Everful

Wholesale makeup remover

Beauty tools and accessories sourced from vetted factories, inspected before shipping.

Sign Up
Makeup Remover

Find the perfect pieces: makeup puffs & sponges, makeup mirrors, eyelid tools

filterShow Filters
Best Seller
New Arrivals
Price Drop
Free Shipping
Quilted Gingham Makeup Bag Large Capacity Polyester Portable Bow Pattern Sweet Fresh Style Organizer For Women Student
Quilted Gingham Makeup Bag Large Capacity Polyester Portable Bow Pattern Sweet Fresh Style Organizer For Women Student
like
Find Similar
Pink plaid cosmetic bag with bow pattern and quilted cotton fabric for storage - Plaid Pink Bow
Quilted yellow gingham cosmetic bag with pink bow pattern and zipper closure - Plaid Yellow Bow
Red plaid quilted makeup bag with blue bow patterns and light blue zipper closure - Plaid Red Bow
Light blue plaid quilted cosmetic bag with pink bow pattern and a secure zipper - Plaid Blue Bow
+3
Quilted Gingham Makeup Bag Large Capacity Polyester Portable Bow Pattern Sweet Fresh Style Organizer For Women Student
$1.50
Mix MOQ : 3
Floral Daisy Embroidery Cosmetic Bag Portable Canvas Travel Storage Pouch Zipper Makeup Organizer Clutch For Women
Floral Daisy Embroidery Cosmetic Bag Portable Canvas Travel Storage Pouch Zipper Makeup Organizer Clutch For Women
like
Find Similar
Close-up of fabric cosmetic bag with detailed white daisy embroidery and gold zipper - Sanitary Napkin Bag / Black
Detail of embroidered daisy cosmetic bag made of beige linen fabric with high quality zipper - Sanitary Napkin Bag / Beige
Detail of white daisy embroidery on black fabric travel cosmetic bag with silver zipper - Small Clutch / Black
Detailed embroidery of white daisies and green leaves on a beige canvas travel makeup bag - Small Clutch / Beige
+8
Floral Daisy Embroidery Cosmetic Bag Portable Canvas Travel Storage Pouch Zipper Makeup Organizer Clutch For Women
$1.72-3.45
No MOQ
Canvas Cotton Makeup Bag Swiss Dot Floral Printed Bow Striped Portable Cosmetic Pouch For Women Travel Organizer Zipper Closure
Canvas Cotton Makeup Bag Swiss Dot Floral Printed Bow Striped Portable Cosmetic Pouch For Women Travel Organizer Zipper Closure
like
Find Similar
Detailed texture of cotton makeup bag with floral prints and 3D woven dotted fabric - White Background With Pink Small Flowers
Detailed close-up of floral cotton makeup bag with brand label on wooden surface - Pink Elegant Small Flowers
Detail view of floral cotton makeup bag with blue stripes and pink bow patterns - Blue Stripes With Bow
Detailed macro view of the floral cotton makeup bag on a decorative wooden tray - Green Leaves With Elegant Red Flowers
Canvas Cotton Makeup Bag Swiss Dot Floral Printed Bow Striped Portable Cosmetic Pouch For Women Travel Organizer Zipper Closure
$2.25
No MOQ
Cosmetic Bag PU Waterproof Toiletry Case Large Capacity Travel Makeup Organizer Cartoon Animal Pattern Handheld Pouch
Cosmetic Bag PU Waterproof Toiletry Case Large Capacity Travel Makeup Organizer Cartoon Animal Pattern Handheld Pouch
like
Find Similar
Pink cat cartoon wash bag with waterproof PU handle and large capacity storage - Pink Cat
Cute blue cat cartoon toiletry bag with PU waterproof material and dual zippers - Blue Cat
Cute green panda makeup bag with large capacity waterproof PU leather and handle - Green Panda
Brown checkered toiletry bag with cute bear motif and dimensions 25x14x15cm - Dark Brown Bear
Cosmetic Bag PU Waterproof Toiletry Case Large Capacity Travel Makeup Organizer Cartoon Animal Pattern Handheld Pouch
