Hanging Ornaments Merry Christmas Letter Plate Plastic Metal Bells Holiday Tree Home Decor
like
Find Similar
Red glitter Christmas bells with golden Merry Christmas sign and small bell accents - 15 Letters Hanging 4.5 Ingot Bell / Red
Golden Merry Christmas bells with red trees and sequins for holiday hanging decoration - 15 Letters Hanging 4.5 Ingot Bell / Gold
Blue glitter Christmas tree hanging ornament with silver bells and snowflakes - 15 Letters Hanging 4.5 Ingot Bell / Silver
Christmas Bell Hanging Ornaments Merry Christmas Letter Plate Plastic Metal Bells Holiday Tree Home Decor
-4%
$0.77
No MOQ
Butterfly Earring Display Rack Plastic Multi-Hole Jewelry Organizer Stand Desktop Creative Decorative Holder
Butterfly Earring Display Rack Plastic Multi-Hole Jewelry Organizer Stand Desktop Creative Decorative Holder
like
Find Similar
Black butterfly jewelry stand for earrings and necklaces on green and pink background - Black
Transparent acrylic butterfly jewelry stand for displaying earrings and necklaces - Clear
Sapphire blue butterfly jewelry stand with black base for earring and necklace storage - Blue
Butterfly Earring Display Rack Plastic Multi-Hole Jewelry Organizer Stand Desktop Creative Decorative Holder
-5%
$1.07
No MOQ
 · 
11 views
Striped Christmas Tree Ornaments Finial Drop Glitter Shatterproof Plastic Electroplated Holiday Decorative Pendants For Party Home Decor
Striped Christmas Tree Ornaments Finial Drop Glitter Shatterproof Plastic Electroplated Holiday Decorative Pendants For Party Home Decor
like
Find Similar
Golden gourd Christmas ornament with white frosted stripes and 12.9cm height specifications - Gourd Shape / Gold
Red and white striped gourd Christmas ornament in glossy finish, 12.9cm tall decoration - Gourd Shape / Red
Silver gourd Christmas tree pendant with glitter detail and 12.9cm height - Gourd Shape / Silver
Striped Christmas Tree Ornaments Finial Drop Glitter Shatterproof Plastic Electroplated Holiday Decorative Pendants For Party Home Decor
$1.87
No MOQ
Christmas Ball Ornaments Plastic Painted Star Snow Forest Patterns Hanging Tree Holiday Party Decorations
Christmas Ball Ornaments Plastic Painted Star Snow Forest Patterns Hanging Tree Holiday Party Decorations
like
Find Similar
Detailed view of 6cm transparent Christmas ornaments with white forest patterns on wood - 6cm/Set of 6 / Transparent / Snow Forest
Set of 6 clear 8cm Christmas balls with white forest snowy landscape patterns - 8cm/Set of 6 / Transparent / Snow Forest
Detail of 8cm Christmas ornaments with painted stars on red and gold festive balls - 8cm/Set of 6 / Red / Shiny & Matte Star
Close-up of 8cm gold painted Christmas balls with star patterns on pine branches - 8cm/Set of 6 / Gold / Shiny & Matte Star
+1
NewChristmas Ball Ornaments Plastic Painted Star Snow Forest Patterns Hanging Tree Holiday Party Decorations
-5%
$2.16-2.96
No MOQ
Christmas Tree Ornaments Painted Glitter Plastic Hanging Pendant Snowflake Icicle Holiday Party Home Decor Mixed Styles
Christmas Tree Ornaments Painted Glitter Plastic Hanging Pendant Snowflake Icicle Holiday Party Home Decor Mixed Styles
like
Find Similar
Pink Christmas ball ornament set with glitters and snowflake pendants in 330g box - Pink
Red Christmas ball ornament set with snowflakes and spirals in a grid box - Red
Ice blue Christmas ornament set with snowflakes, icicles and matte balls in 44 pieces - Blue
Silver assorted Christmas ornament set with glossy, matte and snowflake shaped baubles - Gray
+1
NewChristmas Tree Ornaments Painted Glitter Plastic Hanging Pendant Snowflake Icicle Holiday Party Home Decor Mixed Styles
$8.07
No MOQ
Christmas Ball Ornaments Plastic Foam Glitter Faux Artificial Pearls Hanging Xmas Tree Decorations Festive Elegant Spiral Design
Christmas Ball Ornaments Plastic Foam Glitter Faux Artificial Pearls Hanging Xmas Tree Decorations Festive Elegant Spiral Design
like
Find Similar
White 8cm Christmas ball ornament with glitter texture and pearl beads on tree - White
Pink Christmas foam ball with sequins and white pearls hanging on a tree branch - Pink
8cm red Christmas ball ornament with white pearls and glitter for tree decoration - Red
Light blue 8cm Christmas ball ornament with blue glitter, white lace, and pearls - Blue
+1
Christmas Ball Ornaments Plastic Foam Glitter Faux Artificial Pearls Hanging Xmas Tree Decorations Festive Elegant Spiral Design
