Everful

Wholesale makeup remover

Beauty tools and accessories sourced from vetted factories, inspected before shipping.

Sign Up
Makeup Remover

Find the perfect pieces: makeup puffs & sponges, makeup mirrors, eyelid tools

filterShow Filters
Best Seller
New Arrivals
Price Drop
Free Shipping
Floral Plant Print Cosmetic Bag Imitation Linen Makeup Pouch With Zipper And Wristlet For Travel Toiletries Storage Women
Floral Plant Print Cosmetic Bag Imitation Linen Makeup Pouch With Zipper And Wristlet For Travel Toiletries Storage Women
like
Find Similar
Floral print cosmetic bag in dark green featuring realistic leaf patterns and hand strap - Fine Hemp / Dark Green Seaweed Style / 17*25cm With Webbing
Floral makeup bag with dark green tropical leaves pattern and a black zipper closure - Fine Hemp / Tropical Plant Leaf Style / 17*25cm With Webbing
Green cosmetic bag with bamboo leaf print and durable zipper for travel storage - Fine Hemp / Fresh Emerald Bamboo Leaf Style / 17*25cm With Webbing
Floral makeup bag with lush green leaf pattern and secure zipper closure and hand strap - Fine Hemp / Lush Green Leaf Style / 17*25cm With Webbing
Floral Plant Print Cosmetic Bag Imitation Linen Makeup Pouch With Zipper And Wristlet For Travel Toiletries Storage Women
-4%
$1.37
No MOQ
Fashion Leopard Print Plush Square Makeup Bag For Women Soft Faux Fur Cosmetic Storage Pouch Mini Coin Purse Travel Bag
Fashion Leopard Print Plush Square Makeup Bag For Women Soft Faux Fur Cosmetic Storage Pouch Mini Coin Purse Travel Bag
like
Find Similar
Detailed view of pink leopard plush makeup bag with zipper and woven Hisocute label - Pink
Detail view of leopard print plush cosmetic bag with pink brand label and cord - Black
Detail of leopard print plush makeup bag featuring a pink brand label and soft faux fur texture - Yellow
Macro view of blue leopard plush makeup bag with pink woven label and soft texture - Blue
+2
Fashion Leopard Print Plush Square Makeup Bag For Women Soft Faux Fur Cosmetic Storage Pouch Mini Coin Purse Travel Bag
$1.90
Mix MOQ : 2
Quilted Gingham Makeup Bag Cotton Checkered Toiletry Organizer Pouch Travel Portable Cosmetic Storage Case Women
Quilted Gingham Makeup Bag Cotton Checkered Toiletry Organizer Pouch Travel Portable Cosmetic Storage Case Women
like
Find Similar
Red and white checkered quilted 4-piece cosmetic bag set with top handle and zippers - Large Makeup Bag with Ribbon (Red Gingham)
Quilted Gingham Makeup Bag Cotton Checkered Toiletry Organizer Pouch Travel Portable Cosmetic Storage Case Women
$1.44-3.46
Mix MOQ : 3
Cute Capybara Cartoon Acetate Handheld Makeup Mirror Hair Comb Portable Aesthetic Animal Shape Mini Pocket Mirror Jewelry
Cute Capybara Cartoon Acetate Handheld Makeup Mirror Hair Comb Portable Aesthetic Animal Shape Mini Pocket Mirror Jewelry
like
Find Similar
Detail shot of a cute Capybara shaped hair comb made from premium brown acetate material - No.4 Comb
Cute brown bear-shaped handheld makeup mirror with acetic acid finish and long handle design - No.3 Handheld Mirror
Close-up of cute khaki bear shaped portable keychain mirror with silver spring clip - No.2 Cute Capybara Mirror
Detailed view of Capybara cartoon keychain accessories on soft quilted fabric - No.1 Sitting Capybara Mirror
+1
Cute Capybara Cartoon Acetate Handheld Makeup Mirror Hair Comb Portable Aesthetic Animal Shape Mini Pocket Mirror Jewelry
$1.99-3.60
No MOQ
Free Shipping
Forest Animal Print Makeup Bag Fine Linen Zippered Cosmetic Pouch Portable Travel Storage Organizer For Women Girls
Forest Animal Print Makeup Bag Fine Linen Zippered Cosmetic Pouch Portable Travel Storage Organizer For Women Girls
like
Find Similar
Portable forest elk canvas makeup bag with zipper and convenient black wrist strap - Forest Elk Style (Style 1)
Portable forest fox canvas makeup bag with black zipper and wrist strap detail - Jungle Fox Style (Style 2)
Forest mushroom canvas cosmetic bag with vintage herb print and black wristlet strap - Vintage Mushroom Style (Style 3)
Portable forest elk canvas makeup bag with convenient hand strap and secure zip closure - Artistic Elk Style (Style 4)
Forest Animal Print Makeup Bag Fine Linen Zippered Cosmetic Pouch Portable Travel Storage Organizer For Women Girls
-4%
$1.37
No MOQ
Makeup Bag 3D Rose Flower Lace Trim Ribbed Fabric Large Capacity Travel Cosmetic Pouch Toiletry Organizer Ins Style Women
Makeup Bag 3D Rose Flower Lace Trim Ribbed Fabric Large Capacity Travel Cosmetic Pouch Toiletry Organizer Ins Style Women
like
Find Similar
Detail of cream white quilted makeup bag with 3D floral accent and delicate lace embroidery - White / Small (15x11x10cm)
Detailed close-up of a pink textured makeup bag with delicate lace and a white floral accent - Pink / Small (15x11x10cm)
Detail of beige corduroy makeup bag with green rose accent and printed ribbon puller - Yellow / Small (15x11x10cm)
Close-up of white lace embroidered cosmetic bag featuring a yellow fabric rose detail - White / Large (22x12x11cm)
+2
Makeup Bag 3D Rose Flower Lace Trim Ribbed Fabric Large Capacity Travel Cosmetic Pouch Toiletry Organizer Ins Style Women
-4%
$2.44-2.71
No MOQ
Gingham Makeup Bag Fabric Bow Print Square Zipper Sanitary Napkin Storage Pouch Kawaii Travel Portable Organizer For Women Girls
Gingham Makeup Bag Fabric Bow Print Square Zipper Sanitary Napkin Storage Pouch Kawaii Travel Portable Organizer For Women Girls
like
Find Similar
Close-up of pink checkered pouch with red bow print and smooth zip closure detail - Pink
Detail of yellow gingham cosmetic bag with pink bow pattern and braided zipper pull - Yellow
Detail of blue plaid makeup bag with pink bow pattern and zipper closure on a white desk - Blue
