Everful

Wholesale makeup remover

Beauty tools and accessories sourced from vetted factories, inspected before shipping.

Sign Up
Makeup Remover

Find the perfect pieces: makeup puffs & sponges, makeup mirrors, eyelid tools

filterShow Filters
Best Seller
New Arrivals
Price Drop
Free Shipping
Fine Linen Makeup Bag Women Zipper Toiletry Pouch Portable Travel Cosmetic Organizer Letter Print Z 1920 Wrist Strap
Fine Linen Makeup Bag Women Zipper Toiletry Pouch Portable Travel Cosmetic Organizer Letter Print Z 1920 Wrist Strap
like
Find Similar
White canvas cosmetic pouch with blue Z 1920 print, black zipper, and wrist strap - Z 1920 Print Style (Style 1) / 17*25cm (Linen) with Strap
Fine Linen Makeup Bag Women Zipper Toiletry Pouch Portable Travel Cosmetic Organizer Letter Print Z 1920 Wrist Strap
-5%
$1.51
No MOQ
Plaid Makeup Bag Cotton Large Capacity Cosmetic Pouch With Lace Trim And Ribbon Bowknot Zipper Storage Organizer Women
Plaid Makeup Bag Cotton Large Capacity Cosmetic Pouch With Lace Trim And Ribbon Bowknot Zipper Storage Organizer Women
like
Find Similar
Checkered makeup bag with black ribbon bow and elegant lace trim in monochrome finish - Black and White Plaid Trim
Plaid Makeup Bag Cotton Large Capacity Cosmetic Pouch With Lace Trim And Ribbon Bowknot Zipper Storage Organizer Women
-5%
$2.99
No MOQ
Floral Jacquard Cosmetic Bag Canvas Makeup Organizer Travel Clutch Purse Women Artistic Flower Zip Toiletry Bag
Floral Jacquard Cosmetic Bag Canvas Makeup Organizer Travel Clutch Purse Women Artistic Flower Zip Toiletry Bag
like
Find Similar
Detailed texture of floral jacquard canvas makeup bag with simple wish label and zipper - W27cmxH18cmxBottom5cm / Flesh Pink
Floral Jacquard Cosmetic Bag Canvas Makeup Organizer Travel Clutch Purse Women Artistic Flower Zip Toiletry Bag
$4.70
Mix MOQ : 3
Vintage Woolen Checkered Cosmetic Bag Retro Tweed Leopard Print Makeup Storage Pouch Zippered Travel Toiletry Case
Vintage Woolen Checkered Cosmetic Bag Retro Tweed Leopard Print Makeup Storage Pouch Zippered Travel Toiletry Case
like
Find Similar
Vintage coffee brown plaid wool makeup bag with Pleasant Time tag and soft texture - Blue Purple Black
Vintage Woolen Checkered Cosmetic Bag Retro Tweed Leopard Print Makeup Storage Pouch Zippered Travel Toiletry Case
-5%
$1.89
No MOQ
Quilted Cotton Makeup Bag Blue Floral Large Capacity Travel Toiletry Organizer With Handle Double Zipper For Women
Quilted Cotton Makeup Bag Blue Floral Large Capacity Travel Toiletry Organizer With Handle Double Zipper For Women
like
Find Similar
Close-up of quilted floral cosmetic bag with blue flower patterns and soft cotton texture - Blue Flower
Quilted Cotton Makeup Bag Blue Floral Large Capacity Travel Toiletry Organizer With Handle Double Zipper For Women
$3.43
No MOQ
Floral Cosmetic Bag Zipper Closure Elegant Calla Lily Print Jacquard Fabric Toiletry Makeup Organizer Pouch For Women
Floral Cosmetic Bag Zipper Closure Elegant Calla Lily Print Jacquard Fabric Toiletry Makeup Organizer Pouch For Women
like
Find Similar
Elegant floral makeup bag with orange poppy print and yellow zipper on fabric background - Calla Lily Orange Floral
Floral Cosmetic Bag Zipper Closure Elegant Calla Lily Print Jacquard Fabric Toiletry Makeup Organizer Pouch For Women
-4%
$2.71
No MOQ
Quilted Cotton Cosmetic Bag Large Capacity Toiletry Organizer With Handle Floral Bear Pattern Travel Makeup Pouch
Quilted Cotton Cosmetic Bag Large Capacity Toiletry Organizer With Handle Floral Bear Pattern Travel Makeup Pouch
like
Find Similar
Cream quilted cosmetic bag with vintage floral bear pattern and dual zippers - Flower Bear
Quilted Cotton Cosmetic Bag Large Capacity Toiletry Organizer With Handle Floral Bear Pattern Travel Makeup Pouch
-12%
$4.03
No MOQ
Quilted Gingham Cosmetic Bag Heart Pattern Cotton Makeup Storage Pouch Portable Sanitary Napkin Organizer Ins Style
Quilted Gingham Cosmetic Bag Heart Pattern Cotton Makeup Storage Pouch Portable Sanitary Napkin Organizer Ins Style
like
Find Similar
Detail of blue and white checkered quilted cosmetic bag with heart-shaped stitching - Blue Plaid
Quilted Gingham Cosmetic Bag Heart Pattern Cotton Makeup Storage Pouch Portable Sanitary Napkin Organizer Ins Style
-4%
$2.44
No MOQ
Quilted Gingham Cosmetic Bag Cotton Makeup Pouch Portable Travel Storage Organizer Soft Checkered Handheld Case For Women
Quilted Gingham Cosmetic Bag Cotton Makeup Pouch Portable Travel Storage Organizer Soft Checkered Handheld Case For Women
like
Find Similar
Close-up of pink checkered quilted vanity bag with durable woven strap and fabric label - Pink Plaid Wristlet Bag
Macro detail of a green gingham quilted cosmetic bag with woven handle and fabric label - Green Plaid Wristlet Bag
Quilted checkered cotton cosmetic bags in pink and green with melody embroidery - Pink Plaid Cosmetic Bag
Pink and green plaid quilted cotton makeup bags set in a cozy minimalist aesthetic style - Pink Plaid Clutch Bag
+1
NewQuilted Gingham Cosmetic Bag Cotton Makeup Pouch Portable Travel Storage Organizer Soft Checkered Handheld Case For Women
-5%
$2.05-2.74
No MOQ
Corduroy Shoulder Bag Strawberry Print Kawaii Tote Handbag Large Capacity Casual Sweet Makeup Organizer For Women
Corduroy Shoulder Bag Strawberry Print Kawaii Tote Handbag Large Capacity Casual Sweet Makeup Organizer For Women
like
Find Similar
Close-up of white corduroy tote bag with red strawberry print on soft plush surface - Shoulder Tote Bag / Single Strap Double Layer Beige
Corduroy Shoulder Bag Strawberry Print Kawaii Tote Handbag Large Capacity Casual Sweet Makeup Organizer For Women
-4%
$3.26
No MOQ
Cute Checkered Makeup Bag Polyester Plush 3D Cartoon Dog Storage Pouch Zipper Closure Small Cosmetic Bag For Women
Cute Checkered Makeup Bag Polyester Plush 3D Cartoon Dog Storage Pouch Zipper Closure Small Cosmetic Bag For Women
like
Find Similar
Pink checkered cosmetic bag with cute plush puppy 3D design and smooth metal zipper - Puppy Pink Plaid