$1.10
No MOQ
Christmas Tree Hanging Ornaments Plastic Painted Hot Air Balloon And Large Baubles Sequins Glitter Holiday Party Decor
Christmas Tree Hanging Ornaments Plastic Painted Hot Air Balloon And Large Baubles Sequins Glitter Holiday Party Decor
like
Find Similar
Red 13cm ribbed Christmas ball with gold glitter band and snowflake metal cap ornament - 13cm Red Big Ball
Hot air balloon Christmas ornament in champagne gold with sequins and ribbon bow - 12cm Champagne Gold Balloon
15cm champagne and silver glitter hot air balloon Christmas ornament with bow detail - 15cm Champagne Gold Balloon
Hot air balloon Christmas ornament in burgundy lacquer with silver glitter and sequins - 12cm Wine Red Balloon
+1
Christmas Tree Hanging Ornaments Plastic Painted Hot Air Balloon And Large Baubles Sequins Glitter Holiday Party Decor
$4.27-7.15
No MOQ
Christmas Snowflake Hanging Ornaments Glitter Plastic Sparkling Tree Decorations For Holiday Party Home Decor
Christmas Snowflake Hanging Ornaments Glitter Plastic Sparkling Tree Decorations For Holiday Party Home Decor
like
Find Similar
Pack of 6 red glitter snowflake ornaments in a transparent gift box with gold strings - Red Snowflake (Pack Of 6)
6-pack of 11cm sparkling gold plastic snowflake ornaments in a transparent box - Champagne Snowflake (Pack Of 6)
Set of 6 white glitter snowflake ornaments in a plastic box with silver hanging strings - White Snowflake (Pack Of 6)
Pink glitter snowflake ornaments set of 6 in plastic box for Christmas tree decor - Pink Snowflake (Pack Of 6)
+1
Christmas Snowflake Hanging Ornaments Glitter Plastic Sparkling Tree Decorations For Holiday Party Home Decor
$3.69
No MOQ
Sparkling Christmas Tree Decoration Picks Glitter Spiral Branches For Holiday Home Party Floral Fireworks Shape Plastic
Sparkling Christmas Tree Decoration Picks Glitter Spiral Branches For Holiday Home Party Floral Fireworks Shape Plastic
like
Find Similar
Red plush pom-pom festive branch spray with sparkling details, 53cm long decorative stem - Red
Golden Christmas glitter spray branch with three fluffy heads and spiral decorative stems - Gold
53cm white glitter artificial Christmas branch with three fluffy pompom flower heads - White
Golden glitter Christmas picks with firework tassel design for festive tree decoration - Champagne
+1
Sparkling Christmas Tree Decoration Picks Glitter Spiral Branches For Holiday Home Party Floral Fireworks Shape Plastic
$2.54
No MOQ
Artificial Berry Branches Foam Plastic Realistic Decorative Stems For Home Vase DIY Christmas Holiday Crafts
Artificial Berry Branches Foam Plastic Realistic Decorative Stems For Home Vase DIY Christmas Holiday Crafts
like
Find Similar
Artificial red berry branch with green leaves on white textured background for DIY decor - Red Berry Branch
Artificial blueberry branch with dark blue berries and realistic green leaves - Blue Berry Branch
Three pieces of decorative white berries with green leaves and realistic stems on wooden surface - White Berry Branch
Artificial plant branch with red and white berries and green leaves for DIY decor - Pink-White Berry Branch
+1
Artificial Berry Branches Foam Plastic Realistic Decorative Stems For Home Vase DIY Christmas Holiday Crafts
$0.45
Mix MOQ : 2
Artificial Daisy Satin Flower Wreath Garland And Vine Plastic Eucalyptus Plant For Wedding Arch Desktop Home Decor Romantic Style
Artificial Daisy Satin Flower Wreath Garland And Vine Plastic Eucalyptus Plant For Wedding Arch Desktop Home Decor Romantic Style
like
Find Similar
Detailed view of artificial light blue daisy vine with lush green leaves on white background - 115cm Blue Artificial Flower Long Vine
Detail view of Easter daisy candle ring wreath with 15cm inner and 35cm outer diameter - Blue Artificial Flower Wreath
Detailed view of pink floral wreath dimensions with 11cm inner and 32cm outer diameter - Pink Artificial Flower Wreath
Detail of faux yellow daisies and eucalyptus garland held against a white wall - Yellow Daisy Eucalyptus Candle Ring
+1
Artificial Daisy Satin Flower Wreath Garland And Vine Plastic Eucalyptus Plant For Wedding Arch Desktop Home Decor Romantic Style
$1.90-9.80
No MOQ
Modern Round Wall Clock Plastic Quartz Movement Silent Battery Operated Minimalist For Living Room Bedroom Office Decor
Modern Round Wall Clock Plastic Quartz Movement Silent Battery Operated Minimalist For Living Room Bedroom Office Decor