Detail of red checkered cosmetic pouch with blue butterfly print and zipper closure - Rose Red
+1
Gingham Makeup Bag Fabric Bow Print Square Zipper Sanitary Napkin Storage Pouch Kawaii Travel Portable Organizer For Women Girls
$1.90
No MOQ
Floral Leaf Print Makeup Bag Cotton Canvas Clutch Pouch Fresh Pastoral Style Zipper Storage Handbag For Women
Floral Leaf Print Makeup Bag Cotton Canvas Clutch Pouch Fresh Pastoral Style Zipper Storage Handbag For Women
like
Find Similar
Detail of leaf print cotton makeup bag featuring a vintage label and gold metal zipper - Black with Leaves
Detail of green floral canvas pouch with white leaves and Time to Party label on soft mat - Green Base Leaf
Floral cotton makeup bag with metal zipper and Time To Party patch on quilted fabric - Yellow Leaf
NewFloral Leaf Print Makeup Bag Cotton Canvas Clutch Pouch Fresh Pastoral Style Zipper Storage Handbag For Women
$3.75
No MOQ
Dual Grid Nail Towel Storage Box Transparent Plastic Cotton Pad Holder Dustproof Flip Lid Makeup Organizer Case
Dual Grid Nail Towel Storage Box Transparent Plastic Cotton Pad Holder Dustproof Flip Lid Makeup Organizer Case
like
Find Similar
1 option
Dual Grid Nail Towel Storage Box Transparent Plastic Cotton Pad Holder Dustproof Flip Lid Makeup Organizer Case
$0.84
Mix MOQ : 3
Women Quilted Cotton Clutch Bag Bowknot Embroidery Minimalist Makeup Toiletry Pouch Fashion Handheld Storage Handbag
Women Quilted Cotton Clutch Bag Bowknot Embroidery Minimalist Makeup Toiletry Pouch Fashion Handheld Storage Handbag
like
Find Similar
Detailed close-up of brown quilted toiletry bag with black bow embroidery and zip - Khaki
Detailed macro of rose pink quilted makeup bag with black bow embroidery and zipper - Rose Pink
Detailed view of apricot quilted makeup bag featuring black embroidered bows and top zipper - Light Pink
Detailed view of black quilted cosmetic bag featuring pink bow embroidery and zipper closure - Black
+2
Women Quilted Cotton Clutch Bag Bowknot Embroidery Minimalist Makeup Toiletry Pouch Fashion Handheld Storage Handbag
$3.03
No MOQ
Butterfly Print Quilted Makeup Bag PU Leather Large Capacity Portable Cosmetic Pouch Pencil Case For Travel Office
Butterfly Print Quilted Makeup Bag PU Leather Large Capacity Portable Cosmetic Pouch Pencil Case For Travel Office
like
Find Similar
Macro detail of pink quilted makeup bag with butterfly print and smooth metal zipper - Pink
Detail of chevron quilted light blue makeup bag with vibrant butterfly print and zipper - Blue
Detail of purple quilted makeup bag with laser butterfly print and smooth metallic zipper - Purple
Detail of black quilted cosmetic bag with colorful butterflies and secure zipper - Black
Butterfly Print Quilted Makeup Bag PU Leather Large Capacity Portable Cosmetic Pouch Pencil Case For Travel Office
$1.41
Mix MOQ : 2
Checkered Cartoon Cat Panda Makeup Bag PU Leather Oxford Cloth Large Capacity Travel Toiletry Organizer Portable Pouch
Checkered Cartoon Cat Panda Makeup Bag PU Leather Oxford Cloth Large Capacity Travel Toiletry Organizer Portable Pouch
like
Find Similar
Pink cat cartoon wash bag with waterproof PU handle and large capacity storage - Pink Cat
Cute blue cat cartoon toiletry bag with PU waterproof material and dual zippers - Blue Cat
Cute green panda makeup bag with large capacity waterproof PU leather and handle - Green Panda
Brown checkered toiletry bag with cute bear motif and dimensions 25x14x15cm - Dark Brown Bear
Checkered Cartoon Cat Panda Makeup Bag PU Leather Oxford Cloth Large Capacity Travel Toiletry Organizer Portable Pouch
-5%
$2.85
No MOQ
Floral Quilted Cotton Makeup Bag Large Capacity Travel Cosmetic Organizer Portable Wash Pouch For Women Pastoral Style
Floral Quilted Cotton Makeup Bag Large Capacity Travel Cosmetic Organizer Portable Wash Pouch For Women Pastoral Style
like
Find Similar
Detail of floral cotton makeup bag with red roses on a rustic straw mat setup - Rose / Rose Small / Small
Blue floral cosmetic bag with cotton texture on woven mat with vintage aesthetic - Blue Floral / Blue Floral Small / Small
Detail of floral quilted makeup bag with green zipper and soft cotton texture - Rose / Rose Large / Large
Top-down view of a blue floral quilted cotton makeup bag with high-quality zipper detail - Blue Floral / Blue Floral Large / Large
Floral Quilted Cotton Makeup Bag Large Capacity Travel Cosmetic Organizer Portable Wash Pouch For Women Pastoral Style
-5%
$1.89-2.71
No MOQ
Plush Lambswool Makeup Bag Large Capacity Portable Bow Pattern Diamond Quilted Toiletry Organizer Travel Women
Plush Lambswool Makeup Bag Large Capacity Portable Bow Pattern Diamond Quilted Toiletry Organizer Travel Women
like
Find Similar
White faux fur makeup bag featuring black bow patterns and gold double zipper detail - Top Handle Bag
White faux shearling scarf with black bow embroidery and woven Hayaa Godluck label - Scarf
Cream teddy fleece cosmetic bag with black bow embroidery and gold zipper detail - Clutch Bag
Sherpa fleece makeup bag in creamy white with black bow prints and gold hardware - Octagonal Pouch
Plush Lambswool Makeup Bag Large Capacity Portable Bow Pattern Diamond Quilted Toiletry Organizer Travel Women
-4%
$2.33-4.44
No MOQ
 · 
13 views
Vintage Jacquard Canvas Makeup Bag Large Capacity Cosmetic Organizer With Bow Knot Pattern For Travel Women Toiletries
Vintage Jacquard Canvas Makeup Bag Large Capacity Cosmetic Organizer With Bow Knot Pattern For Travel Women Toiletries
like
Find Similar
Portable black bow print makeup bag with durable fabric texture for travel storage - French Jacquard Bow / Large / Black
White quilted bow-knot makeup bag with soft 3D embossed pattern and brand label - French Jacquard Bow / Large / White