-5%
$2.85
No MOQ
Clear Window PU Leather Travel Makeup Bag Large Capacity Toiletry Organizer Handbag With Handle For Women Cosmetics Storage
Clear Window PU Leather Travel Makeup Bag Large Capacity Toiletry Organizer Handbag With Handle For Women Cosmetics Storage
like
Find Similar
Black cross-grain leather makeup bag with transparent window and silver zipper - Black
Chic light blue transparent waterproof cosmetic bag with leather texture and top handle - Blue
Pink PVC travel makeup bag with transparent window and sturdy cross-grain leather handle - Pink
Cream large capacity travel makeup bag with clear window and crossgrain leather texture - Off White
+1
Clear Window PU Leather Travel Makeup Bag Large Capacity Toiletry Organizer Handbag With Handle For Women Cosmetics Storage
$4.32
No MOQ
Chenille Patch PU Leather Cosmetic Bag Large Capacity Waterproof Portable Travel Toiletry Makeup Pouch Zipper For Women
Chenille Patch PU Leather Cosmetic Bag Large Capacity Waterproof Portable Travel Toiletry Makeup Pouch Zipper For Women
like
Find Similar
Purple PU leather pouch with chenille patches including lightning, smiley, and heart - Purple (Lightning Smiley Heart Style)
Detailed view of blue PU leather bag featuring HAIR chenille embroidery patch - Sky Blue (HAIR Letter Style)
White PU leather makeup bag with colorful chenille SKIN letter patches and silver zipper - White (SKIN Letter Style)
Detail of pink PU leather makeup bag featuring colorful chenille FACE letter patches - Pink (FACE Letter Style)
+2
Chenille Patch PU Leather Cosmetic Bag Large Capacity Waterproof Portable Travel Toiletry Makeup Pouch Zipper For Women
-4%
$2.14
No MOQ
Vintage Bookshelf Print Makeup Bag Fine Linen Zippered Travel Organizer Pouch With Wristlet For Women Classical
Vintage Bookshelf Print Makeup Bag Fine Linen Zippered Travel Organizer Pouch With Wristlet For Women Classical
like
Find Similar
Cosmetic bag with vintage bookshelf print, zipper closure and black wrist strap - Vintage Bookshelf Print / 17*25cm (Linen) with Strap
Vintage Bookshelf Print Makeup Bag Fine Linen Zippered Travel Organizer Pouch With Wristlet For Women Classical
-4%
$1.37
No MOQ
Elegant Butterfly Embossed Makeup Bag Portable Polyester Travel Toiletry Pouch Zipper Cosmetic Organizer Handbag For Women
Elegant Butterfly Embossed Makeup Bag Portable Polyester Travel Toiletry Pouch Zipper Cosmetic Organizer Handbag For Women
like
Find Similar
Detail of light blue butterfly cosmetic bag with gold embroidery and white woven label - Blue
Detailed close-up of purple butterfly embroidery and gold stitching on a gray makeup bag - Pink
Detail of grey butterfly cosmetic bag with embroidery and branded side label - Black
Elegant Butterfly Embossed Makeup Bag Portable Polyester Travel Toiletry Pouch Zipper Cosmetic Organizer Handbag For Women
$2.74
No MOQ
Cute Cartoon Dog Embroidery Quilted Heart Makeup Bag Canvas Large Capacity Portable Travel Cosmetic Pouch Zipper Organizer
Cute Cartoon Dog Embroidery Quilted Heart Makeup Bag Canvas Large Capacity Portable Travel Cosmetic Pouch Zipper Organizer
like
Find Similar
Detail of white quilted makeup bag with dog embroidery and red puppy land text - Painter Dog (With Lanyard)
Detail of white quilted makeup bag featuring cartoon dog embroidery and red zipper closure - Bowknot Dog (With Lanyard)
Detail of cream quilted makeup bag with colorful puppy embroidery and red zipper - Lying Flat Dog (With Lanyard)