like
Find Similar
Minimalist 10-inch white round wall clock with Arabic numerals and quartz movement - White
Classic 10-inch round wall clock featuring a bright red frame and white dial face - Red
10 inch light blue wall clock with white dial and clear Arabic numerals for home - Blue
Minimalist 10 inch round black plastic wall clock with white dial and quartz movement - Black
+1
Modern Round Wall Clock Plastic Quartz Movement Silent Battery Operated Minimalist For Living Room Bedroom Office Decor
$3.11
Mix MOQ : 2
Round Wall Clock Quartz Movement Minimalist Analog Silent For Home Office Bedroom Living Room Plastic Frame
Round Wall Clock Quartz Movement Minimalist Analog Silent For Home Office Bedroom Living Room Plastic Frame
like
Find Similar
Minimalist 10-inch white round wall clock with Arabic numerals and quartz movement - White
Classic 10-inch round wall clock featuring a bright red frame and white dial face - Red
10 inch light blue wall clock with white dial and clear Arabic numerals for home - Blue
Minimalist 10 inch round black plastic wall clock with white dial and quartz movement - Black
+1
Round Wall Clock Quartz Movement Minimalist Analog Silent For Home Office Bedroom Living Room Plastic Frame
$3.11
Mix MOQ : 2
Round Wall Clock Quartz Minimalist Analogue Plastic Silent Battery Operated Home Decor For Bedroom Living Room Kitchen Office
Round Wall Clock Quartz Minimalist Analogue Plastic Silent Battery Operated Home Decor For Bedroom Living Room Kitchen Office
like
Find Similar
Classic 10-inch round wall clock featuring a bright red frame and white dial face - Red
Minimalist 10-inch light blue round plastic wall clock with white quartz dial - Blue
Minimalist 10 inch round black plastic wall clock with white dial and quartz movement - Black
Classic 10-inch white plastic wall clock with black numerals and quartz movement - White
+1
Round Wall Clock Quartz Minimalist Analogue Plastic Silent Battery Operated Home Decor For Bedroom Living Room Kitchen Office
$3.17
Mix MOQ : 2
Round Wall Clock Quartz Silent Non Ticking Plastic Frame Home Decor Large Arabic Numerals For Living Room Bedroom Office
Round Wall Clock Quartz Silent Non Ticking Plastic Frame Home Decor Large Arabic Numerals For Living Room Bedroom Office
like
Find Similar
Minimalist white 12-inch plastic silent wall clock with black Arabic numerals and quartz movement - White
Modern 12-inch silent wall clock with a red frame and large 3D Arabic numerals for living room - Red
12-inch silent green wall clock with 3D black numbers and quartz movement mechanism - Green
12-inch blue silent wall clock with a modern round plastic frame and white quartz dial - Blue
+1
Round Wall Clock Quartz Silent Non Ticking Plastic Frame Home Decor Large Arabic Numerals For Living Room Bedroom Office
$4.55
Mix MOQ : 2
Christmas Ball Ornaments Plastic Electroplated Painted Hanging Pendants For Holiday Tree Decor Assorted Shapes Mixed Colors
Christmas Ball Ornaments Plastic Electroplated Painted Hanging Pendants For Holiday Tree Decor Assorted Shapes Mixed Colors
like
Find Similar
60pcs vintage blue-green Christmas ball set with stars and train ornaments in display box - 60pcs Christmas Ball Box Set / Ice Blue
60pcs Red and Gold Christmas Ornament Set with Baubles and Trains in a Gift Box - 60pcs Christmas Ball Box Set / Red
60pcs Christmas ball set in rose gold and champagne colors with diverse shapes in gift box - 60pcs Christmas Ball Box Set / Rose Gold
Set of 60 champagne gold Christmas ornaments including painted balls and train shapes - 60pcs Christmas Ball Box Set / Champagne Gold
+1
Christmas Ball Ornaments Plastic Electroplated Painted Hanging Pendants For Holiday Tree Decor Assorted Shapes Mixed Colors
-5%
$12.81
Mix MOQ : 2
Luxury Silk Thread Texture Rhinestone Christmas Balls Plastic Glitter Baubles For Christmas Tree Home Decor Decoration
Luxury Silk Thread Texture Rhinestone Christmas Balls Plastic Glitter Baubles For Christmas Tree Home Decor Decoration
like
Find Similar
12-pack navy blue silk texture Christmas balls with sparkling sequins in 24x18x6cm box - Silk Thread Ball / Set of 12 / Navy Blue
12-pack white Christmas balls with gold glitter stripes and sequins in a display box - Silk Thread Ball / Set of 12 / White
Set of 12 red Christmas balls with silk texture and glitter in a clear storage box - Silk Thread Ball / Set of 12 / Red
