Everful

Wholesale makeup remover

Beauty tools and accessories sourced from vetted factories, inspected before shipping.

Sign Up
Makeup Remover

Find the perfect pieces: makeup puffs & sponges, makeup mirrors, eyelid tools

filterShow Filters
Best Seller
New Arrivals
Price Drop
Free Shipping
Floral Jacquard Large Capacity Cosmetic Bag Travel Toiletry Organizer Pouch With Canvas Lining Metal Zipper For Women
Floral Jacquard Large Capacity Cosmetic Bag Travel Toiletry Organizer Pouch With Canvas Lining Metal Zipper For Women
like
Find Similar
Close-up of jacquard floral cosmetic bag with brand tag on soft white fabric background - Jacquard Green
Pink floral jacquard makeup bag with elegant orange flower patterns and ATRYG woven label - Jacquard Pink
Floral Jacquard Large Capacity Cosmetic Bag Travel Toiletry Organizer Pouch With Canvas Lining Metal Zipper For Women
$2.39
No MOQ
Women Quilted Floral Pattern Clutch Handbag Puffy Fabric Cosmetic Organizer Cloud Pouch Zip Travel Bag
Women Quilted Floral Pattern Clutch Handbag Puffy Fabric Cosmetic Organizer Cloud Pouch Zip Travel Bag
like
Find Similar
Minimalist black quilted cosmetic bag with floral daisy embroidery and nylon texture - Black
Minimalist white quilted floral makeup bag with textured flower pattern and zipper - White
Olive green quilted clutch bag with floral daisy stitching and lightweight nylon fabric - Brown
Quilted floral handbag in bright yellow finish with elegant floral stitching patterns - Yellow
+3
Women Quilted Floral Pattern Clutch Handbag Puffy Fabric Cosmetic Organizer Cloud Pouch Zip Travel Bag
$3.17
No MOQ
Cute Koala Embroidery Transparent PVC Cosmetic Bag Waterproof Portable Zipper Mini Coin Purse Storage Pouch For Women
Cute Koala Embroidery Transparent PVC Cosmetic Bag Waterproof Portable Zipper Mini Coin Purse Storage Pouch For Women
like
Find Similar
Close-up of a transparent PVC koala cosmetic bag with red zipper and embroidery - Strawberry Koala
Cute Koala Embroidery Transparent PVC Cosmetic Bag Waterproof Portable Zipper Mini Coin Purse Storage Pouch For Women
$1.59
No MOQ
Quilted Cosmetic Bag Large Capacity Toiletry Organizer Puffy PU Leather Zipper Clutch For Women Travel
Quilted Cosmetic Bag Large Capacity Toiletry Organizer Puffy PU Leather Zipper Clutch For Women Travel
like
Find Similar
Silver quilted makeup bag with metallic finish and black zipper for travel storage - Silver
Brown quilted puffer handbag with soft texture and zip closure for women fashion - Brown
Fashionable dark green quilted crossbody bag for women with glossy finish and zipper closure - Green
Dark blue quilted nylon handbag with square stitching and top zipper for women - Blue
+5
Quilted Cosmetic Bag Large Capacity Toiletry Organizer Puffy PU Leather Zipper Clutch For Women Travel
-3%
$2.99
No MOQ
Cosmetic Bag Star Pattern Canvas Portable Large Capacity Travel Toiletry Wash Bag With Handle Zipper Closure For Women
Cosmetic Bag Star Pattern Canvas Portable Large Capacity Travel Toiletry Wash Bag With Handle Zipper Closure For Women
like
Find Similar
Star pattern large makeup bag with dual zippers and handle for travel organization - 19*14.5*12cm / White
Cosmetic Bag Star Pattern Canvas Portable Large Capacity Travel Toiletry Wash Bag With Handle Zipper Closure For Women
$3.75
No MOQ
Portable Foldable Air Cushion Hairbrush With Mirror Leopard Print ABS Plastic Small Travel Massage Combs
Portable Foldable Air Cushion Hairbrush With Mirror Leopard Print ABS Plastic Small Travel Massage Combs
like
Find Similar
Portable folding hairbrush with mirror featuring a stylish leopard pattern case - Leopard Print / 8cmx8cm
Portable Foldable Air Cushion Hairbrush With Mirror Leopard Print ABS Plastic Small Travel Massage Combs
$1.30
No MOQ
Apple Shape Plush Hair Bang Sticker Velcro Cute Fruit Hair Gripper For Girls Non-Marking Hair Styling Accessory
Apple Shape Plush Hair Bang Sticker Velcro Cute Fruit Hair Gripper For Girls Non-Marking Hair Styling Accessory
like
Find Similar
Close-up of handmade crochet apple coasters with soft plush texture on white bedding - Apple (Single Pack)
Apple Shape Plush Hair Bang Sticker Velcro Cute Fruit Hair Gripper For Girls Non-Marking Hair Styling Accessory
$0.72
No MOQ
Free Shipping
Cosmetic Bag Quilted Cotton Floral Rose Bow Ribbon Travel Toiletry Organizer Zipper Soft Retro French Style Women
Cosmetic Bag Quilted Cotton Floral Rose Bow Ribbon Travel Toiletry Organizer Zipper Soft Retro French Style Women
like
Find Similar
Vintage floral quilted toiletry bag with pink bow ribbon patterns and soft cotton texture - Pink Bow Flower (Octagon Bag - Small)
Quilted floral makeup bag with pink bow ribbon and rose print in creamy white finish - Pink Bow Flower (Clutch Bag - Medium)
Quilted floral makeup bag with pink bows and roses on a white vintage vanity case - Pink Bow Flower (Cosmetic Bag - Large)
Cosmetic Bag Quilted Cotton Floral Rose Bow Ribbon Travel Toiletry Organizer Zipper Soft Retro French Style Women
$1.79-3.40
No MOQ