Detailed quilted makeup bag with heart patterns and puppy embroidery for organization - Music Dog (With Lanyard)
+1
Cute Cartoon Dog Embroidery Quilted Heart Makeup Bag Canvas Large Capacity Portable Travel Cosmetic Pouch Zipper Organizer
$3.72
No MOQ
Quilted Heart Pattern Makeup Bag Puffy Polyester Cosmetic Toiletry Pouch With Handle For Travel Storage Sweet For Women
Quilted Heart Pattern Makeup Bag Puffy Polyester Cosmetic Toiletry Pouch With Handle For Travel Storage Sweet For Women
like
Find Similar
Detail of white quilted handbag with heart pattern and top metal zipper closure - White
Detail of light purple quilted handbag with unique bear pattern stitching on a wood table - Blue
Detailed view of pink quilted makeup bag with heart pattern and sturdy top handle - Pink
Close-up of black quilted makeup bag with zipper closure and portable top handle - Black
+1
Quilted Heart Pattern Makeup Bag Puffy Polyester Cosmetic Toiletry Pouch With Handle For Travel Storage Sweet For Women
$3.45
No MOQ
Floral Quilted Makeup Bag Portable Cosmetic Pouch Large Capacity Lipstick Storage Organizer Sweet Travel Clutch For Women
Floral Quilted Makeup Bag Portable Cosmetic Pouch Large Capacity Lipstick Storage Organizer Sweet Travel Clutch For Women
like
Find Similar
Detail of white quilted cosmetic bag featuring cute rabbit patterns and a zipper closure - Rabbit
Detailed view of quilted floral cotton makeup bag with rose pattern and zipper closure - Rose Ribbon Pink
Detailed macro view of quilted floral fabric texture with elegant ink flower patterns - Ink Floral
Detailed close-up of blue floral quilted makeup bag with signature woven label - Blue Floral
+1
Floral Quilted Makeup Bag Portable Cosmetic Pouch Large Capacity Lipstick Storage Organizer Sweet Travel Clutch For Women
$2.01
No MOQ
Large Capacity Makeup Bag PU Leather Vertical Stripe Portable Travel Toiletry Wash Organizer Minimalist Zipper Pouch For Women
Large Capacity Makeup Bag PU Leather Vertical Stripe Portable Travel Toiletry Wash Organizer Minimalist Zipper Pouch For Women
like
Find Similar
White vertical stripe PU leather cosmetic bag with gold handle and printed text - Gray
Vertical striped white leather vanity case with golden text and portable handle - Beige
Pink vertical striped PU leather cosmetic bag with gold text and portable handle - Pink
Brown PU leather travel makeup bag with vertical stripes and sturdy top handle - Brown
+1
Large Capacity Makeup Bag PU Leather Vertical Stripe Portable Travel Toiletry Wash Organizer Minimalist Zipper Pouch For Women
-4%
$3.15
No MOQ
Floral Cotton Canvas Makeup Bag Sweet Pencil Case Large Capacity Zipper Pouch Travel Toiletry Organizer
Floral Cotton Canvas Makeup Bag Sweet Pencil Case Large Capacity Zipper Pouch Travel Toiletry Organizer
like
Find Similar
Detail of floral cotton pouch showing pink zipper closure and striped inner lining - Pink Floral
Close-up of small floral cotton pencil case with pink zipper and BEST label detail - Pink Small Floral
Detailed view of pink corduroy pouch with 'best' floral patch on a white tabletop - Twill Skin Pink
Detailed close-up of a pink floral cotton pouch with a zipper and best tag - Five-color Small Flower Pink
+1
Floral Cotton Canvas Makeup Bag Sweet Pencil Case Large Capacity Zipper Pouch Travel Toiletry Organizer
$4.55
No MOQ
Quilted Cotton Makeup Bag Cute Cartoon Bear Floral Print Large Capacity Portable Toiletry Organizer For Women Travel