Set of 12 luxury silver Christmas ornaments with sequins and silk texture in box - Silk Thread Ball / Set of 12 / Silver Gray
+1
Luxury Silk Thread Texture Rhinestone Christmas Balls Plastic Glitter Baubles For Christmas Tree Home Decor Decoration
-4%
$5.48
No MOQ
Christmas Baubles Ornaments Plastic Electroplated Sparkling Sequin Hanging Holiday Tree Decorative Festive Home Interior
Christmas Baubles Ornaments Plastic Electroplated Sparkling Sequin Hanging Holiday Tree Decorative Festive Home Interior
like
Find Similar
Christmas ball ornament set featuring 12 pieces of pink and white glitter foam spheres - Pink
Set of 12 red and white electroplated Christmas ball ornaments in a clear gift box - Red
Set of 12 blue and white glitter Christmas ornaments with snowflake gift box packaging - Lake Blue
Christmas ball ornament set with 12 gold and white glitter baubles in a clear gift box - Gold
+1
Christmas Baubles Ornaments Plastic Electroplated Sparkling Sequin Hanging Holiday Tree Decorative Festive Home Interior
-4%
$4.33
No MOQ
Christmas Tree Ornaments Hanging Baubles Red Green Gold Plastic Glitter Reindeer Star Topper Holiday Party Home Decor
Christmas Tree Ornaments Hanging Baubles Red Green Gold Plastic Glitter Reindeer Star Topper Holiday Party Home Decor
like
Find Similar
Three colorful reindeer Christmas tree ornaments in red green and champagne gold finish - Red/Green Reindeer 3Pcs
6-pack of red green and gold Christmas balls in a transparent gift box for tree decor - Red/Green 8cm Balls 6Pcs
Christmas tree ornaments set in red, green, and gold with various festive shapes - Red/Green Set 32Pcs
Colorful Christmas ball set with red tree star in various matte and glossy finishes - Red/Green Set 50Pcs
+1
Christmas Tree Ornaments Hanging Baubles Red Green Gold Plastic Glitter Reindeer Star Topper Holiday Party Home Decor
$1.87-10.06
No MOQ
Christmas Tree Decoration Balls Plastic Mesh Tinsel Holiday Hanging Ornaments Home Party Decor Transparent Colorful
Christmas Tree Decoration Balls Plastic Mesh Tinsel Holiday Hanging Ornaments Home Party Decor Transparent Colorful
like
Find Similar
6-piece set of 8cm clear Christmas ornaments with pink tulle and aurora flake fillings - 8cm/Set of 6 / Pink Mesh Color Strip
Christmas clear hanging ornaments with gold stars and glitter in 6-piece gift box set - 8cm/Set of 6 / White Mesh Color Strip
12-piece Christmas ball set with white mesh dots and colorful laser sequins design - 6cm/12Pcs / Polka Dot Mesh Color Strip
12pcs Christmas tree ornaments set with white lattice and laser transparent globes - 6cm/12Pcs / Plaid Cloth Wrap Color Strip
+1
Christmas Tree Decoration Balls Plastic Mesh Tinsel Holiday Hanging Ornaments Home Party Decor Transparent Colorful
-4%
$6.44-7.13
No MOQ
Christmas Balls Hanging Ornaments Plastic Glitter Burlap Lace Painted Snowflake Reindeer Xmas Tree Decoration
Christmas Balls Hanging Ornaments Plastic Glitter Burlap Lace Painted Snowflake Reindeer Xmas Tree Decoration
like
Find Similar
Set of 9 Christmas ornaments 8cm featuring linen straps and white painted wave patterns - White Stripe Hemp Rope Foam Style (4926961197846)
Set of 9 assorted 8cm Christmas balls with lace and burlap details in a gift box - Hemp Knit Mixed Natural Style (5634299601598)
Detailed view of 8cm Christmas ball ornaments in a kraft box with festive decor - Hemp Lace Reindeer Clear Style (5634299601599)
Set of 9 gold Christmas ornaments with snowflake and stripe details in a 24cm display box - Gold Sequin Bead Painted Style (5634299601600)
+1
Christmas Balls Hanging Ornaments Plastic Glitter Burlap Lace Painted Snowflake Reindeer Xmas Tree Decoration
-4%
$5.75
Mix MOQ : 2
Christmas Headband Reindeer Antlers Santa Snowman Fabric Plastic Pompom Festive Party Hair Accessories Cartoon Style
Christmas Headband Reindeer Antlers Santa Snowman Fabric Plastic Pompom Festive Party Hair Accessories Cartoon Style
like
Find Similar
Christmas headband featuring red reindeer antlers and mini Santa Claus figures - Antler Gnome
Christmas reindeer antler headband with cartoon deer, green pom-poms, and festive lettering - Antler Reindeer
Christmas headband with red reindeer antlers, golden glitter ears and fuzzy pom poms - Antler Mushroom
Christmas headband with brown reindeer antlers, gold glitter ears and red plush balls - Antler Pompom
+1