Green checkered makeup pouch with cute 3D fuzzy monster face and secure zipper closure - Puppy Green Plaid
Blue plaid cartoon dog cosmetic bag with 3D plush ears and embroidered face details - Puppy Blue Plaid
Cute yellow checkered cosmetic bag with 3D cartoon plush design and zipper closure - Puppy Yellow Plaid
Cute Checkered Makeup Bag Polyester Plush 3D Cartoon Dog Storage Pouch Zipper Closure Small Cosmetic Bag For Women
$3.46
No MOQ
Cute Cartoon Puppy Makeup Bag Large Capacity Fabric Portable Handle Cosmetic Storage Case Korean Style Contrast Color Zipper
Cute Cartoon Puppy Makeup Bag Large Capacity Fabric Portable Handle Cosmetic Storage Case Korean Style Contrast Color Zipper
like
Find Similar
Brown canvas patchwork dog makeup bag with The Jolly House text and cartoon patterns - Large / Milky Yellow
Dual-tone coffee and cream toiletry bag with 'The Jolly House' print and sturdy handle - Small / Milky Yellow
Blue dog embroidery vanity bag with red handles and The Jolly House patch design - Large / Sea Salt Blue
Blue and white puppy makeup bag with red handles and The Jolly House branding - Small / Sea Salt Blue
Cute Cartoon Puppy Makeup Bag Large Capacity Fabric Portable Handle Cosmetic Storage Case Korean Style Contrast Color Zipper
$3.75-6.63
No MOQ
Plush Makeup Bag Rhomboid Quilted Large Capacity Cosmetic Case Portable Travel Storage Pouch Zipper Closure For Women
Plush Makeup Bag Rhomboid Quilted Large Capacity Cosmetic Case Portable Travel Storage Pouch Zipper Closure For Women
like
Find Similar
Detailed view of the lilac plush shell-shaped cosmetic bag with zipper and logo label - Purple
Detail of pink plush quilted makeup bag with zipper and logo in cozy setting - Pink
Detail of plush quilted cosmetic bag with silver double zippers and embroidery label - Brown
Detail of dark brown plush shell makeup bag with quilted texture and double zippers - Brown
Plush Makeup Bag Rhomboid Quilted Large Capacity Cosmetic Case Portable Travel Storage Pouch Zipper Closure For Women
$3.45
No MOQ
Smiley Face Corduroy Makeup Bag For Women Retro Simple Cosmetic Pouch With Zipper Closure Travel Storage Handheld Clutch
Smiley Face Corduroy Makeup Bag For Women Retro Simple Cosmetic Pouch With Zipper Closure Travel Storage Handheld Clutch
like
Find Similar
Detail of light blue corduroy makeup bag with black smiley faces and zip closure - Light Blue Smiley Face
Detailed texture of brown corduroy makeup bag with smiley pattern and logo tag - Brown Smile
Close-up of gray corduroy makeup bag featuring black smiley prints and top zipper detail - Gray Smiley Face
Detail of corduroy makeup bag featuring a smiley pattern and May Rabbit woven label - Creamy White Smiley Face
Smiley Face Corduroy Makeup Bag For Women Retro Simple Cosmetic Pouch With Zipper Closure Travel Storage Handheld Clutch
-5%
$1.89
No MOQ
Quilted Cotton Makeup Bag Zipper Storage Pouch Floral Stripe Pattern Portable Cosmetic Organizer Travel Clutch Women
Quilted Cotton Makeup Bag Zipper Storage Pouch Floral Stripe Pattern Portable Cosmetic Organizer Travel Clutch Women
like
Find Similar
Quilted cotton makeup bag with colorful stripes and dots shown on a wooden table - Colorful Stripes and Dots
Detailed macro view of blue floral quilted cotton makeup bag with secure zip closure - Blue Flower
Quilted cotton bag with hand-drawn animal illustrations held by a woman in soft knitwear - Rabbit Family
Quilted cotton makeup bag with colorful rainbow, sun, and bear prints for travel use - Graffiti
Quilted Cotton Makeup Bag Zipper Storage Pouch Floral Stripe Pattern Portable Cosmetic Organizer Travel Clutch Women
$3.11
No MOQ
Mini Corduroy Lipstick Bag Cute Floral Bow Portable Cosmetic Pouch Small Storage Bag Students Makeup Organizer
Mini Corduroy Lipstick Bag Cute Floral Bow Portable Cosmetic Pouch Small Storage Bag Students Makeup Organizer
like
Find Similar
Detailed close-up of blue corduroy cosmetic bag with floral pattern and metal zipper - Blue Plaid Bow
Detail of a brown corduroy makeup bag with bow patterns and floral prints in a cozy setting - Brown Plaid Bowknot
Detailed view of cream corduroy makeup bag with bow patterns and zipper closure - White with Plaid Bow
Detail of pink corduroy lipstick pouch with small floral pattern and secure zipper closure - Pink Floral
Mini Corduroy Lipstick Bag Cute Floral Bow Portable Cosmetic Pouch Small Storage Bag Students Makeup Organizer
$1.70
No MOQ
Quilted Makeup Bag Cartoon Animal Print Portable Seersucker Cosmetic Pouch Travel Toiletry Storage Organizer Cute For Women
Quilted Makeup Bag Cartoon Animal Print Portable Seersucker Cosmetic Pouch Travel Toiletry Storage Organizer Cute For Women
like
Find Similar
Close-up of quilted cream makeup bag featuring blue stripes and cute cartoon bear print - Bear
Detail of cute elephant floral toiletry bag in off-white seersucker fabric material - Cute Elephant
Pink seersucker makeup bag with embossed bear pattern and MAY RABBIT label - Bear with Red Hat on Pink Base
Close-up of quilted puff fabric makeup bag with cute cartoon rabbit and floral prints - Dessert Rabbit
Quilted Makeup Bag Cartoon Animal Print Portable Seersucker Cosmetic Pouch Travel Toiletry Storage Organizer Cute For Women
$1.99
No MOQ
Bow Embroidery Striped Plaid Makeup Bag Cotton Canvas Portable Cosmetic Pouch Travel Storage Organizer For Women
Bow Embroidery Striped Plaid Makeup Bag Cotton Canvas Portable Cosmetic Pouch Travel Storage Organizer For Women
like
Find Similar
Detail of light blue plaid cosmetic bag with bow embroidery and zipper closure - Blue Grid Blue Bow
Detail of striped toiletry bag featuring blue bow embroidery and side woven label - White Blue Stripe Blue Bow
Detail of red bow embroidery on blue and white striped fabric toiletry storage bag - Blue Stripe Red Bow
Detail of blue striped makeup bag featuring delicate bow embroidery and soft cotton texture - Blue White Stripe Blue Bow
Bow Embroidery Striped Plaid Makeup Bag Cotton Canvas Portable Cosmetic Pouch Travel Storage Organizer For Women
