Everful

Wholesale pencil case

Factory-direct selection, vetted for quality and ready to order.

Sign Up
Pencil Case

Find the perfect pieces: pencil cases, pen, pencil & marker cases, stationery boxes & bags and more

filterShow Filters
Best Seller
New Arrivals
Price Drop
Free Shipping
Cute Cat Paw Pencil Case Plush Large Capacity Stationery Bag Korean Style Embroidery Soft Zipper Storage Pouch For Student School Office
Cute Cat Paw Pencil Case Plush Large Capacity Stationery Bag Korean Style Embroidery Soft Zipper Storage Pouch For Student School Office
like
Find Similar
Close-up of a grey plush cat paw pencil case with pink embroidered heart-shaped paw pads - Gray
Cute camel plush cat paw pencil case with pink heart embroidery and Yeah lettering - Beige
Close-up of pink plush cat paw pencil case with embroidered white YEAH lettering - Pink
Detail of plush brown cat paw pencil case featuring soft pink embroidery and YEAH text - Brown
Cute Cat Paw Pencil Case Plush Large Capacity Stationery Bag Korean Style Embroidery Soft Zipper Storage Pouch For Student School Office
$1.56
No MOQ
 · 
146 sold recently
Kids 3D Pencil Case EVA Hard Shell Large Capacity Cartoon Stationery Bag School Students Organizer Cute Embossed Design
Kids 3D Pencil Case EVA Hard Shell Large Capacity Cartoon Stationery Bag School Students Organizer Cute Embossed Design
like
Find Similar
Pink EVA hard shell pencil case featuring a 3D cartoon giraffe design with Smile text - Pink with Giraffe
3D EVA kids pencil case featuring navy blue space astronaut theme and space lettering - Space Boy
3D astronaut space theme EVA pencil case for kids in navy blue with red zipper details - Astronaut
3D navy blue EVA pencil case featuring a raised space rocket design and red zipper - Space Rocket
+4
Kids 3D Pencil Case EVA Hard Shell Large Capacity Cartoon Stationery Bag School Students Organizer Cute Embossed Design
-5%
$2.05
Mix MOQ : 2
 · 
101 sold recently
Drawstring Pencil Case Large Capacity Polyester Folding Vertical Pen Holder Gingham Stationery Storage Bag Japanese Style
Drawstring Pencil Case Large Capacity Polyester Folding Vertical Pen Holder Gingham Stationery Storage Bag Japanese Style
like
Find Similar
Detail of green gingham stationery bag standing on a desk with colorful accessories - Green Plaid
Close-up of blue gingham and white canvas storage bag with branded sozakka label - Blue Plaid
Drawstring Pencil Case Large Capacity Polyester Folding Vertical Pen Holder Gingham Stationery Storage Bag Japanese Style
-5%
$2.16
No MOQ
 · 
16 views
Kawaii Capybara Transparent Pencil Case Waterproof PVC Storage Bag Frosted Document Pouch Round Ring Zipper For Students
Kawaii Capybara Transparent Pencil Case Waterproof PVC Storage Bag Frosted Document Pouch Round Ring Zipper For Students
like
Find Similar
Frosted Capybara exam stationery bag with white ring zipper and yellow illustrations - Goose Capybara (Zipper Bag)
Transparent Capybara pencil case with Japanese hot spring print and white ring zipper - Bath Capybara (Zipper Bag)
Transparent Capybara zipper pencil case with cute illustrations, size 21x17cm - Burger Capybara (Zipper Bag)
Translucent capybara frosted zipper pouch with cute cartoon animal print 17x21cm - Crocodile Capybara (Zipper Bag)
Kawaii Capybara Transparent Pencil Case Waterproof PVC Storage Bag Frosted Document Pouch Round Ring Zipper For Students
$0.16
No MOQ
 · 
309 sold recently
Vintage Roll Up Pencil Case Retro Treasure Map Nautical Compass Print Faux Leather Stationery Organizer Cord Coin Pendant
Vintage Roll Up Pencil Case Retro Treasure Map Nautical Compass Print Faux Leather Stationery Organizer Cord Coin Pendant
like
Find Similar
4 options
Vintage Roll Up Pencil Case Retro Treasure Map Nautical Compass Print Faux Leather Stationery Organizer Cord Coin Pendant
-5%
$2.05
No MOQ
 · 
59 sold recently
Seersucker Striped Pencil Case High Capacity Stationery Storage Bag Rectangular Zipper Pouch For Student Office Desktop
Seersucker Striped Pencil Case High Capacity Stationery Storage Bag Rectangular Zipper Pouch For Student Office Desktop
like
Find Similar
Seersucker pencil case featuring black and white vertical stripes and zipper closure - Black & White Stripes
Seersucker pencil case with red and white stripes and secure zipper closure - Red Stripes
Green and white striped seersucker pencil case with zipper for desk stationery storage - Green Stripes
Seersucker pencil case with yellow and white stripes and large capacity storage - Yellow Plaid
+13
Seersucker Striped Pencil Case High Capacity Stationery Storage Bag Rectangular Zipper Pouch For Student Office Desktop
$1.33
No MOQ
 · 
12 sold recently
Floral Pencil Case Seersucker Fabric Large Capacity Stationery Storage Bag Makeup Pouch Portable Zipper Bag Ins Style
Floral Pencil Case Seersucker Fabric Large Capacity Stationery Storage Bag Makeup Pouch Portable Zipper Bag Ins Style
like
Find Similar
Detailed view of pink floral seersucker fabric texture on a large capacity pencil case - Pink Floral
Macro detail of white and blue floral pencil case featuring pleated fabric texture and zipper - Blue Floral
Detailed shot of floral seersucker fabric stationery pouch with zipper closure - Red Flower
Detail of lavender floral pencil case featuring pleated fabric texture and zipper closure - Purple Floral
+1
Floral Pencil Case Seersucker Fabric Large Capacity Stationery Storage Bag Makeup Pouch Portable Zipper Bag Ins Style
$1.53
No MOQ
 · 
175 sold recently
Telescopic Pencil Case Standing Pen Holder Large Capacity Canvas Pouch Polka Dot Solid Color Korean Style School Office Supplies For Students
Telescopic Pencil Case Standing Pen Holder Large Capacity Canvas Pouch Polka Dot Solid Color Korean Style School Office Supplies For Students
like
Find Similar
Vertical pink canvas stationery pouch with yellow zipper and cute cartoon patch detail - Pink
Top view of large capacity yellow stationery pouch with pink zipper and cute cartoon patch - Yellow