Christmas Headband Reindeer Antlers Santa Snowman Fabric Plastic Pompom Festive Party Hair Accessories Cartoon Style
-5%
$0.66-0.74
Mix MOQ : 2
Realistic Santa Claus Figurine Plush Fabric And Plastic Standing Father Christmas Tabletop Ornament Festive Decor
Realistic Santa Claus Figurine Plush Fabric And Plastic Standing Father Christmas Tabletop Ornament Festive Decor
like
Find Similar
30cm Christmas Santa gnome ornament in red knit hat with plush trim and sack - Style A Santa Claus / Small (30cm)
50cm Santa Claus figurine in grey fur coat holding a lantern and rustic gift bag - Style B Santa Claus / Large (50cm)
Classic 30cm Santa Claus doll with red hat and gift bag for Christmas decoration - Style C Santa Claus / Small (30cm)
50cm standing Nordic Santa Claus figurine in grey and brown attire for Christmas decor - Style D Santa Claus / Large (50cm)
+1
Realistic Santa Claus Figurine Plush Fabric And Plastic Standing Father Christmas Tabletop Ornament Festive Decor
$17.00-25.65
No MOQ
Mini Christmas Tree Plastic Sisal Wood Base Snow Covered Frosted Colorful Micro Landscape Desktop Home Decoration DIY
Mini Christmas Tree Plastic Sisal Wood Base Snow Covered Frosted Colorful Micro Landscape Desktop Home Decoration DIY
like
Find Similar
7cm mini blue-green sisal Christmas tree with snow frosting and round wooden base - Blue Tree with Wood Base - 7cm
Blue-green 9cm miniature Christmas snow tree with white frost and wood base - Blue Tree with Wood Base - 9cm
Miniature white frosted Christmas tree with natural wood base and 7cm height marker - Glitter White Tree - 7cm
6cm miniature frosted Christmas tree with green pine needles and natural wooden base - Layered Deep Green Tree - 6cm
+1
Mini Christmas Tree Plastic Sisal Wood Base Snow Covered Frosted Colorful Micro Landscape Desktop Home Decoration DIY
$0.09-0.20
Mix MOQ : 2
Christmas Ball Ornaments Plastic Shiny Matte Glitter Hollow Carved Hanging Decorative Baubles For Xmas Tree Holiday Decor
Christmas Ball Ornaments Plastic Shiny Matte Glitter Hollow Carved Hanging Decorative Baubles For Xmas Tree Holiday Decor
like
Find Similar
24-piece set of blue and white 4cm Christmas balls with glitter and matte finishes - Style 3-Blue/White (4cm)
Set of 24 bronze and white 4cm Christmas balls with glitter and matte finishes - Style 4-Coffee/White (4cm)
Set of 24 rose gold and white 6cm Christmas balls in clear barrel packaging - Style 11-Rose Gold/White (6cm)
Brown and white Christmas ball set with glitter and matte finish in clear tube packaging - Style 12-Brown/White (6cm)
+1
Christmas Ball Ornaments Plastic Shiny Matte Glitter Hollow Carved Hanging Decorative Baubles For Xmas Tree Holiday Decor
$4.50-8.30
No MOQ
Christmas Reindeer Baubles Ornaments Plastic Electroplated Glitter Elk Hanging Decorations Festive Home Party Tree Decor
Christmas Reindeer Baubles Ornaments Plastic Electroplated Glitter Elk Hanging Decorations Festive Home Party Tree Decor
like
Find Similar
Set of 2 bright red reindeer Christmas ball ornaments hanging on a snowy pine branch - Red Little Deer (2 Pcs) / 8x5cm/17.5g
Golden Christmas reindeer ornament with red glitter antlers hanging on pine branch - Champagne Little Deer (2 Pcs) / 8x5cm/17.5g
Set of 2 rose gold Christmas elk ornaments for tree decoration, 11x5.5cm hanging reindeer - Champagne Reindeer (2 Pcs) / 11x5.5cm/24.7g
Set of 2 shiny red reindeer Christmas tree ornaments with silver antlers and snowy background - Red Reindeer (2 Pcs) / 11x5.5cm/24.7g
+1
Christmas Reindeer Baubles Ornaments Plastic Electroplated Glitter Elk Hanging Decorations Festive Home Party Tree Decor
-5%
$2.41-2.68
No MOQ
Transparent Christmas Ornaments Hanging Pendants Plastic Acrylic Spiral Icicles Stars Snowflakes For Tree Decoration
Transparent Christmas Ornaments Hanging Pendants Plastic Acrylic Spiral Icicles Stars Snowflakes For Tree Decoration
like
Find Similar
Set of 12 clear twisted icicle ornaments for Christmas tree decoration 13cm length - 13CM 12PCS Transparent Icicle
Set of 6 transparent 15cm icicle hanging ornaments for Christmas tree decor - 15CM 6PCS Transparent Icicle
Set of 3 transparent acrylic 10cm snowflake ornaments with ropes for Christmas trees - 10CM 3PCS Transparent Leaf Snowflake
Set of six 14cm clear spiral icicle ornaments with hanging strings for Christmas decor - 14CM 6PCS Transparent Spiral Wind Roll
+1