Quilted Cotton Makeup Bag Cute Cartoon Bear Floral Print Large Capacity Portable Toiletry Organizer For Women Travel
like
Find Similar
Detail of pink quilted bear makeup bag featuring a convenient top handle and zipper - Brown Zoo
Close-up of quilted floral cosmetic bags with cute ribbons and carrying handles - Pink Long-eared Character
Detailed macro view of pink quilted makeup bag with bow prints and sturdy top handle - Blue Ribbon Bear
Detailed macro of quilted makeup bags with cute cherry and cartoon bear patterns - Heart Baby Bear
+1
Quilted Cotton Makeup Bag Cute Cartoon Bear Floral Print Large Capacity Portable Toiletry Organizer For Women Travel
-4%
$4.08
No MOQ
Makeup Bag Checkered Striped Cosmetic Pouch With Bow Flower Embroidery Polyester Canvas Zipper Travel Storage Case For Women
Makeup Bag Checkered Striped Cosmetic Pouch With Bow Flower Embroidery Polyester Canvas Zipper Travel Storage Case For Women
like
Find Similar
Detail of blue plaid makeup bag with embroidered bow and brand label in a desk scene - Blue Grid Blue Bow
Close-up of blue striped fabric makeup bag with bow embroidery and side woven label - Blue Stripe Blue Bow
Blue striped makeup bag with red bow embroidery on a desk with a laptop and mouse - Blue Stripe Red Bow
Detailed close-up of a plaid seersucker makeup pouch with delicate bow embroidery - Black Grid Black Bow
+1
Makeup Bag Checkered Striped Cosmetic Pouch With Bow Flower Embroidery Polyester Canvas Zipper Travel Storage Case For Women
-5%
$2.16
No MOQ
Round Quilted Cosmetic Bag Polyester Portable Makeup Organizer Travel Toiletry Pouch Zipper Handle Soft Macaron Color
Round Quilted Cosmetic Bag Polyester Portable Makeup Organizer Travel Toiletry Pouch Zipper Handle Soft Macaron Color
like
Find Similar
Close-up of a soft quilted shell makeup bag with a top handle and zip closure - Yellow
Detailed close-up of quilted light green shell makeup bag with pink zipper and handle - Green
Close-up of a blue quilted shell makeup bag with Sorakka Studio label and top handle - Light Blue
Close-up of pink quilted shell makeup bag with Sorakka Studio label on bed - Nude Pink
+1
Round Quilted Cosmetic Bag Polyester Portable Makeup Organizer Travel Toiletry Pouch Zipper Handle Soft Macaron Color
-5%
$2.16
No MOQ
Quilted Shell Shape Makeup Bag Soft Polyester Cosmetic Travel Organizer Partitioned Storage Pouch Handle Women
Quilted Shell Shape Makeup Bag Soft Polyester Cosmetic Travel Organizer Partitioned Storage Pouch Handle Women
like
Find Similar
Detail of round quilted shell cosmetic bag with mint green zipper and top handle - Yellow
Detail of quilted green makeup bag with purple zipper and handle on white bedding - Green
Macro detail of a soft quilted shell makeup bag in light blue with Sorakka Studio label - Light Blue
Detailed flat lay of a pink quilted shell makeup bag with blue zipper and handle - Nude Pink
+1
Quilted Shell Shape Makeup Bag Soft Polyester Cosmetic Travel Organizer Partitioned Storage Pouch Handle Women
-5%
$2.16
No MOQ
Vintage Corduroy Makeup Bag Zipper Cosmetic Organizer Portable Travel Storage Pouch For Women Soft Toiletry Wash Bag
Vintage Corduroy Makeup Bag Zipper Cosmetic Organizer Portable Travel Storage Pouch For Women Soft Toiletry Wash Bag
like
Find Similar
Brown corduroy cosmetic bag with a zipper and Big Star & Little Moon label on front - Khaki
Pink corduroy makeup pouch with a vintage label shown in a cozy lifestyle setting - Pink
Vintage yellow corduroy makeup bag with white zipper and tag on white tabletop - Lemon Yellow