Detailed view of pale green polka dot pencil case with vertical storage and yellow zipper - Lake Green
Detailed view of large capacity canvas pencil case with cute cloud patch and yellow zipper - Light Purple
+1
Telescopic Pencil Case Standing Pen Holder Large Capacity Canvas Pouch Polka Dot Solid Color Korean Style School Office Supplies For Students
$2.28
No MOQ
 · 
39 views
Checkerboard Knit Pencil Case Large Capacity Yarn Cosmetic Bag Portable Makeup Pouch Soft Ins Style Storage Organizer
Checkerboard Knit Pencil Case Large Capacity Yarn Cosmetic Bag Portable Makeup Pouch Soft Ins Style Storage Organizer
like
Find Similar
Classic black and white checkered knit pouch with top zipper for makeup storage - Black and White Plaid
Blue and white checkered knitted cosmetic bag with zipper and woven handle - Blue & White Plaid
Knitted checkerboard makeup bag in purple and yellow with side handle and zipper - Yellow and Purple Grid
Knitted checkerboard cosmetic bag in dark coffee and cream with zipper and side handle - Khaki Plaid
+5
Checkerboard Knit Pencil Case Large Capacity Yarn Cosmetic Bag Portable Makeup Pouch Soft Ins Style Storage Organizer
$1.73
Mix MOQ : 2
 · 
40 sold recently
Plush Pencil Case Makeup Bag Large Capacity Checkerboard Design Portable Zipper Pouch Cute Cartoon Bear For Students And Travel
Plush Pencil Case Makeup Bag Large Capacity Checkerboard Design Portable Zipper Pouch Cute Cartoon Bear For Students And Travel
like
Find Similar
Close-up of brown plush pouch with teddy bear label and laptop in background - Khaki
Close-up of brown plush cosmetic bag featuring bear tag and woven wrist strap details - Dark Coffee
Detail of plush checkered makeup bag with cute bear patch and woven carrying strap - Checkered Black
Detail of plush checkerboard makeup bag with cute bear label and side woven handle - Checkered Grey
+2
Plush Pencil Case Makeup Bag Large Capacity Checkerboard Design Portable Zipper Pouch Cute Cartoon Bear For Students And Travel
-5%
$1.31
No MOQ
 · 
326 sold recently
Vintage Genuine Leather Pencil Case Zippered Fountain Pen Pouch Handmade Retro Large Capacity Stationery Organizer Bag
Vintage Genuine Leather Pencil Case Zippered Fountain Pen Pouch Handmade Retro Large Capacity Stationery Organizer Bag
like
Find Similar
Vintage brown crazy horse leather pencil case with zipper and yellow contrast stitching - Brown
Handmade black crazy horse leather pencil case with orange stitching and zipper closure - Black
Handmade dark brown crazy horse leather pencil case with orange contrast stitching - Coffee
Handmade burgundy crazy horse leather pencil pouch with vintage yellow stitching - Red
+2
Vintage Genuine Leather Pencil Case Zippered Fountain Pen Pouch Handmade Retro Large Capacity Stationery Organizer Bag
-4%
$5.77
No MOQ
 · 
30 sold recently
Retro Corduroy Pencil Case Solid Color Large Capacity Stationery Bag For School Office Minimalist Students Organizer
Retro Corduroy Pencil Case Solid Color Large Capacity Stationery Bag For School Office Minimalist Students Organizer
like
Find Similar
Green corduroy pencil case with a minimalist rectangular design and matching zipper - Dark Green
Pink corduroy pencil case with soft texture and zipper closure for school storage - Dusty Pink
Pink corduroy pencil case with a rectangular design and soft cream-colored zipper pull - Pink
Handheld vintage ginger yellow corduroy pencil case with a zipper closure for students - Ginger Yellow (Chocolate)
+2
Retro Corduroy Pencil Case Solid Color Large Capacity Stationery Bag For School Office Minimalist Students Organizer
$1.33
Mix MOQ : 3
 · 
30 sold recently
Korean Style Quilted Cotton Pencil Case Large Capacity Floral Pattern Stationery Storage Bag With Pom Pom And Heart Button
Korean Style Quilted Cotton Pencil Case Large Capacity Floral Pattern Stationery Storage Bag With Pom Pom And Heart Button
like
Find Similar
Detail of blue quilted floral pencil case with pink pompom trim and soft heart stitching - Pink Floral + Light Blue Heart
Detailed view of pink quilted floral pencil case with heart stitching and pom-pom trim - Pink Floral + Light Pink Heart
Detail of floral quilted pencil case featuring heart buckle and plush pom-pom trim - Pink Floral + Pink Stripes
Detailed close-up of floral quilted pencil case with pom-pom trim and pink handle - Pink Floral + Blue Stripes
+2
Korean Style Quilted Cotton Pencil Case Large Capacity Floral Pattern Stationery Storage Bag With Pom Pom And Heart Button
-4%
$2.71
No MOQ
 · 
21 views
Cute Cat Plush Pencil Case Large Capacity Zippered Gradient Tie Dye Student Stationery Organizer For Girls
Cute Cat Plush Pencil Case Large Capacity Zippered Gradient Tie Dye Student Stationery Organizer For Girls
like
Find Similar
Pink plush cat pencil case with 3D ears and embroidery, cute cartoon stationery pouch - Pure Pink
Gradient purple and blue plush cat pencil case with embroidered face and 3D ears - Purple Multi
Plush cat pencil case with macaron gradient fur and sequined ears on display stand - Pink Multi
Pink plush cat pencil case with blue embroidered eyes and fuzzy ears for students - Rose Gold Rainbow
Cute Cat Plush Pencil Case Large Capacity Zippered Gradient Tie Dye Student Stationery Organizer For Girls
-5%
$1.23
Mix MOQ : 3
 · 
58 sold recently
Pink White Canvas Pencil Case Large Capacity Stripes Dots Patterns Zipper Stationery Pouch Organizer For School Office Students
Pink White Canvas Pencil Case Large Capacity Stripes Dots Patterns Zipper Stationery Pouch Organizer For School Office Students
like
Find Similar
4 options
Pink White Canvas Pencil Case Large Capacity Stripes Dots Patterns Zipper Stationery Pouch Organizer For School Office Students
-4%
$0.77
Mix MOQ : 2
 · 
91 sold recently
Canvas Zipper Pouch Portable Makeup Storage Bag Large Capacity Pencil Case Metal Ring Contrast Color Handheld Organizer
Canvas Zipper Pouch Portable Makeup Storage Bag Large Capacity Pencil Case Metal Ring Contrast Color Handheld Organizer