$2.28
No MOQ
Professional Makeup Brush Large Powder Foundation Contour Flame Brushes Wood Handle Soft Synthetic Fiber
Professional Makeup Brush Large Powder Foundation Contour Flame Brushes Wood Handle Soft Synthetic Fiber
like
Find Similar
Large loose powder makeup brush with soft black and white gradient synthetic bristles - Single Black Powder Brush
Angled foundation makeup brush with black and white synthetic bristles, 18.5cm long - Single Black Contour Brush
Flat head makeup brush with black handle and white-tipped bristles for foundation - Single Black Flat Head Brush
Large foundation brush with black handle and dual-tone dome bristles for makeup - Single Black Flame Brush
Professional Makeup Brush Large Powder Foundation Contour Flame Brushes Wood Handle Soft Synthetic Fiber
$1.30-1.59
Mix MOQ : 3
Professional Makeup Brushes Synthetic Fiber Gradient Bristles Aluminum Tube Portable Cosmetic Tools For Eye Shadow
Professional Makeup Brushes Synthetic Fiber Gradient Bristles Aluminum Tube Portable Cosmetic Tools For Eye Shadow
like
Find Similar
7pcs makeup brush set with colorful handles and gradient bristles on white background - 7Pcs Multicolor Black Handle
7pcs makeup brush set with rose gold gradient handles and bicolor bristles on white background - 7Pcs Multicolor Pink Handle
7-piece makeup brush set with purple metallic handles and clear tips on white background - 7Pcs Multicolor Transparent Handle
7-piece professional makeup brush set with pink transparent handles and silver ferrules - 7Pcs Silver Transparent Handle
Professional Makeup Brushes Synthetic Fiber Gradient Bristles Aluminum Tube Portable Cosmetic Tools For Eye Shadow
$4.27
Mix MOQ : 3
Professional Makeup Brushes Cosmetic Beauty Tools Wood Aluminum Synthetic Fiber With Waterproof PU Bag
Professional Makeup Brushes Cosmetic Beauty Tools Wood Aluminum Synthetic Fiber With Waterproof PU Bag
like
Find Similar
12-piece professional makeup brush set with silver ferrules and black zipper travel case - Black Silver Set (With Waterproof Bag)
Close-up of 13 professional makeup brushes with rose gold ferrules and a black travel case - Flesh Color Set (With Waterproof Bag)
15-piece makeup brush set with black handles and zippered travel pouch in black - Black Silver Set (With Waterproof Bag)
14-piece makeup brush set in black and rose gold with matching portable travel bag - Black Gold Set (With Waterproof Bag)
Professional Makeup Brushes Cosmetic Beauty Tools Wood Aluminum Synthetic Fiber With Waterproof PU Bag
$7.20-8.36
No MOQ
Retractable Foundation Brush Portable Travel Makeup Tool With Lid Aluminum Tube Fiber Bristles Black
Retractable Foundation Brush Portable Travel Makeup Tool With Lid Aluminum Tube Fiber Bristles Black
like
Find Similar
Portable black retractable foundation brush with soft gradient bristles and cap - Small Flat Top Telescopic Brush
Portable retractable angled foundation brush in sleek black finish with matching protective cap - Small Flat Angled Telescopic Brush
Portable retractable flat head foundation brush with dual-tone synthetic bristles and lid - Small Round Angled Telescopic Brush
Portable black retractable foundation brush with dual-tone synthetic bristles and protective cap - Small Retractable Round Head Brush
Retractable Foundation Brush Portable Travel Makeup Tool With Lid Aluminum Tube Fiber Bristles Black
$1.30
No MOQ
Makeup Brush Set Professional Synthetic Fiber Bristles Aluminum Tube Ribbed Transparent Handle Soft Gradient Beauty Tools
Makeup Brush Set Professional Synthetic Fiber Bristles Aluminum Tube Ribbed Transparent Handle Soft Gradient Beauty Tools
like
Find Similar
10pcs professional makeup brush set with pink transparent handles and gradient bristles - Pink Transparent Handle (9Pcs)
9-piece makeup brush set with transparent green handles and blue gradient bristles - Green Transparent Handle (9Pcs)
9-piece makeup brush set with purple transparent prism handles and soft gradient bristles - Purple Transparent Handle (9Pcs)
10-piece makeup brush set with clear amber handles and soft pink synthetic bristles - Orange Transparent Handle (9Pcs)
Makeup Brush Set Professional Synthetic Fiber Bristles Aluminum Tube Ribbed Transparent Handle Soft Gradient Beauty Tools
$5.48
Mix MOQ : 3
Professional Concealer Brush Tongue Shape Lip Brush Synthetic Fiber Bristles Wood Handle Makeup Detail Tool
Professional Concealer Brush Tongue Shape Lip Brush Synthetic Fiber Bristles Wood Handle Makeup Detail Tool
like
Find Similar
Flat tongue concealer brush with orange bristles, silver ferrule and matte black handle - Concealer Brush Black/Silver
Pro tongue-shaped concealer brush with orange bristles and rose gold ferrule - Concealer Brush Black/Gold
Concealer brush with orange fibers, rose gold ferrule and lavender handle on white background - Concealer Brush Purple/Gold
Professional tongue-shaped concealer and lip brush with RANCAI logo and rose gold ferrule - Concealer Brush Black/Gold (with Logo)
Professional Concealer Brush Tongue Shape Lip Brush Synthetic Fiber Bristles Wood Handle Makeup Detail Tool
$0.40
Mix MOQ : 3
Professional Eye Makeup Brushes Synthetic Fiber Geometric Handle Eyeshadow Eyeliner Blending Cosmetic Beauty Tools
Professional Eye Makeup Brushes Synthetic Fiber Geometric Handle Eyeshadow Eyeliner Blending Cosmetic Beauty Tools
like
Find Similar
5-piece pink diamond handle eye makeup brush set with silver ferrules and soft bristles - 5 Pcs Eye Brush Set / Pink
5-piece eye makeup brush set with white faceted resin handles and silver ferrules - 5 Pcs Eye Brush Set / White
5-piece yellow diamond handle eye makeup brush set with soft gradient synthetic bristles - 5 Pcs Eye Brush Set / Yellow
Deep blue sparkly 5-piece eye makeup brush set with gradient gray bristles - 5 Pcs Eye Brush Set / Blue
Professional Eye Makeup Brushes Synthetic Fiber Geometric Handle Eyeshadow Eyeliner Blending Cosmetic Beauty Tools
-5%
$2.08
Mix MOQ : 3