Quilted Polyester Cosmetic Bag Cute Puppy Embroidery Large Capacity Travel Toiletry Pouch With Strap Women Girls
Quilted Polyester Cosmetic Bag Cute Puppy Embroidery Large Capacity Travel Toiletry Pouch With Strap Women Girls
like
Find Similar
Detail of white quilted cosmetic bag featuring cute embroidered puppies and pink lanyard - White (With Lanyard)
Detail of pink quilted makeup bag with dachshund embroidery and mint green zipper handle - Pink (With Lanyard)
Detailed embroidery of cute puppies on a yellow quilted cosmetic bag with purple lanyard - Yellow (With Lanyard)
Quilted Polyester Cosmetic Bag Cute Puppy Embroidery Large Capacity Travel Toiletry Pouch With Strap Women Girls
-3%
$4.03
No MOQ
Vintage Plaid Cosmetic Bag Oxford Cloth Large Capacity Travel Toiletry Organizer Portable Handle Multi Color Style
Vintage Plaid Cosmetic Bag Oxford Cloth Large Capacity Travel Toiletry Organizer Portable Handle Multi Color Style
like
Find Similar
Detail of colorful plaid travel wash bag with sturdy handle and dual zipper closure - Retro Plaid Handbag
Vintage Plaid Cosmetic Bag Oxford Cloth Large Capacity Travel Toiletry Organizer Portable Handle Multi Color Style
$4.47
No MOQ
Heart Quilted Cotton Cosmetic Bag Checkerboard Grid Pattern Large Capacity Toiletry Storage Pouch Travel Portable
Heart Quilted Cotton Cosmetic Bag Checkerboard Grid Pattern Large Capacity Toiletry Storage Pouch Travel Portable
like
Find Similar
Detail of red checkered quilted toiletry bags with heart patterns and tassel zippers - Small / Red
Blue plaid quilted 4-piece set including large cosmetic bag and wash bags with heart patterns - Small / Blue
Heart Quilted Cotton Cosmetic Bag Checkerboard Grid Pattern Large Capacity Toiletry Storage Pouch Travel Portable
$2.16-3.60
No MOQ
Cute Cartoon Bear Embroidered Sherpa Fleece Cosmetic Bag Portable Travel Toiletry Pouch Soft Teddy Fleece Organizer
Cute Cartoon Bear Embroidered Sherpa Fleece Cosmetic Bag Portable Travel Toiletry Pouch Soft Teddy Fleece Organizer
like
Find Similar
Detailed embroidery on white teddy fleece cosmetic bag featuring a cute cartoon bear motif - Bear Embroidery Handbag / White
Close-up of brown Sherpa storage bag with pink Why Bear embroidery and cute bear pattern - Bear Embroidery Handbag / Brown
Cute Cartoon Bear Embroidered Sherpa Fleece Cosmetic Bag Portable Travel Toiletry Pouch Soft Teddy Fleece Organizer
$1.44
No MOQ
Quilted Heart Fabric Cosmetic Bag Large Capacity Toiletry Organizer Plaid Handle Cute Cartoon Patch Portable Travel Pouch
Quilted Heart Fabric Cosmetic Bag Large Capacity Toiletry Organizer Plaid Handle Cute Cartoon Patch Portable Travel Pouch
like
Find Similar
Detail of yellow quilted makeup bag featuring heart texture and red plaid handle detail - Apple Cat
Yellow quilted makeup bag with red checkered handle and plush tomato charm accessory - Creamy Yellow Apple
White quilted cosmetic bag with heart pattern and blue checkered handle and kitten charm - Cream Cat
Quilted Heart Fabric Cosmetic Bag Large Capacity Toiletry Organizer Plaid Handle Cute Cartoon Patch Portable Travel Pouch
$5.19
No MOQ
Quilted Heart Cosmetic Bag Large Capacity Portable Toiletry Pouch Kawaii Embroidery Pencil Case For Women Students
Quilted Heart Cosmetic Bag Large Capacity Portable Toiletry Pouch Kawaii Embroidery Pencil Case For Women Students
like
Find Similar
Detail of pink quilted makeup bag showing soft embossed heart patterns and zipper closure - Quilted Pleated Pink
Detailed close-up of quilted heart makeup bag with metal zipper and woven brand label - Quilted Pleated Khaki
Close-up of quilted heart makeup bag with May Rabbit label and silver zipper pull - Quilted Pleated Beige White
Close-up of pink quilted heart makeup bag featuring a silver zipper and brand woven label - Light Pink Pleated Rhombus
+6
Quilted Heart Cosmetic Bag Large Capacity Portable Toiletry Pouch Kawaii Embroidery Pencil Case For Women Students
$2.28
No MOQ
Quilted Cosmetic Bag Portable Printed Lipstick Pouch Zipper Travel Toiletry Storage For Women Cute Bowknot Heart Pattern
Quilted Cosmetic Bag Portable Printed Lipstick Pouch Zipper Travel Toiletry Storage For Women Cute Bowknot Heart Pattern
like
Find Similar
Detailed macro view of quilted floral cotton makeup bag with MAY RABBIT brand label - White Base Floral
Quilted makeup bag with brown heart patterns and MAY RABBIT tag on a desk - Quilted Vertical Stripe Heart Cream
Pink quilted cosmetic bag with red heart pattern and soft texture on a lace tablecloth - Quilted Striped Heart Pink
Close-up of quilted floral cosmetic bag with colorful heart embroidery and bow detail - Embroidered Heart Cream White
+15
Quilted Cosmetic Bag Portable Printed Lipstick Pouch Zipper Travel Toiletry Storage For Women Cute Bowknot Heart Pattern
$1.99
No MOQ
Leopard Print Cosmetic Bag Suede Square Storage Pouch For Lipstick Coin Travel Organizer Portable Small Accessory Case
Leopard Print Cosmetic Bag Suede Square Storage Pouch For Lipstick Coin Travel Organizer Portable Small Accessory Case
like
Find Similar
Detailed macro view of soft leopard print faux fur and the mayrabbit logo on a square pouch - Suede Large Leopard Print