+2
Vintage Corduroy Makeup Bag Zipper Cosmetic Organizer Portable Travel Storage Pouch For Women Soft Toiletry Wash Bag
-4%
$2.44
Mix MOQ : 2
 · 
11 views
Women Jacquard Cosmetic Bag Large Capacity Embossed Floral Fruit Pattern Portable Makeup Organizer Zipper Storage Pouch
Women Jacquard Cosmetic Bag Large Capacity Embossed Floral Fruit Pattern Portable Makeup Organizer Zipper Storage Pouch
like
Find Similar
Detail of floral jacquard makeup bag with May Rabbit label and elegant metal zipper - Abundant Flowers
Detail of jacquard fabric makeup bag featuring embossed orange and apple patterns - Yellow Apple
Floral jacquard cosmetic bag with handle shown in a natural cafe setting - Green Pastoral
Detailed view of embossed sunflower jacquard fabric on a beige makeup storage bag - Grey Blue Floral
Women Jacquard Cosmetic Bag Large Capacity Embossed Floral Fruit Pattern Portable Makeup Organizer Zipper Storage Pouch
$3.74
No MOQ
Cartoon Prince Princess Resin Pen Holder Cute Castle Figurine Desktop Makeup Brush Organizer Stationery Storage
Cartoon Prince Princess Resin Pen Holder Cute Castle Figurine Desktop Makeup Brush Organizer Stationery Storage
like
Find Similar
Blue castle desk organizer with a cute prince figurine for stationery and makeup brushes - Prince Style Pen Holder
Cartoon princess resin desktop stationery holder and castle shaped makeup brush storage - Princess Style Pen Holder
Cartoon Prince Princess Resin Pen Holder Cute Castle Figurine Desktop Makeup Brush Organizer Stationery Storage
$6.17
No MOQ
Floral Embroidery Makeup Bag Cotton Linen Zipper Toiletry Cosmetic Storage Pouch Vintage Handheld Travel Organizer Women
Floral Embroidery Makeup Bag Cotton Linen Zipper Toiletry Cosmetic Storage Pouch Vintage Handheld Travel Organizer Women
like
Find Similar
Blue canvas pouch with bird embroidery and green zipper for cosmetic storage - Gray
Portable floral embroidery cosmetic bag in dusty rose cotton with leaf patterns - Brown
Floral Embroidery Makeup Bag Cotton Linen Zipper Toiletry Cosmetic Storage Pouch Vintage Handheld Travel Organizer Women
-4%
$3.81
Mix MOQ : 3
Floral Canvas Cosmetic Bag Portable Zipper Makeup Pouch Small Fabric Coin Purse For Daily Travel Organizer
Floral Canvas Cosmetic Bag Portable Zipper Makeup Pouch Small Fabric Coin Purse For Daily Travel Organizer
like
Find Similar
Floral fabric cosmetic bag in beige with pink flower pattern and woven tag - Striped Rose
Light blue floral cosmetic bag with Sozakka label and purple zipper pull - Striped Branch
Floral Canvas Cosmetic Bag Portable Zipper Makeup Pouch Small Fabric Coin Purse For Daily Travel Organizer
-4%
$1.62
No MOQ
Cartoon Teddy Bear Quilted Cosmetic Bag Diamond Pattern Travel Toiletry Pouch Portable Large Capacity Makeup Organizer
Cartoon Teddy Bear Quilted Cosmetic Bag Diamond Pattern Travel Toiletry Pouch Portable Large Capacity Makeup Organizer
like
Find Similar
Quilted cream makeup bag with cartoon bear patterns and decorative ribbon zipper - Quilted Teddy Bear Makeup Bag
Detail of quilted teddy bear makeup bag with blue plaid patterns and side webbing - Quilted Teddy Bear Wristlet Bag
Detail of cream quilted bear makeup bag with bow pattern and fabric texture close-up - Quilted Teddy Bear Clutch Bag
Cartoon Teddy Bear Quilted Cosmetic Bag Diamond Pattern Travel Toiletry Pouch Portable Large Capacity Makeup Organizer
$2.16-3.60
No MOQ
 · 
70 sold recently