like
Find Similar
Set of four minimalist canvas zipper pouches in cream white with colored metal rings - Horizontal Pouch / Purple Zipper
Set of 4 canvas zipper pouches with colorful pull tabs for stationery or makeup storage - Vertical Pouch / Purple Zipper
Detail of canvas pouch with blue zipper tape and purple zipper pull in contrast design - Coin Purse / Purple Zipper
Detailed macro view of cream canvas pouch with vibrant pink and yellow zipper pulls - Coin Purse / Pink Zipper
+8
Canvas Zipper Pouch Portable Makeup Storage Bag Large Capacity Pencil Case Metal Ring Contrast Color Handheld Organizer
$1.30-1.53
No MOQ
 · 
39 sold recently
Aesthetic Quilted Plush Pencil Case Large Capacity Japanese Ins Style Grid Stationery Storage Bag Students Women
Aesthetic Quilted Plush Pencil Case Large Capacity Japanese Ins Style Grid Stationery Storage Bag Students Women
like
Find Similar
Creamy white plush quilted pencil case with soft diamond stitching and large capacity - White
Blue checkered plush pencil case with pink zipper for students and office storage - Blue
Quilted velvet pencil case in light purple with metal zipper for student stationary - Purple
Plush yellow pencil case with blue zipper and quilted texture for school stationery - Yellow
+2
Aesthetic Quilted Plush Pencil Case Large Capacity Japanese Ins Style Grid Stationery Storage Bag Students Women
$1.04
No MOQ
 · 
339 sold recently
Kawaii Cartoon Transparent PVC Pencil Case Large Capacity Glitter Waterproof Stationary Pouch Girls Students School
Kawaii Cartoon Transparent PVC Pencil Case Large Capacity Glitter Waterproof Stationary Pouch Girls Students School
like
Find Similar
Clear glitter pencil case with cute rabbit strawberry print and pink heart pendant - Glitter Strawberry Rabbit
Pink semi-transparent pencil case with cute cartoon bear and peach prints and heart charm - Peach Bear
Pink semi-transparent PVC pencil case with cute cartoon dogs and cherry patterns - Cherry Puppy
Kawaii Cartoon Transparent PVC Pencil Case Large Capacity Glitter Waterproof Stationary Pouch Girls Students School
$1.24
Mix MOQ : 2
 · 
149 sold recently
Heart Shape PU Leather Self Adhesive Pen Loop Holder Elastic Pencil Clip For Notebook Tablet Journal Minimalist Stationery
Heart Shape PU Leather Self Adhesive Pen Loop Holder Elastic Pencil Clip For Notebook Tablet Journal Minimalist Stationery
like
Find Similar
Eight colors of heart-shaped PU leather pen holders with elastic loops on wood background - Multicolor Set
Close-up of heart-shaped yellow PU leather stylus holder with elastic strap detail - Milk Yellow
Detail view of purple PU leather heart pen holder with elastic loop for notebooks - Macaron Purple
Macro detail of white heart-shaped PU leather pen holder with elastic loop for notebooks - White
+5
Heart Shape PU Leather Self Adhesive Pen Loop Holder Elastic Pencil Clip For Notebook Tablet Journal Minimalist Stationery
-17%
$0.29-2.39
Mix MOQ : 2
 · 
82 sold recently
Cute Gingham Pencil Case Quilted Polyester Stationery Pouch With Lace Decor Large Capacity Fresh Style For Students
Cute Gingham Pencil Case Quilted Polyester Stationery Pouch With Lace Decor Large Capacity Fresh Style For Students
like
Find Similar
Detail of pink plaid quilted pencil case with delicate lace trim and top zipper - Pink
Close-up of quilted light blue plaid pencil case with elegant white lace trim detail - Blue
Detail of lavender plaid quilted pencil case with lace trim and metal zipper closure - Purple
Detail of yellow plaid pencil case with diamond quilting and lace trim on desk - Yellow
+2
Cute Gingham Pencil Case Quilted Polyester Stationery Pouch With Lace Decor Large Capacity Fresh Style For Students
$1.12
No MOQ
 · 
26 sold recently
Transparent Acrylic Pen Display Stand Rack Holder For Makeup Brushes Eyebrow Pencils Fountain Pens Desktop Storage Organizer For Office Home Store
Transparent Acrylic Pen Display Stand Rack Holder For Makeup Brushes Eyebrow Pencils Fountain Pens Desktop Storage Organizer For Office Home Store
like
Find Similar
Clear acrylic pen display stand with 24 slots, 12x7.5x8cm size, minimalist organizer - Style A 24-Hole / Clear
Clear 2-tier acrylic pen display stand with dimensions of 30cm length for office organizers - Style B Arch / Clear
Clear acrylic pen display stand with 2-layer hole design for desk organization - Style D Single Layer 24-Hole / Clear
Clear acrylic 3-tier stepped display stand for pens and lipsticks with 24cm width - Style E Double Layer 48-Hole / Clear
+5
Transparent Acrylic Pen Display Stand Rack Holder For Makeup Brushes Eyebrow Pencils Fountain Pens Desktop Storage Organizer For Office Home Store
-9%
$0.79-3.54
No MOQ
 · 
33 sold recently
Creative Milk Box Shape Pencil Case PU Leather Cartoon Pig Pattern Large Capacity Stationery Organizer Pouch For Students
Creative Milk Box Shape Pencil Case PU Leather Cartoon Pig Pattern Large Capacity Stationery Organizer Pouch For Students
like
Find Similar
Cute red milk carton pencil case with cartoon girl design and polka dot pattern - Little Girl
Blue and white PU leather pencil case in cute milk carton shape with cartoon smiley face - Little Boy
Banana milk carton pencil case in yellow and white with cute cartoon illustrations - Little Banana
Pink milk carton pencil case with white grid pattern and artistic Chinese text - Little Brother
+10
Creative Milk Box Shape Pencil Case PU Leather Cartoon Pig Pattern Large Capacity Stationery Organizer Pouch For Students
$0.57
No MOQ
 · 
201 sold recently
Checkerboard Knitted Makeup Bag Pencil Case Contrast Color Zipper Portable Travel Toiletry Storage Pouch
Checkerboard Knitted Makeup Bag Pencil Case Contrast Color Zipper Portable Travel Toiletry Storage Pouch
like
Find Similar
Pink and orange checkered knit cosmetic bag with yellow zipper and side handle - Large Orange-Pink Grid
Green and white checkerboard knitted cosmetic bag with zipper and handy loop - Large Green-White Grid