Macro view of leopard print suede pouch next to an iPad in a stylish lifestyle setting - Suede Small Leopard Print
Leopard Print Cosmetic Bag Suede Square Storage Pouch For Lipstick Coin Travel Organizer Portable Small Accessory Case
$1.99
No MOQ
Cute Cartoon Animal Quilted Cotton Cosmetic Bag Portable Large Capacity Zipper Travel Toiletry Organizer Handbag
Cute Cartoon Animal Quilted Cotton Cosmetic Bag Portable Large Capacity Zipper Travel Toiletry Organizer Handbag
like
Find Similar
Detail view of quilted blue striped cosmetic bag with cute bear and heart patterns - Bear
Macro detail of quilted cotton fabric with cute cartoon elephant patterns and stitching - Cute Elephant
Detailed view of a pink quilted cosmetic bag with cute cartoon bear and circus motifs - Bear with Red Hat on Pink Base
Close-up of quilted cartoon makeup bag with bear prints and a woven brand label - Dessert Rabbit
+3
Cute Cartoon Animal Quilted Cotton Cosmetic Bag Portable Large Capacity Zipper Travel Toiletry Organizer Handbag
$2.82
No MOQ
Cute Popcorn Bubble Texture Cosmetic Bag Polyester Large Capacity Toiletry Organizer Clutch For Women Daily Travel Sweet
Cute Popcorn Bubble Texture Cosmetic Bag Polyester Large Capacity Toiletry Organizer Clutch For Women Daily Travel Sweet
like
Find Similar
Detailed view of the black popcorn texture and zipper on this cloud cosmetic pouch - Black
Detail of pink bubble texture fabric on a large capacity cosmetic bag with zip closure - Pink
Detail view of the yellow popcorn bubble fabric texture and metal zipper of the makeup bag - Yellow
Detail of light blue bubble textured makeup bag with premium metal zipper closure - Blue
+5
Cute Popcorn Bubble Texture Cosmetic Bag Polyester Large Capacity Toiletry Organizer Clutch For Women Daily Travel Sweet
$1.87
No MOQ
Jacquard Floral Cosmetic Bag Vintage Embroidered Toiletry Organizer Clutch Zipper Pouch Cotton Fabric For Women
Jacquard Floral Cosmetic Bag Vintage Embroidered Toiletry Organizer Clutch Zipper Pouch Cotton Fabric For Women
like
Find Similar
Floral makeup bag featuring pink rose jacquard on a textured beige canvas fabric - Embossed Peony Pink
Close-up of yellow jacquard toiletry bag with purple rose pattern and fabric label - Embossed Peony Purple
Detail of floral makeup bag with rose jacquard pattern and woven logo tag - Embossed Peony Black
Detail of floral jacquard fabric on a large makeup bag with a May Rabbit label - Embossed Blue Lotus
NewJacquard Floral Cosmetic Bag Vintage Embroidered Toiletry Organizer Clutch Zipper Pouch Cotton Fabric For Women
$3.74
No MOQ
Corduroy Mini Square Storage Bag Solid Color Portable Cosmetic Pouch Zipper Soft Travel Organizer For Women
Corduroy Mini Square Storage Bag Solid Color Portable Cosmetic Pouch Zipper Soft Travel Organizer For Women
like
Find Similar
Detail shot of the cream corduroy texture and zip closure on the square storage bag - Creamy White
Detailed macro of khaki corduroy makeup bag with MAY RABBIT label and smooth zipper - Apricot
Close-up of pink corduroy storage bag with zipper and May Rabbit fabric label detail - Nude Pink
Detail of purple corduroy square pouch featuring textured fabric and brand label - Lotus Pink
+7
Corduroy Mini Square Storage Bag Solid Color Portable Cosmetic Pouch Zipper Soft Travel Organizer For Women
$1.90
No MOQ
 · 
11 views
Mini Cosmetic Bag Portable Coin Purse Polyester Zipper Storage Pouch Macaron Color Sweet Style For Daily Travel Women
Mini Cosmetic Bag Portable Coin Purse Polyester Zipper Storage Pouch Macaron Color Sweet Style For Daily Travel Women
like
Find Similar
Detail of black portable makeup bag with vibrant pink zipper and a white woven label - Horizontal Style / Black
Detail of purple fabric mini cosmetic pouch featuring yellow zipper and pink ring pull - Horizontal Style / Purple
Detail of macaron beige cosmetic pouch with pink zipper and signature logo patch - Horizontal Style / Beige
Close-up of light blue macaron makeup bag with pink zipper and brand label details - Horizontal Style / Blue
+10
Mini Cosmetic Bag Portable Coin Purse Polyester Zipper Storage Pouch Macaron Color Sweet Style For Daily Travel Women
$2.19
No MOQ
Plush Small Square Storage Bag Soft Sherpa Leopard Print Mini Cosmetic Pouch Coin Purse Zipper Portable Travel Organizer
Plush Small Square Storage Bag Soft Sherpa Leopard Print Mini Cosmetic Pouch Coin Purse Zipper Portable Travel Organizer
like
Find Similar
Macro shot of cow print plush storage bag with soft texture and logo detail - Black Polka Dot
Close-up of a colorful patchwork plush storage bag with a white MAY RABBIT logo tag - Colored Grid
Detailed view of leopard print plush travel makeup bag with brand label and metal zipper - Khaki Large Leopard
Detailed view of leopard print sherpa storage bag with May Rabbit label on white desk - Brown Leopard Print
+9
Plush Small Square Storage Bag Soft Sherpa Leopard Print Mini Cosmetic Pouch Coin Purse Zipper Portable Travel Organizer
$2.30
No MOQ