Free Shipping
Professional Makeup Brushes Synthetic Fiber Bristles Plastic Handle For Eye Face Foundation Blending Contouring Beauty Tools
Professional Makeup Brushes Synthetic Fiber Bristles Plastic Handle For Eye Face Foundation Blending Contouring Beauty Tools
like
Find Similar
13-piece eye makeup brush set with white matte handles and silver ferrules - 12 Pieces / White
13-piece professional eye makeup brush set with pink handles and silver ferrules - 12 Pieces / Pink
12-piece professional dark blue makeup brush set with synthetic bristles and silver ferrule - 12 Pieces / Blue
Professional 13pcs black makeup brush set with silver ferrules and white gradient bristles - 12 Pieces / Black
Professional Makeup Brushes Synthetic Fiber Bristles Plastic Handle For Eye Face Foundation Blending Contouring Beauty Tools
-5%
$2.60
Mix MOQ : 3
Heart Shaped Foundation Brush Flat Top BB Cream Makeup Tool Synthetic Fiber Wood Handle Aluminum Ferrule For Beginners
Heart Shaped Foundation Brush Flat Top BB Cream Makeup Tool Synthetic Fiber Wood Handle Aluminum Ferrule For Beginners
like
Find Similar
Heart-shaped foundation brush with pink gradient bristles and black glossy handle - Heart Shaped (Rose Red Black)
Detailed macro view of dual-tone synthetic bristles and tropical floral print brush handle - Heart Shaped (Gold Tube Floral Handle)
Detailed view of an angled foundation brush with pink ombre bristles and floral handle - Heart Shaped (Rose Red Tube Floral Handle)
Detail of heart shaped foundation brush with rose gold ferrule and synthetic bristles - Heart Shaped (Black Gold)
Heart Shaped Foundation Brush Flat Top BB Cream Makeup Tool Synthetic Fiber Wood Handle Aluminum Ferrule For Beginners
-5%
$1.23
No MOQ
Professional Makeup Brushes Soft Synthetic Fiber Wood Handle Portable Travel Cosmetic Tools For Powder Foundation Eyeshadow
Professional Makeup Brushes Soft Synthetic Fiber Wood Handle Portable Travel Cosmetic Tools For Powder Foundation Eyeshadow
like
Find Similar
Flat lay of 8-piece mini makeup brush set with pink bristles and matte wood handles - Pink
8-piece mini portable makeup brush set with grey-blue wooden handles and soft fiber bristles - Blue
8-piece mini portable makeup brush set with wooden handles for face and eyes - Gray
8-piece mini portable makeup brush set with wooden handles and champagne gold ferrules - Apricot
Professional Makeup Brushes Soft Synthetic Fiber Wood Handle Portable Travel Cosmetic Tools For Powder Foundation Eyeshadow
-5%
$2.05
Mix MOQ : 3
Professional Makeup Brushes Soft Synthetic Fiber Wood Handle Full Face Cosmetic Tools Aesthetic Powder Foundation Eye Brushes
Professional Makeup Brushes Soft Synthetic Fiber Wood Handle Full Face Cosmetic Tools Aesthetic Powder Foundation Eye Brushes
like
Find Similar
14-piece makeup brush set with green metal ferrules, blue wooden handles and storage pouch - Blue With Cloth Bag (With Logo)
13-piece professional makeup brush set with metallic green ferrule and blue gradient handles - Blue OPP Bag (With Logo)
13-piece makeup brush set with Morandi light blue wooden handles and soft synthetic bristles - Blue OPP Bag (No Logo)
Light blue 13pcs makeup brush set with soft grey bristles and dark green velvet pouch - Blue With Cloth Bag (No Logo)
Professional Makeup Brushes Soft Synthetic Fiber Wood Handle Full Face Cosmetic Tools Aesthetic Powder Foundation Eye Brushes
$7.49-9.51
No MOQ
Professional Makeup Brushes With Pony Hair Synthetic Fiber Wood Handle Powder Foundation Eye Shadow Brushes And PU Storage Bag
Professional Makeup Brushes With Pony Hair Synthetic Fiber Wood Handle Powder Foundation Eye Shadow Brushes And PU Storage Bag
like
Find Similar
9pcs professional makeup brush set with soft hair for eyeshadow and powder - Light Brown With Logo
9-piece makeup brush set with soft beige handles and gold ferrules for face and eyes - Light Brown Without Logo
9-piece makeup brush set with matte champagne handles and mauve velvet storage pouch - Light Brown With Logo and Bag
Sleek black velvet makeup brush roll-up pouch for organized professional cosmetic tools - Black Empty 9-Slot Bag
Professional Makeup Brushes With Pony Hair Synthetic Fiber Wood Handle Powder Foundation Eye Shadow Brushes And PU Storage Bag
-28%
$1.37-5.48
No MOQ
Professional Makeup Brushes Synthetic Fiber Bristles Diamond Cutting Design Gradient Color Beauty Tools For Face Eyes
Professional Makeup Brushes Synthetic Fiber Bristles Diamond Cutting Design Gradient Color Beauty Tools For Face Eyes
like
Find Similar
20pcs unicorn diamond makeup brush set with gradient handles and rose gold ferrules - Green Coffee Gradient Diamond
20pcs unicorn diamond makeup brush set with purple blue gradient handles and soft bristles - Purple Gradient Diamond
20-piece rose gold unicorn makeup brush set with pink gradient bristles on white display - Rose Gold Diamond
20-piece makeup brush set featuring blue gradient bristles and glitter handles - Transparent Glitter
Professional Makeup Brushes Synthetic Fiber Bristles Diamond Cutting Design Gradient Color Beauty Tools For Face Eyes
-4%
$4.25
No MOQ
Portable Retractable Makeup Brush Synthetic Fiber Powder Blush Tool With Dust Cover Capsule Shape Travel Mini
Portable Retractable Makeup Brush Synthetic Fiber Powder Blush Tool With Dust Cover Capsule Shape Travel Mini
like
Find Similar
Portable capsule makeup brush with mint green handle and white-to-green gradient bristles - Light Blue
Detail view of the capsule retractable makeup brush showing the gold ring and cap - Black
Portable retractable makeup brush with clear dustproof cap and golden metal ring detail - White
Portable lavender retractable makeup brush with a protective cap and compact capsule design - Lavender
NewPortable Retractable Makeup Brush Synthetic Fiber Powder Blush Tool With Dust Cover Capsule Shape Travel Mini
$1.44
No MOQ
Dual Ended Makeup Brushes Synthetic Fiber Bristles Wood Handle Professional Face Eye Beauty Tools Cosmetic Application