Knitted checkerboard makeup bag in orange and white with a secure yellow zipper - Large Yellow-White Grid
Purple checkerboard knitted cosmetic bag with soft woven texture and side handle - Large Purple-Yellow Grid
+5
Checkerboard Knitted Makeup Bag Pencil Case Contrast Color Zipper Portable Travel Toiletry Storage Pouch
-15%
$1.47
Mix MOQ : 2
 · 
103 sold recently
Large Capacity Pencil Case Canvas PVC Transparent Multilayer Storage Aesthetic Stationery Pouch Organizer For Girls Students
Large Capacity Pencil Case Canvas PVC Transparent Multilayer Storage Aesthetic Stationery Pouch Organizer For Girls Students
like
Find Similar
Classic black 8-layer pencil case with transparent window and large storage capacity - Black
Off-white large capacity multi-layer pencil case with transparent window and 8 compartments - Off-white
Sky blue multi-layer large capacity pencil case with transparent window and 8 layers - Blue
Purple multi-layer clear pencil case with 8 compartments holding 100 pens, 22x9x12.5cm - Purple
Large Capacity Pencil Case Canvas PVC Transparent Multilayer Storage Aesthetic Stationery Pouch Organizer For Girls Students
-5%
$3.01
No MOQ
 · 
21 sold recently
Cute Cat Paw Shape Pencil Case Soft Plush Large Capacity Stationery Storage Bag For Students Kawaii Embroidery Organizer
Cute Cat Paw Shape Pencil Case Soft Plush Large Capacity Stationery Storage Bag For Students Kawaii Embroidery Organizer
like
Find Similar
Beige plush cat paw pencil case with pink heart embroidery and YEAH text detail - YEAH Embroidery / Beige
Pink plush cat paw pencil case with soft faux fur and embroidered paw pads - Pink
Cute gray plush cat paw pencil case with pink heart-shaped pads and YEAH embroidery - YEAH Embroidery / Gray
Brown plush cat paw pencil case with pink paw pad design and white CAT embroidery - CAT Embroidery / Brown
Cute Cat Paw Shape Pencil Case Soft Plush Large Capacity Stationery Storage Bag For Students Kawaii Embroidery Organizer
-4%
$1.37
Mix MOQ : 2
 · 
14 sold recently
Nylon Pencil Case Large Capacity Macaron Color Stationery Storage Bag Multifunctional Zipper Pouch For Students School
Nylon Pencil Case Large Capacity Macaron Color Stationery Storage Bag Multifunctional Zipper Pouch For Students School
like
Find Similar
Minimalist Macaron pink pencil case shown with pastel pens on book background. - 19x6x7cm / Pink
Macaron color high-capacity pencil case stationery organizer with minimalist fabric design - 19x6x7cm / Yellow
Close-up of a minimalist purple pastel pencil case with a Mayrabbit white label tag. - 19x6x7cm / Purple
Close-up detail of a pastel green macaron pencil case with Mayrabbit woven label - 19x6x7cm / Green
+3
Nylon Pencil Case Large Capacity Macaron Color Stationery Storage Bag Multifunctional Zipper Pouch For Students School
$1.90
No MOQ
 · 
16 sold recently
Plaid Canvas Pencil Case Large Capacity Zipper Stationery Pouch Minimalist Korean Style School Desk Organizer Students
Plaid Canvas Pencil Case Large Capacity Zipper Stationery Pouch Minimalist Korean Style School Desk Organizer Students
like
Find Similar
Close-up of blue plaid canvas pencil case with zipper on pink background with roses - Blue & White Plaid
Detail of blue and yellow plaid canvas pencil case with zipper on a pink background - Blue and Yellow Scottish Plaid
Macro detail of plaid canvas pencil case showing the zipper and green checkered pattern - Green White and Blue Plaid
Detailed top view of a pink and blue checkered canvas pouch with white zipper closure - Pink Blue Plaid
+4
Plaid Canvas Pencil Case Large Capacity Zipper Stationery Pouch Minimalist Korean Style School Desk Organizer Students
-5%
$0.52
Mix MOQ : 5
 · 
33 sold recently
Corduroy Pencil Case Cute Shark Embroidery Large Capacity Stationery Pouch Zipper School Organizer Bag For Students
Corduroy Pencil Case Cute Shark Embroidery Large Capacity Stationery Pouch Zipper School Organizer Bag For Students
like
Find Similar
Detailed texture of green corduroy pencil case with embroidered shark patch and zipper - Green
Detail of grey corduroy pencil case with cartoon shark patch on a white desk - Light Gray
Detailed view of grey corduroy pencil case with shark embroidery and zipper closure - Dark Gray
Brown corduroy shark stationery pouch with embroidered Sea Summer Holiday patch - Tan
+1
Corduroy Pencil Case Cute Shark Embroidery Large Capacity Stationery Pouch Zipper School Organizer Bag For Students
-4%
$0.82
No MOQ
 · 
195 sold recently
Pencil Case Quilted Checkered Cotton Fabric Bow Print Large Capacity Stationery Organizer Pouch For Students Cute Ins Style
Pencil Case Quilted Checkered Cotton Fabric Bow Print Large Capacity Stationery Organizer Pouch For Students Cute Ins Style
like
Find Similar
Detail of yellow checkered quilted pencil case with pink bow embroidery and zipper - Yellow
Detailed view of blue checkered quilted pencil case with pink bows and brand label - Blue
Detailed view of red plaid quilted pencil case with blue bow pattern and zip closure - Rose Red
Detail of quilted plaid pencil case with pink bow prints and brand label on a desk - Purple
Pencil Case Quilted Checkered Cotton Fabric Bow Print Large Capacity Stationery Organizer Pouch For Students Cute Ins Style
$1.59
Mix MOQ : 3
 · 
70 sold recently
Plush Pencil Case Checkerboard Faux Fur Stationery Bag Large Capacity Zippered Makeup Storage Organizer For Students
Plush Pencil Case Checkerboard Faux Fur Stationery Bag Large Capacity Zippered Makeup Storage Organizer For Students
like
Find Similar
Close-up of pink plush pencil case with mesh texture and premium metal zipper detail - Pink
Macro shot of dark grey plush pencil case with textured square pattern and metal zipper - Gray
Creamy beige plush checkerboard pencil case with large capacity and soft texture - Beige
Close-up of brown plaid plush pencil case showing soft faux fur texture and metal zipper - Khaki
+1