Mini Puffy Quilted Coin Purse Shiny PU Metallic Small Wallet Heart Star Pattern Snap Button Portable Storage Pouch Bag
Mini Puffy Quilted Coin Purse Shiny PU Metallic Small Wallet Heart Star Pattern Snap Button Portable Storage Pouch Bag
like
Find Similar
Detail of silver heart-quilted pouch showing the central snap button closure - Large Heart / Silver
Detail of white quilted heart pattern pouch with a round snap button closure - Large Heart / Off-white
Detail of pink satin mini storage bag featuring heart-shaped quilted pattern and snap button - Large Heart / Light Pink
Detail of pink metallic heart quilted makeup bag with a white snap button closure - Large Heart / Pink
+4
Mini Puffy Quilted Coin Purse Shiny PU Metallic Small Wallet Heart Star Pattern Snap Button Portable Storage Pouch Bag
$1.70
No MOQ
Quilted PU Leather Cosmetic Bag Heart Pattern Waterproof Travel Toiletry Organizer Metallic Finish Zipper Pouch For Women
Quilted PU Leather Cosmetic Bag Heart Pattern Waterproof Travel Toiletry Organizer Metallic Finish Zipper Pouch For Women
like
Find Similar
Detail of pearlescent white makeup bag with heart-shaped quilting and gold zipper - Off-white Heart
Detail view of pink heart-quilted waterproof PU makeup bag with smooth zipper closure - Pink Heart
Detail of silver heart quilted PU makeup bag with metallic finish and top zipper - Silver Heart
Detail of silver quilted waterproof PU makeup bag with durable zipper and metal ring pull - Silver Rhombic Pattern
+1
Quilted PU Leather Cosmetic Bag Heart Pattern Waterproof Travel Toiletry Organizer Metallic Finish Zipper Pouch For Women
$1.82
No MOQ
Plush Cosmetic Bag Leopard Print Plaid Woolen Toiletry Organizer Travel Wash Pouch Zipper Portable
Plush Cosmetic Bag Leopard Print Plaid Woolen Toiletry Organizer Travel Wash Pouch Zipper Portable
like
Find Similar
Chic black and gray checkered wool cosmetic bag with a secure top zipper closure - Black-Grey Plaid
Large capacity striped wool makeup bag with fuzzy lambskin texture and black metal zipper - Black & White Stripes
Close-up of leopard print wool cosmetic bag with plush texture and MAY RABBIT label - Grey Leopard
Close-up of leopard print wool cosmetic bag featuring a soft texture and brown top zipper - Brown Leopard Print
Plush Cosmetic Bag Leopard Print Plaid Woolen Toiletry Organizer Travel Wash Pouch Zipper Portable
$2.30
No MOQ
Mini Square Cosmetic Bag Cotton Gingham Plaid Lipstick Pouch Portable Coin Purse Korean Ins Style Minimalist Women
Mini Square Cosmetic Bag Cotton Gingham Plaid Lipstick Pouch Portable Coin Purse Korean Ins Style Minimalist Women
like
Find Similar
Macro detail of pink checkered fabric pouch showing zipper closure and May Rabbit label - Pink Plaid
Detail of red gingham mini cosmetic bag with zipper and May Rabbit brand label - Red Check
Close-up of minimalist beige checkered storage bag with zipper and branded label - Khaki Plaid
Close-up of green checkered cotton fabric pouch with zipper and MAY RABBIT label - Green Check
+3
Mini Square Cosmetic Bag Cotton Gingham Plaid Lipstick Pouch Portable Coin Purse Korean Ins Style Minimalist Women
$1.99
No MOQ
Cosmetic Bag Cotton Canvas Zipper Portable Large Capacity Travel Storage Pouch Vintage Floral Star Patterns For Women
Cosmetic Bag Cotton Canvas Zipper Portable Large Capacity Travel Storage Pouch Vintage Floral Star Patterns For Women
like
Find Similar
Blue denim clover pattern makeup bag held by a model in a cozy lifestyle setting - Light Blue Clover
Close-up of blue polka dot makeup bag with silver zipper and white fabric label - Light Blue Polka Dot
Close-up of navy canvas makeup bag with white stars and stylish woven label detail - Dark Blue Stars
Detail of dark blue floral canvas makeup bag held by hand in a cozy lifestyle setting - Dark Blue Clover
+1
NewCosmetic Bag Cotton Canvas Zipper Portable Large Capacity Travel Storage Pouch Vintage Floral Star Patterns For Women
$2.28
No MOQ
Striped Seersucker Cosmetic Bag Large Capacity Portable Travel Toiletry Wash Storage Organizer Zipper Pouch For Women
Striped Seersucker Cosmetic Bag Large Capacity Portable Travel Toiletry Wash Storage Organizer Zipper Pouch For Women
like
Find Similar
Pink and blue striped fabric cosmetic bag with label on vintage magazine background - Pink Purple Stripes
Detailed shot of pleated striped makeup bag with zipper and mayrabbit woven label - Green Purple Stripes
Detailed view of colorful striped makeup bag with bubble texture and zipper closure - Yellow Purple Stripe
Close-up of pink striped seersucker makeup bag with a high-quality metal zipper closure - Pink & Orange Stripes
+3
Striped Seersucker Cosmetic Bag Large Capacity Portable Travel Toiletry Wash Storage Organizer Zipper Pouch For Women
$1.99
No MOQ
Quilted Rhombus Drawstring Storage Bag Embroidered Butterfly Bow Polyester Travel Cosmetic Organizer Pouch For Women
Quilted Rhombus Drawstring Storage Bag Embroidered Butterfly Bow Polyester Travel Cosmetic Organizer Pouch For Women
like
Find Similar