Transparent Christmas Ornaments Hanging Pendants Plastic Acrylic Spiral Icicles Stars Snowflakes For Tree Decoration
$0.53-0.94
Mix MOQ : 2
Flocked Velvet Christmas Ball Ornaments PET Plastic Hanging Baubles For Holiday Xmas Tree Decorations
Flocked Velvet Christmas Ball Ornaments PET Plastic Hanging Baubles For Holiday Xmas Tree Decorations
like
Find Similar
Set of 12 velvet flocked 6cm Christmas ball ornaments in assorted festive colors - Style 1 (White Blue Khaki Green)
12-pack of 6cm flocked Christmas balls in dark brown and gold velvet texture - Style 2 (Dark Brown Khaki)
Set of 12 flocked and matte Christmas balls in assorted pink shades for tree decor - Style 3 (Rose Red Pink White)
Set of 12 flocked Christmas balls in dark green, cream white, and brown with hanging loops - Style 4 (Green Rice White Dark Brown)
+1
Flocked Velvet Christmas Ball Ornaments PET Plastic Hanging Baubles For Holiday Xmas Tree Decorations
$4.27
No MOQ
 · 
22 views
Christmas Glitter Sequin Headband Thin Plastic Resin Hair Hoop Holiday Party Decoration Accessory For Women Girls
Christmas Glitter Sequin Headband Thin Plastic Resin Hair Hoop Holiday Party Decoration Accessory For Women Girls
like
Find Similar
Sparkly red glitter headband with sequins for Christmas and festive hair accessories - Red
Sparkly green glitter headband for women featuring a thin flexible frame and sequin finish - Green
Sparkly silver glitter thin headband with black protective tips for women - Silver
Christmas glitter hair hoop with green and red sequins on thin metal headband accessory - Green & Red
+1
Christmas Glitter Sequin Headband Thin Plastic Resin Hair Hoop Holiday Party Decoration Accessory For Women Girls
-6%
$0.30
Mix MOQ : 2
 · 
73 sold recently
Christmas Balls Baubles Ornaments Plastic Foam Satin Thread Glitter Painted Transparent Festive Home Holiday Tree Decor
Christmas Balls Baubles Ornaments Plastic Foam Satin Thread Glitter Painted Transparent Festive Home Holiday Tree Decor
like
Find Similar
9-piece set of 8cm red Christmas balls with stripes and star sequins in a gift box - 8CM/9pcs / Red
Set of 9 champagne Christmas baubles with gold glitter and beads in a gift box - 8CM/9pcs / Champagne
Set of 9 silver Christmas balls with sequins and bead patterns in a clear display box - 8CM/9pcs / Silver
Set of 9 Christmas balls in navy blue, gold, and transparent with glitter in a white box - 8CM/9pcs / Blue
+1
Christmas Balls Baubles Ornaments Plastic Foam Satin Thread Glitter Painted Transparent Festive Home Holiday Tree Decor
-4%
$5.48
No MOQ
Christmas Train Snow Globe Water Lamp LED Glowing Musical Desktop Ornament Santa Snowman Plastic Holiday Decor Vintage
Christmas Train Snow Globe Water Lamp LED Glowing Musical Desktop Ornament Santa Snowman Plastic Holiday Decor Vintage
like
Find Similar
Macro view of vintage Christmas train light with Santa and snowman scene inside - Bronze
Christmas lighted musical water train decoration music box on snowy background - Red and Green Painted
Christmas Train Snow Globe Water Lamp LED Glowing Musical Desktop Ornament Santa Snowman Plastic Holiday Decor Vintage
$43.23-48.99
No MOQ
Luminous Christmas Tree Desktop Ornament Transparent Plastic Star Top LED Light Up Festival Home Table Decor Decoration
Luminous Christmas Tree Desktop Ornament Transparent Plastic Star Top LED Light Up Festival Home Table Decor Decoration
like
Find Similar
Luminous crystal Christmas tree night light with golden gift box base and warm glow - Gold Gift Box Base Style
Luminous crystal-style mini Christmas tree with warm light and silver base, height 10.8cm - Silver Gift Box Base Style
Luminous Christmas Tree Desktop Ornament Transparent Plastic Star Top LED Light Up Festival Home Table Decor Decoration
$2.02
No MOQ
Christmas Tree Bead Garland Artificial Pearl Plastic Chain Festive Holiday Party Decoration Hanging Ornament
Christmas Tree Bead Garland Artificial Pearl Plastic Chain Festive Holiday Party Decoration Hanging Ornament
like
Find Similar
2m white pearl bead string chain with 8mm and 3mm beads for DIY Christmas tree decoration - 2m Bead String / White
Golden and white 2m beaded pearl chain with 8mm and 3mm beads for Christmas decor - 2m Bead String / Gold
Christmas Tree Bead Garland Artificial Pearl Plastic Chain Festive Holiday Party Decoration Hanging Ornament
$2.56
No MOQ
 · 
11 views