Dual Ended Makeup Brushes Synthetic Fiber Bristles Wood Handle Professional Face Eye Beauty Tools Cosmetic Application
like
Find Similar
12-piece professional dual-ended makeup brush set with dark brown handles and copper ferrules - 12-Piece Double-ended Brush Set - Coffee
10-piece dual-ended makeup brush set with black matte handles and grey synthetic bristles - 10-Piece Double-ended Brush Set - Coffee
Dual-ended makeup brush with gradient bristles and metallic purple handle for powder and blush - Double-ended Powder/Blush Brush
Dual-ended makeup brush with round powder brush and angled contour brush in brown metal - Double-ended Powder/Foundation Brush
Dual Ended Makeup Brushes Synthetic Fiber Bristles Wood Handle Professional Face Eye Beauty Tools Cosmetic Application
$2.02-10.09
Mix MOQ : 3
Free Shipping
Professional Makeup Brushes Wood Handle Synthetic Fibers Foundation Eyeshadow Blending Travel Portable Beauty Tool Kit
Professional Makeup Brushes Wood Handle Synthetic Fibers Foundation Eyeshadow Blending Travel Portable Beauty Tool Kit
like
Find Similar
14-piece makeup brush set with pink handles and rose gold ferrules on white background - Portable Flesh Tone Set / Flesh/Pink
14-piece travel makeup brush set with black handles and dual-tone synthetic bristles - Portable Black Handle Set / Black
Detail view of 14 professional makeup brushes with soft synthetic hair and purple ferrules - Portable Black Handle Purple Tube Set / Black/Purple
14-piece makeup brush set with dark brown handles and two-tone synthetic bristles - Portable Coffee Color Set / Coffee
Professional Makeup Brushes Wood Handle Synthetic Fibers Foundation Eyeshadow Blending Travel Portable Beauty Tool Kit
$4.90
No MOQ
Double Layer Mesh Makeup Bag Breathable Toiletry Storage Pouch Portable Travel Cosmetic Organizer Large Capacity
Double Layer Mesh Makeup Bag Breathable Toiletry Storage Pouch Portable Travel Cosmetic Organizer Large Capacity
like
Find Similar
Dual-layer black mesh toiletry bag with vibrant pink zippers and top handle strap - Black
Minimalist double-layer mesh travel cosmetic bag in grey with orange zipper details - Gray
Rose red mesh travel toiletry bag with double-layer breathable storage and top handle - Rose Red
Purple mesh dual-layer travel makeup bag with breathable fabric and yellow zipper - Purple
Double Layer Mesh Makeup Bag Breathable Toiletry Storage Pouch Portable Travel Cosmetic Organizer Large Capacity
-5%
$2.41
No MOQ
Floral Heart Printed Makeup Bag Fine Linen Valentine's Day Cosmetic Pouch With Zipper And Wrist Strap For Women
Floral Heart Printed Makeup Bag Fine Linen Valentine's Day Cosmetic Pouch With Zipper And Wrist Strap For Women
like
Find Similar
Pink cosmetic bag with floral heart pattern and I love you print with wrist strap - I Love You Floral Style (Style 1)
Pink canvas cosmetic bag featuring a floral heart and Happy Valentine's Day print - Happy Valentine's Day Heart Cluster Style (Style 2)
Pink canvas cosmetic bag with floral heart and Happy Valentine's Day text print - Happy Valentine's Day Blooming Heart Style (Style 3)
Pink canvas makeup bag featuring I Love You print and floral pattern with black strap - I Love You Fresh Floral Style (Style 4)
Floral Heart Printed Makeup Bag Fine Linen Valentine's Day Cosmetic Pouch With Zipper And Wrist Strap For Women
-4%
$1.37
No MOQ
Cute Bear Striped Makeup Bag Imitation Linen Portable Cosmetic Toiletry Pouch Travel Storage Organizer Handle Zipper
Cute Bear Striped Makeup Bag Imitation Linen Portable Cosmetic Toiletry Pouch Travel Storage Organizer Handle Zipper
like
Find Similar
Cute striped makeup bag with panda and strawberry motifs and a black carry handle - Panda & Cloud Cartoon Style (Style 1)
Pink striped cosmetic bag featuring cute bear flower patterns and a black wrist strap - Pink Vertical Striped Bear (Style 3)
Pink striped bear makeup bag with floral patterns, zipper closure, and hand strap handle - Pink Cherry Bow Bear Style (Style 4)
Cute striped bear and floral makeup bag with cartoon dog pattern and zipper closure - Strawberry Cake Cartoon Dog Style (Style 2)
Cute Bear Striped Makeup Bag Imitation Linen Portable Cosmetic Toiletry Pouch Travel Storage Organizer Handle Zipper
-4%
$1.37
No MOQ
Teddy Bear Heart Print Makeup Bag Polyester Linen Texture Zippered Portable Toiletry Pouch With Practical Wristlet Strap
Teddy Bear Heart Print Makeup Bag Polyester Linen Texture Zippered Portable Toiletry Pouch With Practical Wristlet Strap
like
Find Similar
Canvas makeup bag with teddy bear and heart prints, featuring a zipper and black handle - Teddy Bear with Wings (Style 1)
Cream canvas pouch with cute bear and heart prints featuring a black wrist strap - Flying Teddy Bear with Hearts (Style 2)
Cream makeup bag with winged bear and heart prints featuring a black top handle - Watercolor Bear with Envelope (Style 3)
Portable cream teddy bear and heart print makeup bag with black zipper and wristlet strap - Teddy Bear with Red Hearts (Style 4)
Teddy Bear Heart Print Makeup Bag Polyester Linen Texture Zippered Portable Toiletry Pouch With Practical Wristlet Strap
-4%
$1.37
No MOQ
Easter Rabbit Egg Print Linen Makeup Bag Zipper Cosmetic Pouch Portable Travel Toiletries Storage Case Stationery Bag
Easter Rabbit Egg Print Linen Makeup Bag Zipper Cosmetic Pouch Portable Travel Toiletries Storage Case Stationery Bag
like
Find Similar
Easter egg and bunny print canvas makeup bag with black zipper and wrist strap - Rabbit and Hand-drawn Eggs Style (Style 1)
Easter egg canvas makeup bag with watercolor rabbit print and black zipper strap - Realistic Watercolor Rabbit Style (Style 2)
Easter bunny and egg printed makeup bag with black zipper and carry handle - Vintage Easter Illustration Style (Style 3)
Easter egg canvas makeup bag with watercolor rabbit print and black zipper handle - Rabbit Green Leaf and Yellow Flower Pattern Style (Style 4)
Easter Rabbit Egg Print Linen Makeup Bag Zipper Cosmetic Pouch Portable Travel Toiletries Storage Case Stationery Bag