Detail of quilted camera pouch with pink drawstring and cute black ribbon on white background - Embroidered Beige Bow
Close-up of black quilted drawstring bag with white embroidered bows and pink ropes - Embroidered Black Bow
Quilted Rhombus Drawstring Storage Bag Embroidered Butterfly Bow Polyester Travel Cosmetic Organizer Pouch For Women
$1.70
No MOQ
Quilted Cosmetic Bag Polyester Large Capacity Travel Toiletry Organizer Floral Pattern Handheld Pouch For Women
Quilted Cosmetic Bag Polyester Large Capacity Travel Toiletry Organizer Floral Pattern Handheld Pouch For Women
like
Find Similar
Detail of white quilted floral makeup bag featuring a smooth zipper and brand label - Polyester Floral White
Close-up of pink quilted makeup bag with floral patterns and gold zipper closure - Polyester Floral Pink
Detail of light blue floral quilted pouch with delicate plum blossom stitching and ribbon - Polyester Floral Blue
Detail of yellow quilted makeup bag with wave stitching and branded woven label - Quilted Gourd Yellow
+1
Quilted Cosmetic Bag Polyester Large Capacity Travel Toiletry Organizer Floral Pattern Handheld Pouch For Women
$2.82
No MOQ
Long Coffin French Press On Nails White V Shape Tip Nude Pink Glossy Artificial Nails With Jelly Glue And File
Long Coffin French Press On Nails White V Shape Tip Nude Pink Glossy Artificial Nails With Jelly Glue And File
like
Find Similar
Long ballet press-on nails with nude pink base and white V-shaped French tips - BKS532 Crescent French (Pink White) + Jelly Glue & Nail File
Long Coffin French Press On Nails White V Shape Tip Nude Pink Glossy Artificial Nails With Jelly Glue And File
-5%
$1.04
Mix MOQ : 3
Halloween Press On Nails Long Coffin Shape Plastic Red White Spider Web Cross Gothic Design False Nails For Women Party Decoration
Halloween Press On Nails Long Coffin Shape Plastic Red White Spider Web Cross Gothic Design False Nails For Women Party Decoration
like
Find Similar
Halloween press-on nails featuring pumpkin, cross, and spider designs in red and white - Red and White Halloween Spider Web Cross Style (1XA2-13404)
Halloween Press On Nails Long Coffin Shape Plastic Red White Spider Web Cross Gothic Design False Nails For Women Party Decoration
-5%
$0.71
No MOQ
Floral Printed Linen Cosmetic Bag Mandala Pattern Travel Toiletry Organizer With Zipper And Wrist Strap
Floral Printed Linen Cosmetic Bag Mandala Pattern Travel Toiletry Organizer With Zipper And Wrist Strap
like
Find Similar
Portable Day of the Dead floral cosmetic bag with colorful mandala pattern and zipper - Mandala Floral (xy-038-01) / With Strap
Day of the Dead floral makeup bag with bird and violet flower ethnic print on black - Ethnic Birds & Flowers (xy-038-02) / With Strap
Floral makeup bag with vibrant tulip print and black zipper strap for travel - Artistic Tulip Floral (xy-038-03) / With Strap
Navy Day of the Dead makeup bag with floral mandala pattern and zipper closure - Blue Base Mandala (xy-038-04) / With Strap
+4
NewFloral Printed Linen Cosmetic Bag Mandala Pattern Travel Toiletry Organizer With Zipper And Wrist Strap
-5%
$1.26-1.31
No MOQ
Long Coffin Press On Nails Nude Pink White Snowflake Pattern Gold French Tip Winter Holiday Festive Artificial Fingernails
Long Coffin Press On Nails Nude Pink White Snowflake Pattern Gold French Tip Winter Holiday Festive Artificial Fingernails
like
Find Similar
Long coffin press-on nails in nude pink with festive white snowflakes and metallic edges - BAL007 Ballet Snowflake (Glue Style)
Long Coffin Press On Nails Nude Pink White Snowflake Pattern Gold French Tip Winter Holiday Festive Artificial Fingernails
-5%
$1.23
No MOQ
French White Press On Nails Long Coffin Ballerina Shape Rhinestone Glitter False Nails For Women Elegant Nail Stickers
French White Press On Nails Long Coffin Ballerina Shape Rhinestone Glitter False Nails For Women Elegant Nail Stickers
like
Find Similar
Long coffin press-on nails with white French design, rhinestones and silver glitter accents - White French Style (Z156) / 24Pcs Set (Glue Style)
NewFrench White Press On Nails Long Coffin Ballerina Shape Rhinestone Glitter False Nails For Women Elegant Nail Stickers
-5%
$1.86
No MOQ
Free Shipping
Nail Art Rhinestones Multi Grid Flatback Multi Shape Glass Crystal Decorations With Tweezers And Dotting Pen
Nail Art Rhinestones Multi Grid Flatback Multi Shape Glass Crystal Decorations With Tweezers And Dotting Pen
like
Find Similar
Macro view of 12-grid AB crystal nail art kit with rhinestones, tweezers and dotting pen - 12 Grids AB Rhinestone Set
Detail of 12-grid red nail art rhinestone kit with tweezers, dotting pen, and flatback gems - 12 Grids Red Rhinestone Set
Detailed nail art set with 12-grid rhinestone box, dotting pen, and tweezers on black background - 12 Grids Champagne Rhinestone Set
Detailed nail art rhinestone set with 12-grid crystal gems, tweezers and dotting pen tools - 12 Grids White Rhinestone Set
+7
NewNail Art Rhinestones Multi Grid Flatback Multi Shape Glass Crystal Decorations With Tweezers And Dotting Pen
$3.60-4.76
Mix MOQ : 3
 · 
42 views