Plush Pencil Case Checkerboard Faux Fur Stationery Bag Large Capacity Zippered Makeup Storage Organizer For Students
$1.96
No MOQ
 · 
131 sold recently
Kawaii Refrigerator Shaped Pencil Holder Desktop Organizer Multi Compartment Stationery Storage Case With Cute Cartoon Stickers For Students Girls
Kawaii Refrigerator Shaped Pencil Holder Desktop Organizer Multi Compartment Stationery Storage Case With Cute Cartoon Stickers For Students Girls
like
Find Similar
White mini fridge shaped desk organizer and pen holder, dimensions 7.5x9.8x14 cm - Refrigerator Pen Holder / Off White
Pink refrigerator-shaped desk pen holder with white handle, size 7.5x9.8x14cm - Refrigerator Pen Holder / Pink
Pink mini fridge pencil holder with cute cartoon stickers for desk storage and organization - Refrigerator Pen Holder / With Stickers / Pink
White refrigerator shaped pen holder with cute DIY stickers for desk organization - Refrigerator Pen Holder / With Stickers / Off White
+2
Kawaii Refrigerator Shaped Pencil Holder Desktop Organizer Multi Compartment Stationery Storage Case With Cute Cartoon Stickers For Students Girls
-5%
$1.51-1.81
No MOQ
 · 
59 sold recently
Cute Cat Shaped Plush Pencil Case Soft Faux Fur Stationery Pouch Zipper Large Capacity Makeup Storage Bag Cartoon Gift
Cute Cat Shaped Plush Pencil Case Soft Faux Fur Stationery Pouch Zipper Large Capacity Makeup Storage Bag Cartoon Gift
like
Find Similar
Detailed back view of a cute plush black cat pencil case with a small tail on a desk - Black
Close-up of soft white plush cat pencil case with fluffy faux fur texture on a warm desk - White
Detail showing the plush brown cat-shaped pencil case with fluffy tail and ears - Khaki
Detail of grey plush cat pencil case showing soft texture and 3D ears on a cozy desk - Gray
Cute Cat Shaped Plush Pencil Case Soft Faux Fur Stationery Pouch Zipper Large Capacity Makeup Storage Bag Cartoon Gift
$2.02
Mix MOQ : 2
 · 
26 sold recently
Free Shipping
Canvas Pencil Case Korean Style Zippered Cute Stationery Storage Bag With Gold Quotes For Students School Office Fresh
Canvas Pencil Case Korean Style Zippered Cute Stationery Storage Bag With Gold Quotes For Students School Office Fresh
like
Find Similar
Blue striped canvas pencil case with gold foil You Are My Best lettering design - Striped
White canvas pencil case with blue leaf patterns and gold 'DAYS WILL BE BETTER' print - Diamond
White canvas pencil case with light blue polka dots and golden embroidery detail - Big Polka Dots
White canvas pencil pouch with teal polka dots and golden text decoration - Small Dot
Canvas Pencil Case Korean Style Zippered Cute Stationery Storage Bag With Gold Quotes For Students School Office Fresh
-4%
$0.69
Mix MOQ : 2
 · 
46 sold recently
Large Capacity Basketball Pattern Pencil Case Polyester Zipper Stationery Bag For Boys Girls School Student Office Supplies
Large Capacity Basketball Pattern Pencil Case Polyester Zipper Stationery Bag For Boys Girls School Student Office Supplies
like
Find Similar
Minimalist canvas pencil case with flaming basketball print and large capacity - Flame Basketball (6011313237689)
Minimalist basketball texture pencil case with high capacity and orange sports design - Basketball Texture (6011313237690)
Large Capacity Basketball Pattern Pencil Case Polyester Zipper Stationery Bag For Boys Girls School Student Office Supplies
-5%
$1.64
Mix MOQ : 2
 · 
10 sold recently
Fruit Print Strawberry Peach Pencil Case Waffle Fabric Stationery Bag Zipper Slim Pen Pouch For Students School Office
Fruit Print Strawberry Peach Pencil Case Waffle Fabric Stationery Bag Zipper Slim Pen Pouch For Students School Office
like
Find Similar
Close-up of strawberry print pencil case with honeycomb texture on a wooden tray - Pink Strawberry Style
Close-up of strawberry print cream pencil case with metal zipper on a wooden tray - Yellow Strawberry
Detailed texture of white canvas stationery pouch with blue strawberry print and zipper - Blue Strawberry
Detail of waffle fabric pencil case featuring red strawberry and pink peach patterns - Red Strawberry Style
+1
Fruit Print Strawberry Peach Pencil Case Waffle Fabric Stationery Bag Zipper Slim Pen Pouch For Students School Office
$0.52
No MOQ
 · 
32 sold recently
Fruit Shaped Plush Pencil Case Cute Watermelon Orange Strawberry Pineapple Creative Stationery Storage Bag For Students Kids
Fruit Shaped Plush Pencil Case Cute Watermelon Orange Strawberry Pineapple Creative Stationery Storage Bag For Students Kids
like
Find Similar
Cute plush watermelon storage bag with red zipper and silver metal bead chain - Red Watermelon
Cute watermelon plush pouch with pink fruit detail and zipper for stationery storage - Pink Watermelon
Cute orange slice plush pencil case with zipper closure and portable chain strap - Orange Fruit
Cute strawberry shaped plush pencil case with red zipper and metal bead chain accessory - Red Strawberry
+1
Fruit Shaped Plush Pencil Case Cute Watermelon Orange Strawberry Pineapple Creative Stationery Storage Bag For Students Kids
-4%
$0.96
Mix MOQ : 3
 · 
149 sold recently
Large Capacity Multi Layer Pencil Case Oxford Cloth Transparent Window Flip Top Prism Stationery Pouch For Students Office
Large Capacity Multi Layer Pencil Case Oxford Cloth Transparent Window Flip Top Prism Stationery Pouch For Students Office
like
Find Similar
Macro detail of black stationery case with transparent PVC window and durable dual zippers - Black
Detail view of purple multi-layer pencil case with clear window on a desk - Purple
Brown multi-layer stationery organizer with clear front window and dual zipper rings - Coffee
Large Capacity Multi Layer Pencil Case Oxford Cloth Transparent Window Flip Top Prism Stationery Pouch For Students Office
$1.92
Mix MOQ : 5
 · 
30 sold recently
Bus Shaped Pencil Case Large Capacity Canvas Zipper School Stationery Bag Cute Cartoon Car For Students Kids
Bus Shaped Pencil Case Large Capacity Canvas Zipper School Stationery Bag Cute Cartoon Car For Students Kids