Pink vintage woven makeup bag with bow texture being used to store a lipstick - Bow / Large / Pink
Close-up of pink bow pattern makeup bag with a flower zipper pull on a magazine - Bow / Small / Pink
Vintage Jacquard Canvas Makeup Bag Large Capacity Cosmetic Organizer With Bow Knot Pattern For Travel Women Toiletries
$2.10-2.82
No MOQ
 · 
13 views
Retro Plush Sherpa Coin Purse Mini Makeup Bag Soft Fleece Zipper Pouch Portable Lipstick Storage Travel Organizer Women
Retro Plush Sherpa Coin Purse Mini Makeup Bag Soft Fleece Zipper Pouch Portable Lipstick Storage Travel Organizer Women
like
Find Similar
Detail of striped sherpa fleece makeup bag with pink rope zipper pull and soft texture - Brown Coffee Striped Fleece
Close-up of curly plush makeup bag with colorful stripes and silver zipper detail - Blue Brown Striped Fleece
Close-up of vintage jacquard plush makeup bag with colorful patterns and pink rope handle - Colored Plaid Fleece
Macro shot of striped Sherpa cosmetic bag with fuzzy texture and pink woven puller - Fleece Red Purple Striped
+10
Retro Plush Sherpa Coin Purse Mini Makeup Bag Soft Fleece Zipper Pouch Portable Lipstick Storage Travel Organizer Women
$1.41
No MOQ
St Patricks Day Makeup Bag Linen Blend Leprechaun Shamrock Print Zipper Toiletry Pouch With Wristlet Strap For Travel
St Patricks Day Makeup Bag Linen Blend Leprechaun Shamrock Print Zipper Toiletry Pouch With Wristlet Strap For Travel
like
Find Similar
Saint Patrick's Day leprechaun canvas makeup bag with black zipper and wristlet strap - Elf Sitting on Barrel (Style 1)
St. Patrick's Day makeup bag featuring flute-playing elf and clover canvas print - Elf Playing Flute (Style 2)
St. Patrick's Day canvas makeup bag featuring a cartoon elf and clover print - Girl Elf With Barrel (Style 3)
St. Patrick's Day makeup bag featuring an elf girl and shamrock patterns on canvas - Girl Elf With Top Hat (Style 4)
NewSt Patricks Day Makeup Bag Linen Blend Leprechaun Shamrock Print Zipper Toiletry Pouch With Wristlet Strap For Travel
-4%
$1.37
No MOQ
Geometric Lion Print Canvas Cosmetic Bag Large Capacity Makeup Pouch With Zipper Wristlet Travel Toiletry Organizer
Geometric Lion Print Canvas Cosmetic Bag Large Capacity Makeup Pouch With Zipper Wristlet Travel Toiletry Organizer
like
Find Similar
White canvas lion makeup bag with artistic geometric print and black zipper closure - 17*25cm (Fine Linen) / Geometric Lion Pattern (Style 1)
Geometric Lion Print Canvas Cosmetic Bag Large Capacity Makeup Pouch With Zipper Wristlet Travel Toiletry Organizer
-4%
$1.37
No MOQ
Cosmetic Bag For Women Teacher Appreciation Gift Polyester Makeup Pouch Zipper Closure Printed Large Capacity Travel Bag
Cosmetic Bag For Women Teacher Appreciation Gift Polyester Makeup Pouch Zipper Closure Printed Large Capacity Travel Bag
like
Find Similar
White Best Teacher Ever toiletry bag with hand-drawn graphics and black zipper - Watercolor Splash Best Teacher Ever (jiayinghzb01)
Detailed dimension guide for white canvas makeup bag featuring Best Teacher Ever print - Plant and Pencil Best Teacher Ever (jiayinghzb02)
Detailed size chart of the white teacher makeup bag showing 22cm width and 13.5cm height - Backpack and Glasses Best Teacher Ever (jiayinghzb03)
Detailed size chart for Super Teacher canvas makeup bag showing dimensions and design - Artistic Font Super Teacher (jiayinghzb04)
+2
Cosmetic Bag For Women Teacher Appreciation Gift Polyester Makeup Pouch Zipper Closure Printed Large Capacity Travel Bag
$1.59
No MOQ
Kawaii Pink White Plaid Plush Makeup Bag Soft Bow Embroidery Portable Travel Cosmetic Storage Pouch Wash Organizer Handbag For Women Girls
Kawaii Pink White Plaid Plush Makeup Bag Soft Bow Embroidery Portable Travel Cosmetic Storage Pouch Wash Organizer Handbag For Women Girls
like
Find Similar
Detail of pink plaid tweed makeup bag with white embroidered bow and brand label - 26x18cm / Pink Bow Large Size
Detail of pink plaid plush makeup bag with bow pattern and golden zipper held in hand - 17x14cm / Pink Bow Small
Close-up of pink checkered plush makeup bag with soft knitted bows and brand tag - 19x12cm / Pink Bow Medium
Kawaii Pink White Plaid Plush Makeup Bag Soft Bow Embroidery Portable Travel Cosmetic Storage Pouch Wash Organizer Handbag For Women Girls
$2.54-3.11
No MOQ
Quilted Floral Makeup Bag Cotton Portable Large Capacity Travel Cosmetic Organizer Storage Pouch Sweet Fresh Style
Quilted Floral Makeup Bag Cotton Portable Large Capacity Travel Cosmetic Organizer Storage Pouch Sweet Fresh Style
like
Find Similar
Quilted floral makeup bag in light blue with pink flowers and a sturdy top handle - Oil Painting Floral (Makeup Bag)
Close-up of quilted floral cosmetic bag showing soft cotton texture and embroidery label - Oil Painting Floral (Clutch Bag)
Detail showing the floral quilted makeup bag with soft pastel flowers and zipper closure - Oil Painting Floral (Octagonal Bag)
Quilted Floral Makeup Bag Cotton Portable Large Capacity Travel Cosmetic Organizer Storage Pouch Sweet Fresh Style
-5%
$2.05-3.43
No MOQ
Teddy Fleece Makeup Bag Cute Cartoon Bear Embroidery Cosmetic Pouch Portable Large Capacity Storage Organizer For Women Girls
Teddy Fleece Makeup Bag Cute Cartoon Bear Embroidery Cosmetic Pouch Portable Large Capacity Storage Organizer For Women Girls
like
Find Similar
Pink plush teddy bear makeup bag made of soft sherpa fleece for cosmetic storage - Pink
Plush brown teddy bear makeup bag with fluffy lamb wool and cute bear keychain charm - Apricot
Teddy Fleece Makeup Bag Cute Cartoon Bear Embroidery Cosmetic Pouch Portable Large Capacity Storage Organizer For Women Girls
-4%
$2.14
Mix MOQ : 2
Quilted Heart Print Makeup Bag Polyester Travel Toiletry Pouch Portable Cosmetic Storage Case Korean Style For Women