Nail Mirror Effecting Liquid Aurora Chrome Polish Metallic Gloss For Manicure Art Decoration Professional DIY Beauty Accessory
Nail Mirror Effecting Liquid Aurora Chrome Polish Metallic Gloss For Manicure Art Decoration Professional DIY Beauty Accessory
like
Find Similar
Mirror effect nail liquid 002 showing purple metallic finish on black base and green pearl - Ice Skin Magic Liquid 02 (Color 002)
Nail mirror liquid color 003 showing effects on black and transparent bases - Ice Skin Magic Liquid 03 (Color 003)
Mirror effect nail liquid in shade 004 shown on black and transparent bases - Ice Skin Magic Liquid 04 (Color 004)
Macro detail of liquid mirror nail powder 005 showing chrome effect on black and clear base - Ice Skin Magic Liquid 05 (Color 005)
+1
Nail Mirror Effecting Liquid Aurora Chrome Polish Metallic Gloss For Manicure Art Decoration Professional DIY Beauty Accessory
$1.87
Mix MOQ : 3
 · 
11 views
Free Shipping
Solid Nail Powder Palette Gradient Mirror Chrome Pigment Aurora Sparkle Glitter Patting Application With Sponge Brushes Professional Nail Art
Solid Nail Powder Palette Gradient Mirror Chrome Pigment Aurora Sparkle Glitter Patting Application With Sponge Brushes Professional Nail Art
like
Find Similar
9-color solid mirror nail powder palette with 6 sponge brushes and gradient tips 001 - High Saturation Neon Set (CF01)
9-color solid chrome nail powder palette 002 with sponges for gradient mirror effects - Fluorescent Dazzling Set (CF02)
Detailed palette of nine solid aurora nail powders with sponges and gradient swatches - Nude Earth Tones Set (CF03)
Macro view of 9-color solid mirror nail powder palette with sponge brushes and nail tips - Vintage Red Brown Set (CF04)
Solid Nail Powder Palette Gradient Mirror Chrome Pigment Aurora Sparkle Glitter Patting Application With Sponge Brushes Professional Nail Art
$2.82
Mix MOQ : 3
 · 
10 views
Halloween Press On Nails Long Square Black Gothic Bat Star Moon Heart Pattern Plastic Fake Nails For Women Party Cosplay
Halloween Press On Nails Long Square Black Gothic Bat Star Moon Heart Pattern Plastic Fake Nails For Women Party Cosplay
like
Find Similar
Detail of Halloween press-on nails featuring red bats and silver moon star patterns - Dark Bat Moon Star Style (CW723) / Includes Jelly Glue and Rub Strip
Halloween Press On Nails Long Square Black Gothic Bat Star Moon Heart Pattern Plastic Fake Nails For Women Party Cosplay
$0.92
No MOQ
Short Square Press On Nails Hawaii Beach Palm Tree Summer French False Nails For Women Glossy ABS Plastic DIY Manicure
Short Square Press On Nails Hawaii Beach Palm Tree Summer French False Nails For Women Glossy ABS Plastic DIY Manicure
like
Find Similar
Short square press-on nails with tropical palm trees and colorful floral summer designs - Summer Beach Coconut Style (CW556)
Short Square Press On Nails Hawaii Beach Palm Tree Summer French False Nails For Women Glossy ABS Plastic DIY Manicure
$0.92
No MOQ
Long Coffin Press On Nails Gradient Red Pink Glossy With 3D Blue Bowknot Heart Star Design Fake Nails For Women
Long Coffin Press On Nails Gradient Red Pink Glossy With 3D Blue Bowknot Heart Star Design Fake Nails For Women
like
Find Similar
1 option
Long Coffin Press On Nails Gradient Red Pink Glossy With 3D Blue Bowknot Heart Star Design Fake Nails For Women
-4%
$0.77
No MOQ
French Press On Nails Short Square Round Nude Pink White Stripes Glossy Artificial Fingernails For Women
French Press On Nails Short Square Round Nude Pink White Stripes Glossy Artificial Fingernails For Women
like
Find Similar
Short oval french manicure nails with pink and white diagonal stripes on a nude base - With Glue Style / French White and Pink Diagonal Stripes (W1144)
French Press On Nails Short Square Round Nude Pink White Stripes Glossy Artificial Fingernails For Women
-17%
$0.38
No MOQ
Professional Powder Brush Eye Shadow Brush Contour Brush Synthetic Fiber Bristles Wood Handle Portable Cosmetic Collection
Professional Powder Brush Eye Shadow Brush Contour Brush Synthetic Fiber Bristles Wood Handle Portable Cosmetic Collection
like
Find Similar
Blue makeup brush storage bag with elegant ribbon bow and multiple functional slots - Blue
Pink PU leather makeup brush roll bag with elegant satin bow tie and stitched slots - Pink Bag
Pink PU leather storage pouch for makeup brushes with stylish silver snap closure - Pink Button Pouch
Blue marble texture PU leather makeup brush holder cylinder with metal snap closure - Blue Empty Cylinder
+8
Professional Powder Brush Eye Shadow Brush Contour Brush Synthetic Fiber Bristles Wood Handle Portable Cosmetic Collection
-5%
$1.37-8.21
No MOQ
Professional Angled Contour Brush With Soft Synthetic Fiber Hair And Long Wood Handle For Face Sculpting Highlighting
Professional Angled Contour Brush With Soft Synthetic Fiber Hair And Long Wood Handle For Face Sculpting Highlighting
like
Find Similar
Angled contour makeup brush with white synthetic bristles and black handle by RANCAI - Angled Contour Brush
Professional RANCAI angled contour brush with soft synthetic bristles and black handle - Small Flame Brush