like
Find Similar
4 options
Bus Shaped Pencil Case Large Capacity Canvas Zipper School Stationery Bag Cute Cartoon Car For Students Kids
-5%
$0.90
Mix MOQ : 2
 · 
43 sold recently
Checkered Quilted Cotton Polyester Pencil Case Large Capacity Zipper Pouch Travel Cosmetic Bag Style For Students
Checkered Quilted Cotton Polyester Pencil Case Large Capacity Zipper Pouch Travel Cosmetic Bag Style For Students
like
Find Similar
Detailed macro view of black and white checkered quilted pencil case with green zipper detail - Black
Detail of orange plaid quilted fabric stationery bag with pink woven zipper puller - Orange
Detail of purple plaid quilted pencil case with green zipper and hisocute label - Purple
Detail of blue and white checkered quilted pencil case with yellow zipper and brand tag - Blue
+1
Checkered Quilted Cotton Polyester Pencil Case Large Capacity Zipper Pouch Travel Cosmetic Bag Style For Students
$1.87
Mix MOQ : 2
 · 
46 sold recently
Kawaii Capybara Plush Pencil Case Long Hair Combing Novelty Stationery Pouch Large Capacity Cute Cartoon Bag
Kawaii Capybara Plush Pencil Case Long Hair Combing Novelty Stationery Pouch Large Capacity Cute Cartoon Bag
like
Find Similar
Detailed view of pink plush pig stationery bag with fluffy hair and cute accessories - Pink
Detail of plush Capybara pencil case showing long hair texture with comb and hair clips - Brown
Plush Capybara pencil case with comb and hair accessories on a warm desk setup - Beige
Kawaii Capybara Plush Pencil Case Long Hair Combing Novelty Stationery Pouch Large Capacity Cute Cartoon Bag
$1.73
Mix MOQ : 2
Mesh Makeup Bag Nylon Transparent Zipper Portable Travel Toiletry Organizer Stationery Pencil Pouch Women Students
Mesh Makeup Bag Nylon Transparent Zipper Portable Travel Toiletry Organizer Stationery Pencil Pouch Women Students
like
Find Similar
Portable black nylon mesh makeup bag with zipper and side loop for storage - Small (13*10cm) / Black
Portable white rectangular mesh makeup bag with zipper and side hanging loop - Small (13*10cm) / White
White nylon mesh makeup bag with zipper closure and side loop for portable storage - Medium (19*14cm) / White
Portable gray mesh makeup bag with zipper closure and round puller for travel storage - Small (13*10cm) / Gray
+5
Mesh Makeup Bag Nylon Transparent Zipper Portable Travel Toiletry Organizer Stationery Pencil Pouch Women Students
-5%
$0.37-0.44
Mix MOQ : 3
 · 
288 sold recently
Mesh Pencil Case Nylon Transparent Zippered Large Capacity Stationery Storage Bag For Students School Office
Mesh Pencil Case Nylon Transparent Zippered Large Capacity Stationery Storage Bag For Students School Office
like
Find Similar
White semi-transparent mesh pencil case with zipper and portable handle strap - White
Transparent mesh pencil case in fluorescent green color for student stationery storage - Green
Pink mesh pencil case with large capacity, zipper closure and portable carrying handle - Pink
Minimalist blue mesh pencil case with zipper and portable nylon strap for stationery - Blue
+1
Mesh Pencil Case Nylon Transparent Zippered Large Capacity Stationery Storage Bag For Students School Office
-4%
$0.88
No MOQ
 · 
28 sold recently
Pencil Case Large Capacity Corduroy Simple Solid Color Zipper Stationery Bag Student Portable Makeup Storage Pouch Vintage
Pencil Case Large Capacity Corduroy Simple Solid Color Zipper Stationery Bag Student Portable Makeup Storage Pouch Vintage
like
Find Similar
Close-up of cream corduroy pencil case texture with May Rabbit label on a desk - Creamy White
Detail of black corduroy pencil case with zipper and white May Rabbit logo label - Black
Pink corduroy pencil case detail with white MAY RABBIT label on a cozy desktop - Nude Pink
Close-up of dark green corduroy pencil case texture with minimalist woven label - Dark Green
+7
Pencil Case Large Capacity Corduroy Simple Solid Color Zipper Stationery Bag Student Portable Makeup Storage Pouch Vintage
$1.82
No MOQ
 · 
11 sold recently
Clear Pencil Case Large Capacity PVC Waterproof Zipper Stationery Bag Student School Office Supply Organizer INS Style
Clear Pencil Case Large Capacity PVC Waterproof Zipper Stationery Bag Student School Office Supply Organizer INS Style
like
Find Similar
Large capacity black transparent PVC stationery bag with cute cartoon pens and cloud cutter - Black
White semi-transparent PVC pencil case with large capacity and cartoon pens - White
Clear Pencil Case Large Capacity PVC Waterproof Zipper Stationery Bag Student School Office Supply Organizer INS Style
-4%
$0.47
No MOQ
 · 
864 sold recently
Cute Plush Pencil Case Large Capacity Faux Fur Cylindrical Pen Bag For School Girls Office Students Stationery Storage Box
Cute Plush Pencil Case Large Capacity Faux Fur Cylindrical Pen Bag For School Girls Office Students Stationery Storage Box
like
Find Similar
Close-up of soft pink faux fur material on the cylindrical plush pencil case - Pink
Close-up of white plush pencil case showing soft faux fur texture and silver zipper - White
Cute large capacity purple plush pencil case for girls with soft faux fur and metal zipper - Purple
Detail of plush brown cylindrical pencil case showing soft faux fur texture and metal zipper - Coffee
Cute Plush Pencil Case Large Capacity Faux Fur Cylindrical Pen Bag For School Girls Office Students Stationery Storage Box
-4%
$1.15
Mix MOQ : 2
 · 
64 sold recently
3D Racing Car Shape Pencil Case EVA Hard Shell Large Capacity Waterproof Stationery Box For School Kids Students Boys
3D Racing Car Shape Pencil Case EVA Hard Shell Large Capacity Waterproof Stationery Box For School Kids Students Boys
like
Find Similar
Black 3D car shaped pencil case with red flame design and racing checkered flag patterns - Black Racing Car (A-555)
3D racing car EVA pencil case in navy blue with flame patterns and zipper closure - Blue Racing Car (B-666)
Red 3D racing car EVA pencil case with B-888 print and blue flame pattern for boys - Red Racing Car (B-888)