Led Christmas Tree Desktop Ornaments Glass Plastic Colorful Sequins Frosted Glowing Warm Light Holiday Table Decor Gift
Led Christmas Tree Desktop Ornaments Glass Plastic Colorful Sequins Frosted Glowing Warm Light Holiday Table Decor Gift
like
Find Similar
Luminous glass Christmas tree with colorful sequins and warm LED lights for tabletop decor - Tree Tower / 23CM (With Battery) / Multicolor Sequins
Frosted white Christmas tree lamp with colorful sequins and star topper, warm LED glow - Star Tree Lamp / 17.5CM (With Battery) / Colorful Sparkling White
Led Christmas Tree Desktop Ornaments Glass Plastic Colorful Sequins Frosted Glowing Warm Light Holiday Table Decor Gift
$2.88-3.75
Mix MOQ : 10
Christmas Snow Globe Lantern LED Lighted Swirling Glitter Plastic Resin Musical Xmas Home Decor Gift USB Battery Operated
Christmas Snow Globe Lantern LED Lighted Swirling Glitter Plastic Resin Musical Xmas Home Decor Gift USB Battery Operated
like
Find Similar
Bronze Christmas lantern with Santa, reindeer and swirling snow on a wooden table - Santa & Reindeer
Vintage bronze Christmas lantern with kids, snowman miniature and swirling glitter snow - Snowman and Boy
Christmas Snow Globe Lantern LED Lighted Swirling Glitter Plastic Resin Musical Xmas Home Decor Gift USB Battery Operated
$28.24
No MOQ
Chef Santa Claus Figurine Christmas Decoration Fabric Plastic Red White Plaid Apron Welcome Sign For Tabletop Holiday
Chef Santa Claus Figurine Christmas Decoration Fabric Plastic Red White Plaid Apron Welcome Sign For Tabletop Holiday
like
Find Similar
60cm Santa Claus chef figure in red checkered shirt with Welcome sign and white apron - Large (Standing)
Chef Santa Claus figurine in red checkered outfit with Merry Christmas apron and welcome sign - Sitting Posture
Chef Santa Claus Figurine Christmas Decoration Fabric Plastic Red White Plaid Apron Welcome Sign For Tabletop Holiday
$14.06-34.24
No MOQ
Free Shipping
Retro Christmas Church Lantern LED Night Light Plastic Bronze Glitter Snow Globe Santa Snowman Desktop Decor Gift
Retro Christmas Church Lantern LED Night Light Plastic Bronze Glitter Snow Globe Santa Snowman Desktop Decor Gift
like
Find Similar
Bronze church-style Christmas lantern with warm LED lights and angel snow globe scene - Water Church-Angel
Retro Christmas Church Lantern LED Night Light Plastic Bronze Glitter Snow Globe Santa Snowman Desktop Decor Gift
$2.88-3.46
Mix MOQ : 2
Christmas Church Snow Globe Lantern LED Lighted Nativity Angel Scene Plastic Resin Glitter Water Holiday Desktop Ornament
Christmas Church Snow Globe Lantern LED Lighted Nativity Angel Scene Plastic Resin Glitter Water Holiday Desktop Ornament
like
Find Similar
White church Christmas snow globe with internal angel figure and warm glowing LED light - White Church (Angel)
Golden church snow globe lantern with nativity scene and LED light, 21.5cm height - Golden Church (Nativity Scene)
Christmas Church Snow Globe Lantern LED Lighted Nativity Angel Scene Plastic Resin Glitter Water Holiday Desktop Ornament
-4%
$5.75
Mix MOQ : 2
Christmas Tree Baubles Ornaments PET Plastic Glitter Painted Decorative Hanging Balls For Holiday Home Party Decor
Christmas Tree Baubles Ornaments PET Plastic Glitter Painted Decorative Hanging Balls For Holiday Home Party Decor
like
Find Similar
Set of 9 white 8cm Christmas balls with glitter patterns in a 9-grid box - 8cm / White Set (9 Pieces)
Set of 9 elegant 8cm transparent Christmas balls with gold glitter grid patterns in a box - 8cm / Champagne Set (9 Pieces)
Christmas Tree Baubles Ornaments PET Plastic Glitter Painted Decorative Hanging Balls For Holiday Home Party Decor
-4%
$11.50
Mix MOQ : 2
Christmas Hanging Balls Ornaments Painted Plastic Glitter Baubles Tree Decoration Red Green White Holiday Party Decor
Christmas Hanging Balls Ornaments Painted Plastic Glitter Baubles Tree Decoration Red Green White Holiday Party Decor
like
Find Similar
Red and green 6cm Christmas balls with snowflake patterns and Merry Christmas text - Lettering Snowflakes Stripes Style / Grass Green Painted
6cm red, white and green Christmas ball ornaments with colorful sequins in 6-pack box - Classic Polka Dot Style / Red Green White Polka Dots
Christmas Hanging Balls Ornaments Painted Plastic Glitter Baubles Tree Decoration Red Green White Holiday Party Decor
$1.73
No MOQ
Shatterproof Plastic Christmas Baubles Set Shiny Matte Glitter Finishes Electroplated Christmas Tree Hanging Ornaments For Festival Party Home Decor Christmas Balls Decorations