Professional Angled Contour Brush With Soft Synthetic Fiber Hair And Long Wood Handle For Face Sculpting Highlighting
-4%
$0.96
Mix MOQ : 3
Professional Double Ended Eyebrow Brush And Angled Eyeliner Brush Synthetic Fiber Bristles Wood Handle Rose Gold Ferrule
Professional Double Ended Eyebrow Brush And Angled Eyeliner Brush Synthetic Fiber Bristles Wood Handle Rose Gold Ferrule
like
Find Similar
Dual-ended eyebrow spoolie brush and angled eyeliner brush set with rose gold metal ferrules - Set of 2 (Double Ended Lash Comb/Eyeliner Black Gold)
Professional Double Ended Eyebrow Brush And Angled Eyeliner Brush Synthetic Fiber Bristles Wood Handle Rose Gold Ferrule
-5%
$0.81
No MOQ
5D Relief Nail Stickers Gold Foil Leaf Flower Patterns With Micro Rhinestones Self Adhesive Waterproof Manicure Decals
5D Relief Nail Stickers Gold Foil Leaf Flower Patterns With Micro Rhinestones Self Adhesive Waterproof Manicure Decals
like
Find Similar
5D gold leaf nail stickers with floral patterns on a gradient manicure set - Gold Bronzing Plant & Flower Style (CO-221)
5D Relief Nail Stickers Gold Foil Leaf Flower Patterns With Micro Rhinestones Self Adhesive Waterproof Manicure Decals
$0.78
No MOQ
Halloween Nail Art Stickers Embossed Horror Blood Wound Eyeball Design Carnival Party Manicure Decoration
Halloween Nail Art Stickers Embossed Horror Blood Wound Eyeball Design Carnival Party Manicure Decoration
like
Find Similar
3D Halloween nail stickers with red bloody wounds and eyeball designs for party decoration - Bloody Red Wound Stitches Style (FEB-890)
Halloween Nail Art Stickers Embossed Horror Blood Wound Eyeball Design Carnival Party Manicure Decoration
$0.58
No MOQ
5D Embossed Nail Art Stickers Ocean Sea Animal Cartoon Dolphin Jellyfish Waterproof Self Adhesive Manicure Decals
5D Embossed Nail Art Stickers Ocean Sea Animal Cartoon Dolphin Jellyfish Waterproof Self Adhesive Manicure Decals
like
Find Similar
3D embossed ocean world nail stickers with translucent jellyfish and dolphin designs - Ocean Animal Series (CO-232)
5D Embossed Nail Art Stickers Ocean Sea Animal Cartoon Dolphin Jellyfish Waterproof Self Adhesive Manicure Decals
$0.63
No MOQ
Large Capacity Cosmetic Bag Polyester Memory Fabric Waterproof Travel Toiletry Organizer With Handle Portable For Women
Large Capacity Cosmetic Bag Polyester Memory Fabric Waterproof Travel Toiletry Organizer With Handle Portable For Women
like
Find Similar
Navy blue large capacity memory fabric travel toiletry bag with white graphic print - Ink Blue
Large Capacity Cosmetic Bag Polyester Memory Fabric Waterproof Travel Toiletry Organizer With Handle Portable For Women
$3.86
No MOQ
Portable Canvas Cosmetic Bag Travel Toiletry Organizer Pencil Case Cartoon Flower Initial Letter Print Storage Pouch
Portable Canvas Cosmetic Bag Travel Toiletry Organizer Pencil Case Cartoon Flower Initial Letter Print Storage Pouch
like
Find Similar
Detail of hand holding a navy blue makeup bag with vibrant 3D floral embroidery patterns - Dark Blue Sunflower Embroidery Style (jiayingpbb074)
Canvas makeup bag with forest mushroom print and zipper closure held by hand - Black Forest Mushroom Illustration (jiayingpbb075)
White canvas cosmetic bag featuring a cute cartoon capybara print and zipper closure - White Cartoon Capybara Paradise (jiayingpbb076)
Handheld view of black canvas pouch with floral wreath design and white letter A detail - Black Floral Letter A (jiayingpbb077)
+15
Portable Canvas Cosmetic Bag Travel Toiletry Organizer Pencil Case Cartoon Flower Initial Letter Print Storage Pouch
$1.01
No MOQ
 · 
12 views
Cosmetic Bag Canvas Zippered Travel Storage Pouch Peace Love Soccer Gymnastics Sports Theme Portable Organiser
Cosmetic Bag Canvas Zippered Travel Storage Pouch Peace Love Soccer Gymnastics Sports Theme Portable Organiser
like
Find Similar
Portable cream canvas makeup bag with Peace Love Gymnastics print and zipper closure - Peace Love Gymnastics Print (Style 2)
Peace Love Soccer theme canvas toiletry bags in cream white with black zipper closures - Peace Love Soccer Print (Style 1)
Cosmetic Bag Canvas Zippered Travel Storage Pouch Peace Love Soccer Gymnastics Sports Theme Portable Organiser
-4%
$1.37
No MOQ
Cosmetic Bag Geometric Horse Print Linen Portable Toiletry Pouch Travel Storage Organizer With Zipper Wrist Strap For Women
Cosmetic Bag Geometric Horse Print Linen Portable Toiletry Pouch Travel Storage Organizer With Zipper Wrist Strap For Women
like
Find Similar
Cream canvas cosmetic bag with abstract geometric horse print and black hand strap - 17*25cm (Linen) with Strap / Abstract Horse Pattern (Style 1)
Cosmetic Bag Geometric Horse Print Linen Portable Toiletry Pouch Travel Storage Organizer With Zipper Wrist Strap For Women
-4%
$1.37
No MOQ
Artistic Colorful Geometric Cosmetic Bag Fine Linen Portable Toiletry Organizer With Wristlet Strap Zipper Travel Pouch
Artistic Colorful Geometric Cosmetic Bag Fine Linen Portable Toiletry Organizer With Wristlet Strap Zipper Travel Pouch
like
Find Similar