3D Racing Car Shape Pencil Case EVA Hard Shell Large Capacity Waterproof Stationery Box For School Kids Students Boys
$2.02
Mix MOQ : 2
 · 
31 sold recently
Retractable Pencil Case Canvas Telescopic Standing Pen Holder Large Capacity Cute Cartoon Animal Student Stationery Bag
Retractable Pencil Case Canvas Telescopic Standing Pen Holder Large Capacity Cute Cartoon Animal Student Stationery Bag
like
Find Similar
Yellow canvas boba tea telescopic pencil case showing extended and collapsed positions - Mango Milk Tea
Blue canvas telescopic pencil case with bubble tea design and cute cartoon face - Blue Velvet Milk Tea
Cute milk tea canvas pencil case in khaki featuring a creative telescopic sliding design - Coffee Milk Tea
Green matcha bubble tea telescopic pencil case in durable canvas material - Matcha Green Milk Tea
+55
Retractable Pencil Case Canvas Telescopic Standing Pen Holder Large Capacity Cute Cartoon Animal Student Stationery Bag
$3.46-5.76
No MOQ
 · 
12 sold recently
Free Shipping
Retro Woolen Plaid Pencil Case Large Capacity Zipper Stationery Storage Bag Vintage Checkered Makeup Pouch
Retro Woolen Plaid Pencil Case Large Capacity Zipper Stationery Storage Bag Vintage Checkered Makeup Pouch
like
Find Similar
Detailed close-up of blue and green plaid tweed pencil case with a brown leather label - Woolen Lake Green Blue Plaid
Detail of wool plaid pencil case featuring a premium leather brand tag and soft texture - Woolen Blue Gray Plaid
Close-up of green plaid fabric pencil case with leather logo and sturdy metal zipper - Woolen Emerald Green Plaid
Detail view of the red and green plaid pencil case with a brown leather logo tag - Woolen Red Gray Plaid
+15
Retro Woolen Plaid Pencil Case Large Capacity Zipper Stationery Storage Bag Vintage Checkered Makeup Pouch
$2.28-2.56
No MOQ
Plush Dog Pencil Case Cartoon Puppy Shape Large Capacity Stationery Pouch Zipper Closure Cute Animal Soft Organizer For Students
Plush Dog Pencil Case Cartoon Puppy Shape Large Capacity Stationery Pouch Zipper Closure Cute Animal Soft Organizer For Students
like
Find Similar
Cute husky plush pencil case, grey and white fluffy dog stationery bag for students - Husky
Cute Chihuahua plush pencil case in cream and pink, large capacity stationery bag - Chihuahua
Cute border collie plush pencil case with large capacity for students and stationery storage - Border Collie
Golden Retriever plush pencil case with zipper closure for school stationery storage - Golden Retriever
+5
Plush Dog Pencil Case Cartoon Puppy Shape Large Capacity Stationery Pouch Zipper Closure Cute Animal Soft Organizer For Students
$2.19
Mix MOQ : 2
 · 
66 sold recently
Corduroy Floral Pencil Case Large Capacity Stationery Bag Zipper Storage Organizer For Students School Pastoral Style
Corduroy Floral Pencil Case Large Capacity Stationery Bag Zipper Storage Organizer For Students School Pastoral Style
like
Find Similar
Floral canvas pencil case with a metal zipper on a desk for stationery storage - Pink Floral
Detailed close-up of floral canvas pencil case with zipper closure on office desk - White Floral
Floral corduroy pencil case detail with soft texture and smooth metal zipper closure - Yellow Floral
Close-up of pink corduroy floral pencil case with soft texture and white zipper detail - Pink
+3
Corduroy Floral Pencil Case Large Capacity Stationery Bag Zipper Storage Organizer For Students School Pastoral Style
$1.24
No MOQ
 · 
46 views
3D Embossed Cartoon Pencil Case Double Layer Large Capacity EVA Waterproof Stationery Organizer For Students School Kids
3D Embossed Cartoon Pencil Case Double Layer Large Capacity EVA Waterproof Stationery Organizer For Students School Kids
like
Find Similar
Pink double-layer 3D pencil case with cute cartoon girl, peaches, and silicone zipper - Double Layer EVA Hard Shell / Pink Peach Tea Party
Purple 3D cartoon pencil case for girls with cute bunny zipper and 22x7x7cm size - Double Layer EVA Hard Shell / Nini Dreamy Purple
3D Embossed Cartoon Pencil Case Double Layer Large Capacity EVA Waterproof Stationery Organizer For Students School Kids
-5%
$2.81
No MOQ
 · 
48 sold recently
Retro French PU Leather Pencil Case Minimalist S-Shape Makeup Brush Storage Bag Portable Multi-Color Travel Pen Organizer
Retro French PU Leather Pencil Case Minimalist S-Shape Makeup Brush Storage Bag Portable Multi-Color Travel Pen Organizer
like
Find Similar
Detail view of pink leather stationery pouch with gold zipper and carrying strap - Pink
Close-up of black PU leather stationery pouch with a curved gold zipper and carry strap - Black
Detail view of grey litchi grain PU leather pen case with gold zipper and hand strap - Gray
Detail of mint green lychee textured faux leather pencil case with golden zipper - Green
+1
Retro French PU Leather Pencil Case Minimalist S-Shape Makeup Brush Storage Bag Portable Multi-Color Travel Pen Organizer
$1.41
Mix MOQ : 2
 · 
14 sold recently
Large Capacity Quilted Diamond Lattice Pencil Case Korean Style Big Zipper Makeup Bag Portable Stationery Organizer Pouch For Students School Office
Large Capacity Quilted Diamond Lattice Pencil Case Korean Style Big Zipper Makeup Bag Portable Stationery Organizer Pouch For Students School Office
like
Find Similar
Pink quilted stationery pouch with large plastic zipper and round ring puller design - Pink
Quilted black cream style stationery pencil case with glossy nylon finish and round zipper - Black
Quilted light blue Hisocute pencil case with large zipper and shiny puff texture - Blue
Mint green quilted pencil case with large zipper and soft puffy down-like fabric texture - Green
+1
Large Capacity Quilted Diamond Lattice Pencil Case Korean Style Big Zipper Makeup Bag Portable Stationery Organizer Pouch For Students School Office
$2.51
Mix MOQ : 2
 · 
10 sold recently
Bow Quilted Sunglasses Pouch Heart Snap Button Padded Eyeglass Case Portable Stationery Pencil Bag Storage For Women Girls