Quilted Heart Print Makeup Bag Polyester Travel Toiletry Pouch Portable Cosmetic Storage Case Korean Style For Women
like
Find Similar
Close-up of black quilted heart print cosmetic bag on a minimalist desk surface - Black
Detailed view of white quilted cosmetic bag with red heart pattern and zip closure - White
Quilted Heart Print Makeup Bag Polyester Travel Toiletry Pouch Portable Cosmetic Storage Case Korean Style For Women
$1.59
Mix MOQ : 2
Cute Quilted Cotton Mini Makeup Bag Portable Zipper Storage Pouch Cartoon Bear Pattern For Women Girls
Cute Quilted Cotton Mini Makeup Bag Portable Zipper Storage Pouch Cartoon Bear Pattern For Women Girls
like
Find Similar
Close-up of quilted cotton pouch with cute puppy prints and green zipper detail - Green
Detailed close-up of quilted cotton mini pouch with teddy bear and floral print pattern - Purple
Cute Quilted Cotton Mini Makeup Bag Portable Zipper Storage Pouch Cartoon Bear Pattern For Women Girls
$1.38
No MOQ
Quilted Cotton Cosmetic Bag Bow Embroidered Large Capacity Travel Toiletry Pouch For Women Makeup Storage Organizer
Quilted Cotton Cosmetic Bag Bow Embroidered Large Capacity Travel Toiletry Pouch For Women Makeup Storage Organizer
like
Find Similar
Macro view of cream quilted makeup bag featuring black bow embroidery and metal zipper detail - Pencil Case Style / Cream White
Detail of embroidered bows on quilted vanity case with Sozakka brand tag and floral decor - Large Capacity Handheld Style / Cream White
Quilted Cotton Cosmetic Bag Bow Embroidered Large Capacity Travel Toiletry Pouch For Women Makeup Storage Organizer
-5%
$2.16-4.63
No MOQ
Colorful Swan Print Makeup Bag Fine Linen Cosmetic Pouch With Zipper And Wrist Strap Portable Travel Toiletry Storage Organizer
Colorful Swan Print Makeup Bag Fine Linen Cosmetic Pouch With Zipper And Wrist Strap Portable Travel Toiletry Storage Organizer
like
Find Similar
Off-white canvas makeup bag featuring colorful quilling swan print and black wristlet - 17*25cm (Linen) with Strap / Swan Pattern (Style 1)
Colorful Swan Print Makeup Bag Fine Linen Cosmetic Pouch With Zipper And Wrist Strap Portable Travel Toiletry Storage Organizer
-4%
$1.37
No MOQ
Leopard Print Plush Cosmetic Bag Large Capacity Faux Fur Makeup Pouch With Polka Dot Lining For Women Travel Portable
Leopard Print Plush Cosmetic Bag Large Capacity Faux Fur Makeup Pouch With Polka Dot Lining For Women Travel Portable
like
Find Similar
Pink leopard plush makeup bag with soft faux fur texture and black polka dot lining - Pink
Plush leopard print makeup bags in pink and light blue colors for travel storage - Blue
Leopard Print Plush Cosmetic Bag Large Capacity Faux Fur Makeup Pouch With Polka Dot Lining For Women Travel Portable
$1.50
No MOQ
Cute Animal Print Cosmetic Bag Cotton Linen Makeup Pouch Travel Toiletries Organizer With Zipper And Wristlet Strap
Cute Animal Print Cosmetic Bag Cotton Linen Makeup Pouch Travel Toiletries Organizer With Zipper And Wristlet Strap
like
Find Similar
Detail of white canvas cosmetic bag with a cute cartoon calico cat print and black zipper - Calico Cat Style(xy-005-01) / With Strap
Detail of white canvas makeup bag featuring a cute cartoon cow print and black wrist strap - Cow Style(xy-005-02) / With Strap
Detail of canvas makeup bag featuring cute terrier illustration and black zipper handle - Terrier Style(xy-005-03) / With Strap
Off-white canvas cosmetic bag with dog cartoon print and black wrist strap - Dog in Cart Style(xy-005-04) / With Strap
+8
Cute Animal Print Cosmetic Bag Cotton Linen Makeup Pouch Travel Toiletries Organizer With Zipper And Wristlet Strap
-5%
$1.26-1.31
No MOQ
Quilted Striped Makeup Bag Cotton And Polyester Portable Travel Toiletry Case Organizer Bag For Women
Quilted Striped Makeup Bag Cotton And Polyester Portable Travel Toiletry Case Organizer Bag For Women
like
Find Similar
Minimalist blue and pink striped quilted cosmetic bag with top handle for travel - Cosmetic Bag (Handle Style) / Blue
Close-up of quilted yellow stripe toiletry bag with BLUE and PINK label in a soft scene - Cosmetic Bag (Handle Style) / Yellow
Detail of striped quilted makeup bag with soft texture and sturdy top handle - Cosmetic Bag (Handle Style) / Pink
Quilted cotton makeup bag with green stripes and handle on aesthetic book stack - Cosmetic Bag (Handle Style) / Green
+8
Quilted Striped Makeup Bag Cotton And Polyester Portable Travel Toiletry Case Organizer Bag For Women
-5%
$2.05-3.43
No MOQ
Quilted Cotton Fabric Floral Cosmetic Bag Large Capacity Travel Makeup Organizer Portable Zipper Storage Pouch For Women
Quilted Cotton Fabric Floral Cosmetic Bag Large Capacity Travel Makeup Organizer Portable Zipper Storage Pouch For Women
like
Find Similar
Top view of floral quilted cotton makeup bag with colorful abstract patterns and logo - Colorful U-Pattern
Detail of yellow quilted cotton makeup bag with smiley pattern and secure zipper - Yellow Plaid Smile
Detail of blue and white checkered quilted cotton bag with light blue zipper and label - Blue Plaid Polka Dot
Detail of blue plaid quilted cosmetic bag with pink floral patterns and today mood tag - Tulip
+8
Quilted Cotton Fabric Floral Cosmetic Bag Large Capacity Travel Makeup Organizer Portable Zipper Storage Pouch For Women
$3.17
Mix MOQ : 3
 · 
34 views
Women Korean Quilted Puffer Cosmetic Bag Large Capacity Solid Color Makeup Organizer Bag Nylon Cloud Clutch Storage Bag
Women Korean Quilted Puffer Cosmetic Bag Large Capacity Solid Color Makeup Organizer Bag Nylon Cloud Clutch Storage Bag
like
Find Similar
Black quilted puffer cosmetic bag in soft nylon, stylish handheld storage pouch - Black
Creamy white quilted pouch made of nylon with soft padded grid texture for storage - White