-4%
$1.37
No MOQ
St. Patricks Day Makeup Bag Fine Linen Toiletry Pouch Portable Zippered Wristlet Handbag Gnome Unicorn Owl Print Gift For Women
St. Patricks Day Makeup Bag Fine Linen Toiletry Pouch Portable Zippered Wristlet Handbag Gnome Unicorn Owl Print Gift For Women
like
Find Similar
St. Patrick's Day unicorn cosmetic bag with clover graphics and black wristlet - Unicorn Pattern (Style 1)
St. Patrick's Day makeup bag with festive owl print and Lucky Clover decoration - Owl Pattern (Style 2)
Canvas makeup bag featuring green leprechaun gnome and floral pattern with strap - Gnome Pattern (Style 3)
St. Patrick's Day makeup bag with leprechaun print and black wrist strap for women - Leprechaun Pattern (Style 4)
St. Patricks Day Makeup Bag Fine Linen Toiletry Pouch Portable Zippered Wristlet Handbag Gnome Unicorn Owl Print Gift For Women
-4%
$1.37
No MOQ
St. Patrick's Day Makeup Bag Linen Cosmetic Pouch With Wristlet Clover Leprechaun Travel Toiletry Storage Organizer
St. Patrick's Day Makeup Bag Linen Cosmetic Pouch With Wristlet Clover Leprechaun Travel Toiletry Storage Organizer
like
Find Similar
Clover unicorn makeup bag with green hat pattern and convenient black wristlet strap - St. Patrick's Day Unicorn Style (Style 1)
St. Patrick's Day makeup bag with green teddy bear clover pattern and black wristlet - Irish Little Bear Style (Style 2)
Off-white canvas cosmetic bag with St. Patrick's Day bear and shamrock print - Bear with Striped Hat (Style 3)
St. Patrick's Day makeup bag featuring a cartoon bear and green shamrock patterns - Green Shirt Bear Style (Style 4)
St. Patrick's Day Makeup Bag Linen Cosmetic Pouch With Wristlet Clover Leprechaun Travel Toiletry Storage Organizer
-4%
$1.37
No MOQ
St Patricks Day Makeup Bag Linen Like Polyester Portable Zipper Cosmetic Pouch With Wristlet Clover Rabbit Pattern Travel Wash Bag
St Patricks Day Makeup Bag Linen Like Polyester Portable Zipper Cosmetic Pouch With Wristlet Clover Rabbit Pattern Travel Wash Bag
like
Find Similar
St. Patrick's Day makeup bag with festive bunny and clover print on black canvas - Style 1
St. Patrick's Day makeup bag with cartoon rabbit and lucky clover on black fabric - Style 2
Canvas makeup bag featuring a St. Patrick's Day bunny with green hat and shamrock pattern - Style 3
St. Patrick's Day makeup bag with clover rabbit pattern and convenient wrist strap - Style 4
St Patricks Day Makeup Bag Linen Like Polyester Portable Zipper Cosmetic Pouch With Wristlet Clover Rabbit Pattern Travel Wash Bag
-4%
$1.37
No MOQ
St Patricks Day Makeup Bag Linen Cosmetic Pouch With Zipper And Wrist Strap Clover Print Festive Toiletry Organizer
St Patricks Day Makeup Bag Linen Cosmetic Pouch With Zipper And Wrist Strap Clover Print Festive Toiletry Organizer
like
Find Similar
St. Patrick's Day makeup bag with green clover and dental prints for toiletries - Smile Teeth Leprechaun Style
White St. Patrick's Day makeup bag with green owl clover patterns and wristlet strap - Owl with Green Hat Style
Canvas St. Patrick's Day makeup bag with cartoon rabbit and lucky clover print - Cartoon Rabbit Rainbow Style
White canvas St. Patrick's Day makeup bag with gnome and clover print and wristlet - Leprechaun Harp Gold Style
St Patricks Day Makeup Bag Linen Cosmetic Pouch With Zipper And Wrist Strap Clover Print Festive Toiletry Organizer
-4%
$1.37
No MOQ
St Patrick's Day Makeup Bag Imitation Linen Cosmetic Pouch With Zipper Wristlet Clover Print Travel Toiletry Organizer
St Patrick's Day Makeup Bag Imitation Linen Cosmetic Pouch With Zipper Wristlet Clover Print Travel Toiletry Organizer
like
Find Similar
Canvas St. Patrick's Day makeup bag with clover print and wrist strap in beige - Leprechaun & Shamrock Design (Style 1)
Linen St. Patrick's Day makeup bag featuring green clovers and leprechaun patterns - Shamrock & Festive Greeting Design (Style 2)
St. Patrick's Day makeup bag with green clover and gnome patterns on beige canvas - Gnome & All-over Shamrock Design (Style 3)
St. Patrick's Day themed makeup bag with clover print and cartoon hat design - Green Hat Cartoon Figure Design (Style 4)
St Patrick's Day Makeup Bag Imitation Linen Cosmetic Pouch With Zipper Wristlet Clover Print Travel Toiletry Organizer
-4%
$1.37
No MOQ
St Patrick Day Makeup Bag Polyester Linen Texture Cartoon Bunny Clover Print Zipper Toiletry Pouch With Wristlet Strap
St Patrick Day Makeup Bag Polyester Linen Texture Cartoon Bunny Clover Print Zipper Toiletry Pouch With Wristlet Strap
like
Find Similar
St. Patrick's Day makeup bag with cartoon rabbit and lucky shamrock print and wristlet - Style 1 / 17x25cm (With Wrist Strap)
White canvas St. Patrick's Day makeup bag with festive green rabbit and clover pattern - Style 2 / 17x25cm (With Wrist Strap)
St. Patrick's Day makeup bag with cartoon rabbit print and convenient wrist strap - Style 3 / 17x25cm (With Wrist Strap)
St. Patrick's Day bunny cosmetic bag with green hat and shamrock prints on white canvas - Style 4 / 17x25cm (With Wrist Strap)
St Patrick Day Makeup Bag Polyester Linen Texture Cartoon Bunny Clover Print Zipper Toiletry Pouch With Wristlet Strap
-4%
$1.37
No MOQ
Floral Print Makeup Bag Linen Fabric Zippered Cosmetic Pouch With Hand Strap Portable Travel Toiletry Organizer Bag
Floral Print Makeup Bag Linen Fabric Zippered Cosmetic Pouch With Hand Strap Portable Travel Toiletry Organizer Bag
like
Find Similar
Cream floral canvas makeup bag with pink watercolor flowers and a convenient wristlet strap - Pink Flower and Cotton Boll Print (Style 1)
Floral print canvas makeup bag with black zipper and wristlet strap in beige color - Colorful Small Floral Print (Style 2)
Floral makeup bag with blue wood grain texture and daisy print featuring a wrist strap - Blue Wood Grain Daisy Print (Style 3)
Floral canvas makeup bag with watercolor flowers, black zipper and wristlet strap - Wildflower and Butterfly Print (Style 4)