Bow Quilted Sunglasses Pouch Heart Snap Button Padded Eyeglass Case Portable Stationery Pencil Bag Storage For Women Girls
like
Find Similar
Detailed view of white quilted storage bag with butterfly texture and pink heart button - White
Detail of pink quilted bow pattern sunglass pouch with heart buckle and aesthetic props - Pink
Detail of light green quilted bow glasses case with heart button and plush fabric texture - Green
Silver quilted bow pattern storage pouch with pink heart button and metallic finish - Silver
+1
Bow Quilted Sunglasses Pouch Heart Snap Button Padded Eyeglass Case Portable Stationery Pencil Bag Storage For Women Girls
$1.33
No MOQ
 · 
11 sold recently
Free Shipping
Plush Pencil Case Cute Heart Pattern Large Capacity Makeup Pouch Portable Travel Stationery Organizer Bag For Girls
Plush Pencil Case Cute Heart Pattern Large Capacity Makeup Pouch Portable Travel Stationery Organizer Bag For Girls
like
Find Similar
Close-up of pink plush makeup bag featuring red heart patterns and metal zipper detail - Pink Heart
Detail of soft white plush cosmetic bag featuring purple heart patterns and zip closure - Purple Heart
Detailed view of plush pouch with green heart patterns and soft texture - Green Heart
Close-up of soft plush pouch with heart pattern and fluffy faux fur texture detail - Black Heart
+1
Plush Pencil Case Cute Heart Pattern Large Capacity Makeup Pouch Portable Travel Stationery Organizer Bag For Girls
$1.53
No MOQ
 · 
14 sold recently
Pencil Cup Pen Holder Desktop Organizer Plastic Dual Compartment For Stationery Makeup Brush Nordic Style Cute 3D Patch
Pencil Cup Pen Holder Desktop Organizer Plastic Dual Compartment For Stationery Makeup Brush Nordic Style Cute 3D Patch
like
Find Similar
White desk organizer with orange fruit decor, Nordic style pen holder for cute storage - Orange
Nordic white desk organizer with cute pink pig design and grey dual compartments - Pig
White cartoon pen holder with gray double compartment lid for desk organization - Small Wings
Dark blue Nordic desk organizer with rainbow motif for pens and makeup brushes - Blue Rainbow
+8
Pencil Cup Pen Holder Desktop Organizer Plastic Dual Compartment For Stationery Makeup Brush Nordic Style Cute 3D Patch
$0.46
No MOQ
 · 
246 sold recently
Large Capacity Standing Pencil Case Canvas Portable Pen Bag Aesthetic Foldable Desktop Pen Holder Korean Style Students
Large Capacity Standing Pencil Case Canvas Portable Pen Bag Aesthetic Foldable Desktop Pen Holder Korean Style Students
like
Find Similar
Blue and white plaid fabric pencil case featuring a convenient handle and snap button - Blue Plaid
Detailed view of pink plaid pencil case with a mint green handle on a mesh tray - Pink Plaid
Close-up of a large capacity two-tone pencil case with a portable handle on a desk tray - Yellow
Detailed close-up of large capacity canvas pencil case with pink handle and blue zipper - Light Blue
Large Capacity Standing Pencil Case Canvas Portable Pen Bag Aesthetic Foldable Desktop Pen Holder Korean Style Students
$2.48
Mix MOQ : 3
 · 
159 sold recently
Kawaii Pencil Case Large Capacity Transparent PVC Mesh Zipper School Stationery Organizer Bag For Students Girls Print
Kawaii Pencil Case Large Capacity Transparent PVC Mesh Zipper School Stationery Organizer Bag For Students Girls Print
like
Find Similar
Transparent avocado pencil case with green zipper and cute cartoon prints - Large Avocado / Transparent Green
Transparent pencil case with cute avocado patterns and a green zipper for students - Small Avocado / Transparent Green
Pink checkered mesh pencil case with heart graphic and zipper closure for students - Balloon / Pink Plaid
Pink mesh pencil case with Love Candy print and zipper closure for stationery storage - English / Pink Grid
+3
Kawaii Pencil Case Large Capacity Transparent PVC Mesh Zipper School Stationery Organizer Bag For Students Girls Print
-4%
$0.80
Mix MOQ : 2
 · 
56 sold recently
Minimalist Leather Pencil Case Slim PU Pouch Zipper Stationery Organizer For School Office Universal Solid Color
Minimalist Leather Pencil Case Slim PU Pouch Zipper Stationery Organizer For School Office Universal Solid Color
like
Find Similar
Minimalist caramel brown leather pencil case with a slim zipper design and leather puller - Brown
Minimalist red leather pencil case with matching pull tab and metal zipper closure - Red
Minimalist single pen case in deep green leather with high-quality gold zipper closure - Dark Green
Minimalist navy blue leather pencil case with golden zipper for stationary storage - Blue
+1
Minimalist Leather Pencil Case Slim PU Pouch Zipper Stationery Organizer For School Office Universal Solid Color
-5%
$1.51
No MOQ
 · 
33 sold recently
Lambswool Pencil Case Fleece Plush Stationery Storage Bag With Zipper Soft Cute For School Students Office
Lambswool Pencil Case Fleece Plush Stationery Storage Bag With Zipper Soft Cute For School Students Office
like
Find Similar
Orange lamb wool pencil case with soft teddy texture and matching zipper closure - Ginger Yellow
Brown teddy fleece pencil case with soft lamb wool texture and zipper closure - Brown Coffee
Creamy white lamb velvet pencil case with soft plush texture and zipper closure - Milky White
Pink plush teddy fleece pencil case with zipper closure for student stationery - Baby Pink
+1
Lambswool Pencil Case Fleece Plush Stationery Storage Bag With Zipper Soft Cute For School Students Office
-4%
$0.69
Mix MOQ : 2
 · 
32 sold recently
Go to

More in office & school supplies

Explore more in pencil case

studentsstylekidstravelshapesimplepolyesterbag large capacityround ringmagnetic
storagestationery storage baggirlsdesktopwindowdesigndouble layergoldstraphandmade

Ready to source like an insider

Get a direct line to the factory floor — no minimums, no middlemen, no guesswork.
iconReal factory pricing, no markup in betweeniconEvery order hand-inspected before it shipsicon5,000+ new products added daily
Get Inside Access