Modern rose red quilted pouch made of shiny fabric held by hand for storage - Rose Pink
Minimalist light pink quilted bubble cosmetic bag with plush checkered texture for storage - Pink
+4
Women Korean Quilted Puffer Cosmetic Bag Large Capacity Solid Color Makeup Organizer Bag Nylon Cloud Clutch Storage Bag
$2.45
No MOQ
Valentine's Day Cosmetic Bag Linen Zipper Makeup Pouch With Wrist Strap Gnome Heart Printed Organizer For Women
Valentine's Day Cosmetic Bag Linen Zipper Makeup Pouch With Wrist Strap Gnome Heart Printed Organizer For Women
like
Find Similar
Pink striped canvas makeup bag with Happy Valentine's Day print and black wristlet - Happy Valentine's Day Text (xy-060-1) / 17*25cm (With Strap)
Pink striped cosmetic bag featuring a cute gnome heart print and black zipper strap - Gnome Holding Heart (xy-060-2) / 17*25cm (With Strap)
Pink striped gnome makeup bag with red roses and love text for women's toiletries - Gnome Holding Roses (xy-060-3) / 17*25cm (With Strap)
Pink striped cosmetic bag with 'Hugs and' print and red heart pattern for makeup storage - Hugs & Heartbeat (xy-060-4) / 17*25cm (With Strap)
+4
Valentine's Day Cosmetic Bag Linen Zipper Makeup Pouch With Wrist Strap Gnome Heart Printed Organizer For Women
-5%
$1.26-1.31
No MOQ
Makeup Bag Linen Canvas Zipper Cosmetic Pouch With Wrist Strap Printed Heart Dolphin Pattern Travel Daily Organizer
Makeup Bag Linen Canvas Zipper Cosmetic Pouch With Wrist Strap Printed Heart Dolphin Pattern Travel Daily Organizer
like
Find Similar
Canvas makeup bag featuring red heart prints and black wristlet strap on beige fabric - Large Red Heart Print (With Wrist Strap)
Canvas cosmetic bag with blue dolphin print, yellow fabric and black handle strap - Double Dolphins Print (With Wrist Strap)
Canvas makeup bag in beige featuring a floral heart wreath and black wrist strap - Rose Wreath Heart Print (With Wrist Strap)
Yellow cosmetic bag with ferris wheel print, canvas texture and wrist strap - Vintage Ferris Wheel Print (With Wrist Strap)
+4
Makeup Bag Linen Canvas Zipper Cosmetic Pouch With Wrist Strap Printed Heart Dolphin Pattern Travel Daily Organizer
-5%
$1.26-1.31
No MOQ
Quilted Cosmetic Bag PU Leather Bow Pattern Makeup Pouch With Artificial Pearl Charm Portable Travel Toiletry Case For Women
Quilted Cosmetic Bag PU Leather Bow Pattern Makeup Pouch With Artificial Pearl Charm Portable Travel Toiletry Case For Women
like
Find Similar
Pink quilted makeup bag with bow texture and a delicate pearl pendant zipper - With Charm / Pink
Close-up of silver quilted makeup bag featuring butterfly pattern and heart zipper charm - With Charm / Silver
Detail of black quilted bow makeup bag with white zipper and pearl heart pendant charm - With Charm / Black
White quilted makeup bag with embossed bow patterns and elegant pearl pendant accessory - With Charm / White
+4
Quilted Cosmetic Bag PU Leather Bow Pattern Makeup Pouch With Artificial Pearl Charm Portable Travel Toiletry Case For Women
$1.99-2.59
No MOQ
Large Capacity Quilted Cosmetic Bag Rhombic Pattern Nylon Makeup Storage Bag Travel Toiletry Handbag For Women Double Zipper
Large Capacity Quilted Cosmetic Bag Rhombic Pattern Nylon Makeup Storage Bag Travel Toiletry Handbag For Women Double Zipper
like
Find Similar
Quilted cream vanity makeup bag with diamond stitching and elegant metal zippers - White
Quilted dark green nylon makeup bag with metallic finish and gold zippers - Green
Chic black quilted rhombic square handbag with gold zippers and a portable top handle - Black
Brown quilted nylon bucket bag with golden double zipper and padded handle on white background - Brown
Large Capacity Quilted Cosmetic Bag Rhombic Pattern Nylon Makeup Storage Bag Travel Toiletry Handbag For Women Double Zipper
-4%
$4.11
No MOQ
Easter Rabbit Makeup Bag Linen Fabric Zipper Cosmetic Pouch With Wristlet Strap Heart Print Travel Toiletry Organizer
Easter Rabbit Makeup Bag Linen Fabric Zipper Cosmetic Pouch With Wristlet Strap Heart Print Travel Toiletry Organizer
like
Find Similar
Easter bunny pattern makeup bag with zipper closure and side handle in cream finish - 17*25cm (Linen) with Strap / Double Rabbit & Heart Style (Style 1)
Canvas makeup bag with red rabbit and heart prints, featuring black zipper and hand strap - 17*25cm (Linen) with Strap / All-over Rabbit & Heart Print (Style 2)
Cream canvas Easter bunny makeup bag with heart motif and black wristlet strap - 17*25cm (Linen) with Strap / Bunny Holding Heart (Style 3)
Easter bunny makeup bag in canvas material with full-print rabbit and heart patterns - 17*25cm (Linen) with Strap / All-over Dynamic Rabbit Style (Style 4)
Easter Rabbit Makeup Bag Linen Fabric Zipper Cosmetic Pouch With Wristlet Strap Heart Print Travel Toiletry Organizer
-4%
$1.37
No MOQ
Women Red Plaid Woolen Cosmetic Bag Makeup Pouch Travel Toiletry Organizer Daily Clutch Handbag Zipper Canvas Lining
Women Red Plaid Woolen Cosmetic Bag Makeup Pouch Travel Toiletry Organizer Daily Clutch Handbag Zipper Canvas Lining
like
Find Similar
Macro detail of red and white checkered tweed makeup bag with a classic woven logo tag - Gold Thread Red White Large Grid
Detail of red checkered wool makeup bag with Simple Wish label on white surface - Red White Small Grid
Detailed view of red plaid wool cosmetic bags with simple wish label on white background - Dark Red Large Grid
Women Red Plaid Woolen Cosmetic Bag Makeup Pouch Travel Toiletry Organizer Daily Clutch Handbag Zipper Canvas Lining
$4.76
No MOQ
Quilted Cotton Gingham Makeup Bag Heart Pattern Stitching With Lace And Bow Ribbon Sweet Korean Style Cosmetic Organizer
Quilted Cotton Gingham Makeup Bag Heart Pattern Stitching With Lace And Bow Ribbon Sweet Korean Style Cosmetic Organizer