Shatterproof Plastic Christmas Baubles Set Shiny Matte Glitter Finishes Electroplated Christmas Tree Hanging Ornaments For Festival Party Home Decor Christmas Balls Decorations
like
Find Similar
Set of 24 pink 6cm Christmas balls with glossy and matte finishes in a clear tube - 8cm 24Pcs / Pink
24-piece 8cm bronze Christmas ball set with glossy, matte and glitter finishes - 8cm 24Pcs / Bronze
Set of 24 red Christmas balls with 8cm diameter in shiny, matte, and glitter finishes - 8cm 24Pcs / Red
24-piece 8cm golden Christmas ornaments set featuring glossy matte and glitter finishes - 8cm 24Pcs / Gold
+6
Shatterproof Plastic Christmas Baubles Set Shiny Matte Glitter Finishes Electroplated Christmas Tree Hanging Ornaments For Festival Party Home Decor Christmas Balls Decorations
-4%
$5.73
Mix MOQ : 2
Graduation Money Pull Surprise Gift Kit Black Gold Cardboard Case With Mortarboard Topper Plastic Bags Party Decor
Graduation Money Pull Surprise Gift Kit Black Gold Cardboard Case With Mortarboard Topper Plastic Bags Party Decor
like
Find Similar
Graduation money pull box kit with 1 congrats grad box, 30 bags and a topper sign - Black Gold Graduation Money Pulling Set(L-00266-1) / Box, Card And Bags
Graduation Money Pull Surprise Gift Kit Black Gold Cardboard Case With Mortarboard Topper Plastic Bags Party Decor
-4%
$1.78
Mix MOQ : 30
Regardless Of Age Happiness Text Shaped Silicone Cake Mold For DIY Chocolate Fondant Baking Decorative Tool Kitchen Accessories
Regardless Of Age Happiness Text Shaped Silicone Cake Mold For DIY Chocolate Fondant Baking Decorative Tool Kitchen Accessories
like
Find Similar
Pink silicone mold for Chinese character cake fondant and chocolate baking decoration - Regardless Of Age Happiness Text (QH6552)
Regardless Of Age Happiness Text Shaped Silicone Cake Mold For DIY Chocolate Fondant Baking Decorative Tool Kitchen Accessories
$1.16
Mix MOQ : 2
Electroplated Plastic Glitter Pentagram Christmas Tree Topper Star Ornament Holiday Party Home Decoration Five-Pointed Star
Electroplated Plastic Glitter Pentagram Christmas Tree Topper Star Ornament Holiday Party Home Decoration Five-Pointed Star
like
Find Similar
Golden plated star Christmas ornament with glitter details, size 12.5x13x3cm - Gold
Silver star Christmas ornament with glitter star pattern and size dimensions in 13cm - Silver
Red star Christmas ornament with gold glitter details, sized 13cm for holiday tree decor - Red
Blue electroplated star Christmas tree topper with silver glitter patterns, 13cm size - Blue
+2
Electroplated Plastic Glitter Pentagram Christmas Tree Topper Star Ornament Holiday Party Home Decoration Five-Pointed Star
-5%
$1.37-1.51
No MOQ
Plastic Christmas Tree Hanging Ornaments Assorted Shapes Balls Boots Stockings Stars Glitter Electroplated Festive Home Decor
Plastic Christmas Tree Hanging Ornaments Assorted Shapes Balls Boots Stockings Stars Glitter Electroplated Festive Home Decor
like
Find Similar
Blue-green Christmas ornament set with glitter boots and matte finish spheres - Teal Blue
21pcs red assorted Christmas ornaments set with baubles and pinecones in snow tray - Red
Set of assorted gold Christmas ornaments in shiny and matte finishes on snow tray - Gold
Royal blue Christmas ornament set with glittery pinecones and snow-textured boots - Blue
+2
NewPlastic Christmas Tree Hanging Ornaments Assorted Shapes Balls Boots Stockings Stars Glitter Electroplated Festive Home Decor
$6.92
No MOQ
Christmas Candy Jar Star Round Transparent Plastic Storage Box Santa Snowman Reindeer Plush Doll For Xmas Party Table Decor
Christmas Candy Jar Star Round Transparent Plastic Storage Box Santa Snowman Reindeer Plush Doll For Xmas Party Table Decor
like
Find Similar
6 options
Christmas Candy Jar Star Round Transparent Plastic Storage Box Santa Snowman Reindeer Plush Doll For Xmas Party Table Decor
$1.04
Mix MOQ : 2
Go to

More in home & kitchen

Explore more in plastic fruit

plastichomestoragestudentsgelstyledesignpetdecorativewhite
kidstoolartificialshapediyclawcakehangingroundwire

Ready to source like an insider

Get a direct line to the factory floor — no minimums, no middlemen, no guesswork.
iconReal factory pricing, no markup in betweeniconEvery order hand-inspected before it shipsicon5,000+ new products added daily
Get Inside Access