Portable geometric makeup bag with colorful abstract print and durable zipper - 17*25cm (Linen) with Strap / Colorful Geometric Patchwork (SN-476)
Artistic Colorful Geometric Cosmetic Bag Fine Linen Portable Toiletry Organizer With Wristlet Strap Zipper Travel Pouch
-4%
$1.37
No MOQ
Cosmetic Bag Imitation Linen Portable Zippered Toiletry Pouch With Wrist Strap Winter Dog Sled Print Holiday Gift Organizer
Cosmetic Bag Imitation Linen Portable Zippered Toiletry Pouch With Wrist Strap Winter Dog Sled Print Holiday Gift Organizer
like
Find Similar
Black canvas makeup bag with winter dog sled print and convenient wrist strap - 17*25cm (Linen) with Strap / Dog Sled Print (Style 1)
Cosmetic Bag Imitation Linen Portable Zippered Toiletry Pouch With Wrist Strap Winter Dog Sled Print Holiday Gift Organizer
-4%
$1.37
No MOQ
Sunflower Floral Print Cosmetic Bag Portable Imitation Linen Travel Toiletry Pouch With Zipper And Wristlet Strap For Women
Sunflower Floral Print Cosmetic Bag Portable Imitation Linen Travel Toiletry Pouch With Zipper And Wristlet Strap For Women
like
Find Similar
Sunflower pattern makeup bag with black zipper and wristlet strap on white background - Style 1
Portable floral makeup bag featuring vibrant sunflower print with zipper and wrist strap - Style 2
Portable floral makeup bag with yellow sunflower print and a black wristlet strap - Style 3
Portable toiletry bag with sunflower and daisy print on dark canvas fabric - Style 4
NewSunflower Floral Print Cosmetic Bag Portable Imitation Linen Travel Toiletry Pouch With Zipper And Wristlet Strap For Women
-4%
$1.37
No MOQ
St Patricks Day Cosmetic Bag Leprechaun Shamrock Print Fine Linen Zippered Toiletry Pouch With Hand Strap For Women
St Patricks Day Cosmetic Bag Leprechaun Shamrock Print Fine Linen Zippered Toiletry Pouch With Hand Strap For Women
like
Find Similar
St. Patrick's Day canvas makeup bag featuring lucky leprechaun and clover prints - St. Patrick's Day Leprechaun Shamrock Style
St Patricks Day Cosmetic Bag Leprechaun Shamrock Print Fine Linen Zippered Toiletry Pouch With Hand Strap For Women
-4%
$1.37
No MOQ
Vintage Floral Cosmetic Bag Linen Zippered Travel Toiletry Organizer Portable Pouch With Wristlet For Women Aesthetic
Vintage Floral Cosmetic Bag Linen Zippered Travel Toiletry Organizer Portable Pouch With Wristlet For Women Aesthetic
like
Find Similar
Floral makeup bag with vintage illustration of vanity items and black wristlet strap - Vintage Vanity Tools Pattern (Style 1) / 17x25cm (Fine Linen)
Toiletry bag featuring blue and purple vintage floral patterns with a wrist strap - Blue-Purple Lotus Floral Pattern (Style 2) / 17x25cm (Fine Linen)
Vintage Floral Cosmetic Bag Linen Zippered Travel Toiletry Organizer Portable Pouch With Wristlet For Women Aesthetic
-4%
$1.37
No MOQ
Cosmetic Bag Fine Linen Floral Print Zipper Pouch Travel Toiletry Organizer With Wristlet For Women Mother Gift
Cosmetic Bag Fine Linen Floral Print Zipper Pouch Travel Toiletry Organizer With Wristlet For Women Mother Gift
like
Find Similar
Blue canvas Mother's Day makeup bag with floral print and Happy Mother's Day text - Happy Mother's Day Floral Print (Style 1)
Cosmetic Bag Fine Linen Floral Print Zipper Pouch Travel Toiletry Organizer With Wristlet For Women Mother Gift
-4%
$1.37
No MOQ
Cosmetic Bag Fine Linen Zippered Pouch Heart Pattern With Hand Strap Travel Toiletry Organizer Funny Quote Print
Cosmetic Bag Fine Linen Zippered Pouch Heart Pattern With Hand Strap Travel Toiletry Organizer Funny Quote Print
like
Find Similar
Black canvas makeup bag with pink hearts and 'I have enough makeup' slogan - Black & Pink Heart Quote Design (Style 1)
Cosmetic Bag Fine Linen Zippered Pouch Heart Pattern With Hand Strap Travel Toiletry Organizer Funny Quote Print
-4%
$1.37
No MOQ
Linen Cosmetic Bag Heart Letter Print Zipper Pouch Travel Toiletry Storage Case With Handle Strap Gift For Couples
Linen Cosmetic Bag Heart Letter Print Zipper Pouch Travel Toiletry Storage Case With Handle Strap Gift For Couples
like
Find Similar
Beige canvas makeup bag with black Mr. Right letter print and zipper closure - Mr. Right Style
Beige canvas cosmetic bag featuring black 'Mrs. always Right' text and pink hearts - Mrs. always Right with Heart Style
Canvas makeup bag with 'Mr. Right' text and pink hearts in cream white finish - Mr. Right with Heart Style
Off-white canvas makeup bag with 'Mrs. Always Right' text and black wrist strap - Mrs. always Right Style
Linen Cosmetic Bag Heart Letter Print Zipper Pouch Travel Toiletry Storage Case With Handle Strap Gift For Couples
-4%
$1.37
No MOQ
Go to

More in beauty

Explore more in makeup remover

diytoolsplasticnaturalheartfiber false eyelashespartyglovelayerfacial cleaning puffs
carecleaningdoublefingertravelhangingstrapstylewoven

Ready to source like an insider

Get a direct line to the factory floor — no minimums, no middlemen, no guesswork.
iconReal factory pricing, no markup in betweeniconEvery order hand-inspected before it shipsicon5,000+ new products added daily
Get Inside Access