like
Find Similar
Quilted light blue plaid makeup bag featuring white lace and a decorative silk bow - Blue Gingham Sweet Lace Style / Blue
Pink and white checkered quilted cosmetic bag with heart embroidery and lace trim - Pink Gingham Sweet Lace Style / Pink
Quilted Cotton Gingham Makeup Bag Heart Pattern Stitching With Lace And Bow Ribbon Sweet Korean Style Cosmetic Organizer
-5%
$2.60
No MOQ
Quilted Fabric Makeup Bag Large Capacity Cartoon Bear Cat Printed Cosmetic Pouch Toiletry Organizer Travel Wash Case
Quilted Fabric Makeup Bag Large Capacity Cartoon Bear Cat Printed Cosmetic Pouch Toiletry Organizer Travel Wash Case
like
Find Similar
Quilted cotton travel pouch with cute cartoon cat and marine pattern in soft cream - Jellyfish
Quilted off-white makeup bag with cute rabbit and bow patterns in a lifestyle setting - Star Rabbit
White quilted makeup bag with purple cartoon bears and star patterns for travel storage - Star Bear
White quilted cotton makeup bag featuring colorful cartoon bear and bow patterns - Snowflake Bear
+9
Quilted Fabric Makeup Bag Large Capacity Cartoon Bear Cat Printed Cosmetic Pouch Toiletry Organizer Travel Wash Case
-5%
$1.89
No MOQ
Quilted Padded Makeup Bag Cartoon Floral Pattern Portable Cosmetic Storage Pouch Zipper Coin Purse For Women
Quilted Padded Makeup Bag Cartoon Floral Pattern Portable Cosmetic Storage Pouch Zipper Coin Purse For Women
like
Find Similar
Detailed macro shot of quilted floral cosmetic pouch with blue mermaid cat illustration - Jellyfish
Close-up of quilted cosmetic bag with cute rabbit patterns and a purple woven handle - Star Rabbit
Detailed close-up of quilted floral cosmetic bag with purple bear and star patterns - Star Bear
Detailed view of quilted cotton pouch featuring cute bear print and floral snowflake patterns - Snowflake Bear
+9
Quilted Padded Makeup Bag Cartoon Floral Pattern Portable Cosmetic Storage Pouch Zipper Coin Purse For Women
-4%
$1.62
No MOQ
Quilted Cotton Makeup Bag Blue Floral Print Travel Toiletry Storage Pouch Women Portable Zipper Organizer Retro
Quilted Cotton Makeup Bag Blue Floral Print Travel Toiletry Storage Pouch Women Portable Zipper Organizer Retro
like
Find Similar
Quilted blue floral cosmetic bag with cotton finish and vintage octagonal shape - Blue Crabapple Flower Octagonal Bag
Close-up of blue floral quilted cosmetic bag with metal zipper and premium fabric texture - Blue Crabapple Flower Handbag
Blue floral quilted makeup bag with handle and dual zippers on white background - Blue Crabapple Flower Makeup Bag
Quilted Cotton Makeup Bag Blue Floral Print Travel Toiletry Storage Pouch Women Portable Zipper Organizer Retro
-5%
$1.64-3.12
No MOQ
Quilted Cotton Cosmetic Bag Pink Ribbon Bow Pattern Travel Toiletry Pouch Sweet Aesthetic Makeup Organizer For Women
Quilted Cotton Cosmetic Bag Pink Ribbon Bow Pattern Travel Toiletry Pouch Sweet Aesthetic Makeup Organizer For Women
like
Find Similar
Pink quilted cosmetic bag with ribbon bows on wooden desk from multiple angles - Pink Ribbon Bowknot Octagonal Bag
Pink quilted makeup bag with ribbon bow patterns and a secure top zipper closure - Pink Ribbon Bowknot Hand Clutch Bag
Close-up of pink quilted makeup bag with ribbon bow patterns and soft fabric texture - Pink Ribbon Bowknot Makeup Bag
Quilted Cotton Cosmetic Bag Pink Ribbon Bow Pattern Travel Toiletry Pouch Sweet Aesthetic Makeup Organizer For Women
-4%
$1.93-3.48
No MOQ
Quilted Cotton Floral Cosmetic Bag Blue Begonia Pattern Travel Makeup Storage Pouch Retro Style Zipper Closure
Quilted Cotton Floral Cosmetic Bag Blue Begonia Pattern Travel Makeup Storage Pouch Retro Style Zipper Closure
like
Find Similar
Quilted blue floral cotton cosmetic bag with zipper and ribbon on white metal basket - Clutch Bag / Blue Crabapple
Quilted cotton cosmetic bag with blue floral patterns and reinforced handle for travel - Makeup Bag / Blue Crabapple
Detailed close-up of blue floral quilted cosmetic bag with metal zipper and fabric handle - Octagonal Pouch / Blue Crabapple
Quilted Cotton Floral Cosmetic Bag Blue Begonia Pattern Travel Makeup Storage Pouch Retro Style Zipper Closure
-5%
$1.64-3.12
No MOQ
Cute Cartoon Bear Print Quilted Cotton Makeup Bag Travel Portable Cosmetic Toiletry Organizer Handbag For Women Girls
Cute Cartoon Bear Print Quilted Cotton Makeup Bag Travel Portable Cosmetic Toiletry Organizer Handbag For Women Girls
like
Find Similar
Detailed close-up of pink quilted makeup bag with cute bear prints and handle - Pink Zoo - Makeup Bag
Detailed texture of white quilted bear pattern storage bag with a fabric label and zipper - Pink Zoo - Pouch Bag
Quilted white cosmetic bag with cute cartoon bears and red bow patterns - Pink Zoo - Octagonal Pouch
Cute Cartoon Bear Print Quilted Cotton Makeup Bag Travel Portable Cosmetic Toiletry Organizer Handbag For Women Girls
-5%
$2.05-3.42
No MOQ
Polka Dot Quilted Cosmetic Bag Large Capacity Travel Makeup Organizer Pouch Cotton Fabric Zipper Storage Handbag
Polka Dot Quilted Cosmetic Bag Large Capacity Travel Makeup Organizer Pouch Cotton Fabric Zipper Storage Handbag
like
Find Similar
Quilted makeup bag featuring blue polka dots and a yellow embroidered handle with melody - Lemon Polka Dot Handheld Makeup Bag
Quilted cotton lemon dot makeup bag detail with yellow zipper and brand logo - Lemon Polka Dot Zipper Handbag
Detail of quilted white cosmetic bag with blue polka dots and a yellow zipper top - Lemon Polka Dot Octagonal Pencil Case
Polka Dot Quilted Cosmetic Bag Large Capacity Travel Makeup Organizer Pouch Cotton Fabric Zipper Storage Handbag
-5%
$2.05-3.97
No MOQ
Canvas Makeup Bag Floral Cartoon Bear Print Portable Toiletry Organizer Pouch With Plush Flower Keychain Zipper Closure