NewFloral Print Makeup Bag Linen Fabric Zippered Cosmetic Pouch With Hand Strap Portable Travel Toiletry Organizer Bag
-4%
$1.37
No MOQ
Valentine's Day Makeup Bag For Women Rose Lips Print Linen Cosmetic Pouch With Zipper And Wrist Strap Portable Travel Organizer
Valentine's Day Makeup Bag For Women Rose Lips Print Linen Cosmetic Pouch With Zipper And Wrist Strap Portable Travel Organizer
like
Find Similar
Beige canvas makeup bag with red rose and lip print for Valentine's Day storage - Cyan Lips Rose Style
White canvas Valentine's Day cosmetic bag with leopard print lip and red rose motif - Leopard Print Lips Rose Style
Canvas Valentine's Day makeup bag with red rose and lip print on cream background - Pink Lips Rose Style
Canvas makeup bag with purple lips and red rose design for Valentine's Day - Purple Lips Rose Style
Valentine's Day Makeup Bag For Women Rose Lips Print Linen Cosmetic Pouch With Zipper And Wrist Strap Portable Travel Organizer
-4%
$1.37
No MOQ
Floral Canvas Cosmetic Bag Cute Jacquard Bow Makeup Pouch Portable Travel Zipper Toiletry Organizer For Women
Floral Canvas Cosmetic Bag Cute Jacquard Bow Makeup Pouch Portable Travel Zipper Toiletry Organizer For Women
like
Find Similar
Pink striped cotton makeup bag with bow patterns and zipper on a wooden tray detail - Pink Striped Bowknot
Floral cotton makeup bag with orange flower patterns on a wooden display stand - Green Leaves Red Small Flowers
Close-up of white floral cotton makeup bag on wooden board with soft lighting - Elegant Red Flowers
Close-up of floral jacquard cotton makeup bag with brand label on a wooden stand - Blue Leaves Red Large Flowers
Floral Canvas Cosmetic Bag Cute Jacquard Bow Makeup Pouch Portable Travel Zipper Toiletry Organizer For Women
$2.25
No MOQ
Nylon Makeup Bag Letter Honey Embroidery Travel Toiletry Organizer Pouch Korean Style Portable For Women Students
Nylon Makeup Bag Letter Honey Embroidery Travel Toiletry Organizer Pouch Korean Style Portable For Women Students
like
Find Similar
Purple nylon makeup bag with honey embroidery and large capacity for travel storage - Deep purple
Detailed close-up of a pink nylon cosmetic bag with honey embroidery and satin handle - Pink
Light blue nylon makeup bag with honey embroidery and quilted texture for travel - Sky Blue
Detail view of cream nylon pouch with honey letter embroidery and gold zipper closure - Pale Grey
NewNylon Makeup Bag Letter Honey Embroidery Travel Toiletry Organizer Pouch Korean Style Portable For Women Students
-4%
$2.74
No MOQ
Quilted Cotton Sanitary Napkin Storage Bag Bow Embroidery Portable Makeup Pouch Sweet Heart Pattern For Women Girls
Quilted Cotton Sanitary Napkin Storage Bag Bow Embroidery Portable Makeup Pouch Sweet Heart Pattern For Women Girls
like
Find Similar
Close-up of white quilted pouch with pink bow embroidery and a sweet lettering detail - Single Bow / Pink Embroidered
White quilted sanitary pouch with black bow embroidery and 'sweet' text variant - Single Bow / Black Embroidery
Detailed interior of white quilted pouch with sweet embroidery and bow accent - Multiple Bows / Pink Embroidered
Detail of white quilted pouch with black bow and sweet embroidery on cotton fabric - Multiple Bows / Black Embroidery
Quilted Cotton Sanitary Napkin Storage Bag Bow Embroidery Portable Makeup Pouch Sweet Heart Pattern For Women Girls
-5%
$1.61-1.70
No MOQ
Floral Cotton Seersucker Makeup Bag Zipper Cosmetic Organizer Puffy Texture Handheld Clutch For Travel Daily Use Women
Floral Cotton Seersucker Makeup Bag Zipper Cosmetic Organizer Puffy Texture Handheld Clutch For Travel Daily Use Women
like
Find Similar
Macro detail of floral cotton pouch with zip closure and white fabric label - Black Background Small Flowers
Detail of floral print makeup bag with vintage woven label and smooth zipper closure - Black with Big White Flower
Close-up of black quilted daisy pouch with a Time to Party label held by a hand - Black Background Daisy
Detail of floral seersucker cosmetic bag with black leaf prints and zipper closure - White Black Branches
Floral Cotton Seersucker Makeup Bag Zipper Cosmetic Organizer Puffy Texture Handheld Clutch For Travel Daily Use Women
$4.03
No MOQ
Vintage Plaid Canvas Makeup Bag Retro British Style Cosmetic Pouch Travel Toiletry Organizer Zipper Clutch For Women
Vintage Plaid Canvas Makeup Bag Retro British Style Cosmetic Pouch Travel Toiletry Organizer Zipper Clutch For Women
like
Find Similar
Detail showing vintage plaid fabric pouch with Time to Party label on white cloth - Blue Purple Check
Detailed macro view of vintage brown plaid makeup bag featuring a Time to Party fabric label - Blue & Coffee Plaid
Detail of vintage plaid canvas pouch featuring a 'TIME TO PARTY' label in a lifestyle setting - Brown Small Plaid
Macro view of vintage brown checkered fabric pouch texture on an elegant white background - Coffee Plaid
NewVintage Plaid Canvas Makeup Bag Retro British Style Cosmetic Pouch Travel Toiletry Organizer Zipper Clutch For Women
$3.46
No MOQ
Floral Print Cotton Makeup Bag Large Capacity Travel Cosmetic Storage Organizer Zipper Clutch Handbag Pastoral Style Women
Floral Print Cotton Makeup Bag Large Capacity Travel Cosmetic Storage Organizer Zipper Clutch Handbag Pastoral Style Women
like
Find Similar
Macro detail of floral cotton makeup bag with pink peonies and secure zipper - Pink Large Flowers
Close-up of floral cotton makeup bag with simple wish label and soft lavender patterns - Violet
Detail of floral printed cotton cosmetic bag with simple wish label and zip closure - Blue Green Striped Floral
Detailed close-up of a floral cotton makeup bag with yellow stripes and simple wish label - Yellow Blue Striped Flowers
NewFloral Print Cotton Makeup Bag Large Capacity Travel Cosmetic Storage Organizer Zipper Clutch Handbag Pastoral Style Women
$4.55
Mix MOQ : 3
Large Floral Cotton Canvas Makeup Bag Travel Toiletry Organizer Portable Zipper Pouch Women Pastoral Style Rabbit Pattern