Canvas Makeup Bag Floral Cartoon Bear Print Portable Toiletry Organizer Pouch With Plush Flower Keychain Zipper Closure
like
Find Similar
Detail of beige canvas makeup bag with cartoon bear pattern and yellow floral plush charm - Cute Bear Large (Beige Cartoon) / Large
Tropical rainforest floral canvas makeup bag with a yellow plush flower keychain - Rainforest Large (Black Floral) / Large
Beige canvas makeup bag featuring cartoon bears in yoga poses with drawstring closure - Cute Bear Small (Beige Cartoon) / Small
Canvas Makeup Bag Floral Cartoon Bear Print Portable Toiletry Organizer Pouch With Plush Flower Keychain Zipper Closure
-5%
$2.44-2.79
Mix MOQ : 10
 · 
18 views
Checkerboard Plush Pencil Case Faux Lambswool Large Capacity Cosmetic Makeup Bag For Students Office School
Checkerboard Plush Pencil Case Faux Lambswool Large Capacity Cosmetic Makeup Bag For Students Office School
like
Find Similar
Close-up of black and white checkered plush pencil case with soft faux fur texture - Black & White Checkerboard / Black
Detail of checkered plush stationery bag with soft texture and smooth zipper closure - Coffee Checkerboard / Coffee
Detailed close-up of brown and white checkered plush pouch with white top zipper on fabric - Khaki Checkerboard / Khaki
Checkerboard Plush Pencil Case Faux Lambswool Large Capacity Cosmetic Makeup Bag For Students Office School
-4%
$1.62
Mix MOQ : 2
Mesh Cosmetic Bag Travel Toiletry Organizer Nylon Grid Portable Makeup Pouch Contrast Color Zipper Lightweight
Mesh Cosmetic Bag Travel Toiletry Organizer Nylon Grid Portable Makeup Pouch Contrast Color Zipper Lightweight
like
Find Similar
Semicircle mesh makeup bag in lilac and yellow with bear patch and zipper closure - Semicircle Style / Light Purple
Rose pink mesh makeup bag with zipper and BEAR label on a white surface - Semicircle Style / Rose Red
Semi-circle mesh cosmetic bag in coral pink with light blue zipper trim and bear patch - Semicircle Style / Orange
Mesh makeup bag in grey and orange color block featuring the BEAR logo on a white background - Semicircle Style / Gray
+8
Mesh Cosmetic Bag Travel Toiletry Organizer Nylon Grid Portable Makeup Pouch Contrast Color Zipper Lightweight
-5%
$1.51-2.00
No MOQ
Mesh Makeup Bag Breathable Travel Toiletry Storage Pouch Portable Cosmetic Organizer With Bear Logo Zipper Closure
Mesh Makeup Bag Breathable Travel Toiletry Storage Pouch Portable Cosmetic Organizer With Bear Logo Zipper Closure
like
Find Similar
Detail of grey mesh makeup bag featuring a pink zipper, top handle and BEAR logo - Makeup Bag / Gray
Portable black mesh cosmetic bag with vibrant pink zipper and top handle strap - Makeup Bag / Black
Semicircle mesh makeup bag in lilac and yellow with bear patch and zipper closure - Semicircle Bag / Light Purple
Rose pink mesh makeup bag with zipper and BEAR label on a white surface - Semicircle Bag / Rose Red
+8
Mesh Makeup Bag Breathable Travel Toiletry Storage Pouch Portable Cosmetic Organizer With Bear Logo Zipper Closure
-5%
$1.51-2.00
No MOQ
Quilted Checkered Makeup Bag Cotton Contrast Color Portable Cosmetic Toiletry Organizer Storage Pouch Travel Aesthetic Ins Style
Quilted Checkered Makeup Bag Cotton Contrast Color Portable Cosmetic Toiletry Organizer Storage Pouch Travel Aesthetic Ins Style
like
Find Similar
Detail of checkered makeup bag featuring soft quilting and a blue tassel zipper pull - Makeup Bag / Purple
Detailed macro shot of pink and blue checkered makeup bag with diamond quilting and handle - Makeup Bag / Pink
Detail of quilted plaid cosmetic bag featuring green zipper and pink woven rope puller - Makeup Bag / Green
Detail of red and blue checkered quilted makeup bag with handle and blue zipper closure - Makeup Bag / Red
+8
Quilted Checkered Makeup Bag Cotton Contrast Color Portable Cosmetic Toiletry Organizer Storage Pouch Travel Aesthetic Ins Style
-5%
$2.05-3.42
No MOQ
Cute Bear Embroidery Plush Makeup Bag Soft Lamb Wool Zipper Pouch Storage Handbag For Women
Cute Bear Embroidery Plush Makeup Bag Soft Lamb Wool Zipper Pouch Storage Handbag For Women
like
Find Similar
Close-up of fluffy bear embroidery on cream plush makeup bag with Care Bears handle - Heart Bear (Yellow)
Detailed embroidery of a blue bear on a white plush wristlet bag with logo strap - Heart Bear (Blue)
Detail of soft cream fleece makeup bag with green Care Bears embroidery and webbing strap - Heart Bear (Green)
Detail of plush beige cosmetic bag with pink Care Bears embroidery and round metal zipper - Heart Bear (Pink)
+1
Cute Bear Embroidery Plush Makeup Bag Soft Lamb Wool Zipper Pouch Storage Handbag For Women
$4.03
No MOQ
Lace Makeup Bag Sweet Bowknot Cosmetic Pouch Ruffled Mesh Coin Purse With Artificial Pearl Pendant Zipper Organizer For Women
Lace Makeup Bag Sweet Bowknot Cosmetic Pouch Ruffled Mesh Coin Purse With Artificial Pearl Pendant Zipper Organizer For Women
like
Find Similar
Close-up of white lace makeup bag featuring a black bow and pearl keychain detail - White
Detail of black polka dot pouch with ruffle edges, beige bow and pearl pendant charm - Black
Detailed shot of pink ruffle makeup bag with yellow ribbon bow and pearl charm - Pink
Detail of light purple ruffled pouch featuring a beige bow and pearl pendant charm - Purple
+1
Lace Makeup Bag Sweet Bowknot Cosmetic Pouch Ruffled Mesh Coin Purse With Artificial Pearl Pendant Zipper Organizer For Women
-5%
$1.48
Mix MOQ : 5
House Shaped Makeup Bag PU Leather Portable Cosmetic Toiletry Case Artificial Pearl Handle Creative Cute Waterproof For Women
House Shaped Makeup Bag PU Leather Portable Cosmetic Toiletry Case Artificial Pearl Handle Creative Cute Waterproof For Women
like
Find Similar
Light blue house shaped leather cosmetic bag with yellow roof and pearl handle accent - Blue and Yellow Contrast/House Shape / Blue
Pink and brown house-shaped makeup bag with pearl handle and room text design - Pink and Brown Contrast/House Shape / Coffee
Cute house-shaped makeup bag in pastel purple and green leather with pearl handle - Green and Purple Contrast/House Shape / Purple
House Shaped Makeup Bag PU Leather Portable Cosmetic Toiletry Case Artificial Pearl Handle Creative Cute Waterproof For Women
-4%
$2.71
No MOQ
Rainbow Heart Makeup Bag Fine Linen Cosmetic Pouch With Wristlet Follow The Dream Print Travel Toiletry Organizer Women
Rainbow Heart Makeup Bag Fine Linen Cosmetic Pouch With Wristlet Follow The Dream Print Travel Toiletry Organizer Women
like
Find Similar
Beige canvas makeup bag with sequin rainbow heart and Follow The Dream print - 17*25cm (Linen) with Strap / Beige Rainbow Heart Follow The Dream
Rainbow Heart Makeup Bag Fine Linen Cosmetic Pouch With Wristlet Follow The Dream Print Travel Toiletry Organizer Women
-4%
$1.37
No MOQ
Cute Angel Wings Makeup Bag Mini Star Print Zipper Storage Pouch Portable Fabric Sanitary Napkin Organizer For Girls
Cute Angel Wings Makeup Bag Mini Star Print Zipper Storage Pouch Portable Fabric Sanitary Napkin Organizer For Girls
like
Find Similar
Close-up of pink canvas pouch with 3D angel wings, stars pattern and black zipper detail - Pink
Macro detail of a light blue mini pouch with plush white wings and star patterns - Blue
Close-up of mini canvas earphone bag with plush wings and star patterns - Off White
Cute Angel Wings Makeup Bag Mini Star Print Zipper Storage Pouch Portable Fabric Sanitary Napkin Organizer For Girls
$1.96
Mix MOQ : 2
Plaid Makeup Bag Oxford Cloth Large Capacity Handheld Travel Cosmetic Organizer With Handle Partitioned For Women Girls
Plaid Makeup Bag Oxford Cloth Large Capacity Handheld Travel Cosmetic Organizer With Handle Partitioned For Women Girls
like
Find Similar
Macro view of plaid makeup bag with red handle and cute 3D bunny plush pendant - Retro Red Plaid + Striped Rabbit Brooch
Detail view of colorful plaid makeup bag with red zipper and cute plush doll attachment - Retro Red Plaid + Apple Brooch
Detail of colorful plaid travel wash bag with sturdy handle and dual zipper closure - Retro Plaid Handbag
Plaid Makeup Bag Oxford Cloth Large Capacity Handheld Travel Cosmetic Organizer With Handle Partitioned For Women Girls
$4.18-4.90
No MOQ
LED Mirror Cosmetic Bag Quilted PU Leather Portable Makeup Case Rechargeable Professional Travel Beauty Organizer
LED Mirror Cosmetic Bag Quilted PU Leather Portable Makeup Case Rechargeable Professional Travel Beauty Organizer
like
Find Similar
Portable black quilted LED makeup case with gold hardware and reinforced handle strap - 26X22X19cm / Black Quilted (LED Mirror)
Portable cream quilted makeup case with LED mirror and gold double zipper closure - 26X22X19cm / White Quilted (LED Mirror)
Pink quilted PU leather makeup case with LED mirror and gold-tone zippers - 26X22X19cm / Pink Quilted (LED Mirror)
LED Mirror Cosmetic Bag Quilted PU Leather Portable Makeup Case Rechargeable Professional Travel Beauty Organizer
$17.26
Mix MOQ : 3
Floral Embroidery Cosmetic Bag Cotton Linen Makeup Organizer Portable Travel Toiletry Storage Pouch Cream Retro
Floral Embroidery Cosmetic Bag Cotton Linen Makeup Organizer Portable Travel Toiletry Storage Pouch Cream Retro
like
Find Similar
Close-up of botanical embroidery and floral relief texture on linen makeup bag - Large Green Leaf Linen
Detail view of cotton linen cosmetic bag with green leaf embroidery and gold flower zipper - Small Green Leaf Linen
Detail of floral embroidery on linen cosmetic bag with a gold ring zipper puller - Pillow Style Green Leaf Linen
Floral Embroidery Cosmetic Bag Cotton Linen Makeup Organizer Portable Travel Toiletry Storage Pouch Cream Retro
$2.82-3.74
No MOQ
Large Capacity Striped Canvas Makeup Bag Travel Toiletry Organizer With 3D Flower Decorative Cosmetic Storage Pouch
Large Capacity Striped Canvas Makeup Bag Travel Toiletry Organizer With 3D Flower Decorative Cosmetic Storage Pouch
like
Find Similar
Detail of red and white striped fabric toiletry bag with woven label on wooden stand - Yellow Clover
Detail of blue striped fabric makeup bag with a decorative zip knot on wood display - Blue Four-leaf Clover
Close-up of green striped fabric makeup bag with H & R BAG label and drawstring closure - Green Clover
Large Capacity Striped Canvas Makeup Bag Travel Toiletry Organizer With 3D Flower Decorative Cosmetic Storage Pouch
$3.11
No MOQ
Floral Cosmetic Bag Canvas Makeup Organizer High Capacity Portable Toiletry Pouch Travel Zipper Storage Sweet Print
Floral Cosmetic Bag Canvas Makeup Organizer High Capacity Portable Toiletry Pouch Travel Zipper Storage Sweet Print
like
Find Similar
Detailed close-up of floral makeup bag with H & R label on a wooden texture background - Pink Floral (Large)
Detail of floral makeup bag with golden flower zipper and fabric brand tag on a tray - Pink Floral (Small)
Detail of floral makeup bag with metal zipper and cosmetics on wooden tray - Pink Floral (Pillow Bag)
Floral Cosmetic Bag Canvas Makeup Organizer High Capacity Portable Toiletry Pouch Travel Zipper Storage Sweet Print
$2.01-2.90
No MOQ
Go to

More in beauty

Explore more in makeup remover

diytoolsplasticnaturalheartfiber false eyelashespartyglovelayerfacial cleaning puffs
carecleaningdoublefingertravelhangingstrapstylewoven

Ready to source like an insider

Get a direct line to the factory floor — no minimums, no middlemen, no guesswork.
iconReal factory pricing, no markup in betweeniconEvery order hand-inspected before it shipsicon5,000+ new products added daily
Get Inside Access