Large Floral Cotton Canvas Makeup Bag Travel Toiletry Organizer Portable Zipper Pouch Women Pastoral Style Rabbit Pattern
like
Find Similar
Detail of floral cotton makeup bag with rabbit prints and simple wish woven label - Green Rabbit
Detailed view of large capacity floral cotton makeup bag with simple wish label and zip - Blue Green Floral
Macro detail of floral cotton fabric texture and simple wish label on the makeup bag - Yellow-Orange Floral
Detail view of floral print cotton makeup bag with simple wish label and hair accessories - Watercolor Pink Green
Large Floral Cotton Canvas Makeup Bag Travel Toiletry Organizer Portable Zipper Pouch Women Pastoral Style Rabbit Pattern
$4.55
Mix MOQ : 3
Striped Cat Print Cosmetic Bag Cotton Canvas Zipper Makeup Pouch Travel Organizer For Women Girls Retro Cute
Striped Cat Print Cosmetic Bag Cotton Canvas Zipper Makeup Pouch Travel Organizer For Women Girls Retro Cute
like
Find Similar
Detailed view of pink striped canvas makeup bag with cute cat prints and fabric label - Pink Stripe Cat
Detailed close-up of retro cat print cotton makeup bag with a sturdy metal zipper - Red Stripe Cat
Detail view of a blue striped cat print canvas makeup bag with a secure zipper closure - Light Blue Stripe Cat
Detail of red striped cotton cosmetic bag with cute rabbit prints and zipper closure - White Red Stripe Rabbit
Striped Cat Print Cosmetic Bag Cotton Canvas Zipper Makeup Pouch Travel Organizer For Women Girls Retro Cute
$4.55
No MOQ
Quilted Cotton Cosmetic Bag Floral Grid Mini Makeup Pouch Travel Toiletry Storage Zipper Canvas Padded Case
Quilted Cotton Cosmetic Bag Floral Grid Mini Makeup Pouch Travel Toiletry Storage Zipper Canvas Padded Case
like
Find Similar
Macro detail of quilted floral cotton makeup bag with French label and zipper closure - Light Blue Stripe Grid Floral
Close-up of floral quilted cotton makeup bag with beige zipper and vintage fabric label - Blue Red Beige Big Grid Floral
Close-up of quilted cotton floral cosmetic bags with soft fabric texture and zipper detail - Blue Green Small Grid Small Flower
Detailed collection of quilted floral and checkered cotton cosmetic bags with zippers - Brick Red Large Grid Rabbit Floral
Quilted Cotton Cosmetic Bag Floral Grid Mini Makeup Pouch Travel Toiletry Storage Zipper Canvas Padded Case
$4.03
No MOQ
Quilted Cotton Makeup Bag Cute Animal Floral Print Zippered Cosmetic Storage Pouch Travel Organizer Soft Padded
Quilted Cotton Makeup Bag Cute Animal Floral Print Zippered Cosmetic Storage Pouch Travel Organizer Soft Padded
like
Find Similar
Detail of quilted fabric pouch with cute purple rabbit and green floral print - Striped Rabbit Floral
Detailed view of a white quilted cotton makeup bag featuring cute brown bear patterns - Striped Bear
Close-up of cream quilted cosmetic bag with cute bear prints and a woven label detail - Striped Elephant
Detailed view of hand-held quilted cotton pouch with cute puppy and cherry patterns - Striped Cat
Quilted Cotton Makeup Bag Cute Animal Floral Print Zippered Cosmetic Storage Pouch Travel Organizer Soft Padded
$4.38
No MOQ
Quilted Cotton Makeup Bag Cartoon Animal Print Soft Zipper Toiletry Storage Pouch Handheld Organizer Clutch
Quilted Cotton Makeup Bag Cartoon Animal Print Soft Zipper Toiletry Storage Pouch Handheld Organizer Clutch
like
Find Similar
Close-up of quilted cotton cosmetic bag featuring rabbit prints and simple wish label - Striped Rabbit Floral
Quilted cotton hand pouch with cute animal prints held to show soft texture and size - Striped Bear
Close-up of quilted cotton cosmetic bag with cute cartoon bear and dog patterns - Striped Cat
Detail of quilted cotton pouch with animal prints and simple wish woven label - Striped Elephant
Quilted Cotton Makeup Bag Cartoon Animal Print Soft Zipper Toiletry Storage Pouch Handheld Organizer Clutch
$4.70
No MOQ
Women Cosmetic Makeup Bag Cotton Canvas Zipper Pouch Bow Floral Print Sweet Small Travel Toiletry Organizer Handheld
Women Cosmetic Makeup Bag Cotton Canvas Zipper Pouch Bow Floral Print Sweet Small Travel Toiletry Organizer Handheld
like
Find Similar
Detail of pink bow pattern makeup bag with 'simple wish' woven label and zipper - Light Purple Polka Dot Bow
Close-up of floral makeup bag with simple wish label and smooth zipper closure - Colorful Floral Bow
Handheld view of a cotton makeup bag featuring a sweet pink bow print and top zipper - Rose Pink Fine Bow
Detail of a pink bow patterned fabric makeup bag featuring a simple wish cloth label - Light Blue Polka Dot Pink Bow
Women Cosmetic Makeup Bag Cotton Canvas Zipper Pouch Bow Floral Print Sweet Small Travel Toiletry Organizer Handheld
$3.89
No MOQ
Floral Cotton Cosmetic Bag Zipper Storage Pouch Makeup Organizer Phone Bag Japanese Style Portable Travel Handbag
Floral Cotton Cosmetic Bag Zipper Storage Pouch Makeup Organizer Phone Bag Japanese Style Portable Travel Handbag
like
Find Similar
Detail of floral makeup bag with lavender print, dots, and a simple cream hair claw clip - White Purple Striped Bellflower
Detail of light purple floral pouch with metallic zipper and a cream simple wish tag - White Base Light Purple Small Floral Cutout
Macro detail of floral cotton pouches with delicate patterns and simple wish woven label - Purple Coffee Striped Floral Cutout
Close-up of floral fabric pouches and a handmade hair claw clip on a wooden tray - White Base Light Purple Khaki Hydrangea
Floral Cotton Cosmetic Bag Zipper Storage Pouch Makeup Organizer Phone Bag Japanese Style Portable Travel Handbag
$3.89
No MOQ
Go to

More in beauty

Explore more in makeup remover

diytoolsplasticnaturalheartfiber false eyelashespartyglovelayerfacial cleaning puffs
carecleaningdoublefingertravelhangingstrapstylewoven

Ready to source like an insider

Get a direct line to the factory floor — no minimums, no middlemen, no guesswork.
iconReal factory pricing, no markup in betweeniconEvery order hand-inspected before it shipsicon5,000+ new products added daily
Get Inside Access