Denim Pencil Case Bow Heart Embroidery Large Capacity Makeup Bag Stationary Organizer Portable For Students Girls
Denim Pencil Case Bow Heart Embroidery Large Capacity Makeup Bag Stationary Organizer Portable For Students Girls
like
Find Similar
Detail of denim pencil case with pink zipper and white embroidered bow patterns on a desk - Light Blue
Close-up of denim pencil case with white bow patterns and branded woven label - Dark Blue
Denim Pencil Case Bow Heart Embroidery Large Capacity Makeup Bag Stationary Organizer Portable For Students Girls
-12%
$1.75
No MOQ
 · 
14 views
Floral Canvas Cosmetic Bag Jacquard Embroidery Makeup Organizer Zippered Portable Toiletries Pouch For Women Travel
Floral Canvas Cosmetic Bag Jacquard Embroidery Makeup Organizer Zippered Portable Toiletries Pouch For Women Travel
like
Find Similar
Floral fabric cosmetic bag in pink and green with woven label and large capacity - Standard / White Floral Print
Floral fabric makeup bag in off-white with pink and green patterns and flower zipper - Small / White Floral Print
Floral textured grass green jacquard cosmetic bag with H&R BAG woven label in a travel size - Small / Green Flower
Light green yarn-dyed makeup bag with pink floral embroidery and H&R BAG woven label - Small / Light Pink Flower
+8
Floral Canvas Cosmetic Bag Jacquard Embroidery Makeup Organizer Zippered Portable Toiletries Pouch For Women Travel
$2.10-2.82
No MOQ
Quilted Cotton Cosmetic Bag Cute Bow Print Toiletry Makeup Organizer Zipper Travel Storage Pouch For Women
Quilted Cotton Cosmetic Bag Cute Bow Print Toiletry Makeup Organizer Zipper Travel Storage Pouch For Women
like
Find Similar
Close-up of white quilted fabric makeup bag featuring blue ribbon pattern and zipper - Blue Bow
Quilted Cotton Cosmetic Bag Cute Bow Print Toiletry Makeup Organizer Zipper Travel Storage Pouch For Women
$2.19
No MOQ
 · 
22 views
Creative House Shaped Makeup Bag Quilted Polyester Cosmetic Storage Pouch With Heart Decor Portable Handle Travel Case
Creative House Shaped Makeup Bag Quilted Polyester Cosmetic Storage Pouch With Heart Decor Portable Handle Travel Case
like
Find Similar
Cute house-shaped makeup bag in purple and pink color block with heart charms - Blue Cottage
Pink and green house-shaped cosmetic bag with heart zipper and brush organizer - Green Cottage
Creative House Shaped Makeup Bag Quilted Polyester Cosmetic Storage Pouch With Heart Decor Portable Handle Travel Case
$3.46
No MOQ
 · 
10 views
Canvas Makeup Bag Portable Zipper Cosmetic Pouch With Wrist Strap Pink Truck Heart Print Toiletry Organizer For Women
Canvas Makeup Bag Portable Zipper Cosmetic Pouch With Wrist Strap Pink Truck Heart Print Toiletry Organizer For Women
like
Find Similar
Canvas makeup bag featuring a pink cartoon truck print and a black wrist strap - Truck With Striped Awning
Cream canvas cosmetic bag with pink cartoon truck and heart prints for makeup storage - Pink Pickup With Hearts
Portable canvas makeup bag with pink vintage truck print and black wrist strap - Truck With Potted Plants
Cream canvas cosmetic bag with pink truck and heart design for Valentine storage - Truck With Giant Heart
+4
Canvas Makeup Bag Portable Zipper Cosmetic Pouch With Wrist Strap Pink Truck Heart Print Toiletry Organizer For Women
-4%
$1.37
No MOQ
Watercolor Giraffe Print Makeup Bag Linen Canvas Cosmetic Pouch Portable Travel Wash Bag With Zipper Wristlet
Watercolor Giraffe Print Makeup Bag Linen Canvas Cosmetic Pouch Portable Travel Wash Bag With Zipper Wristlet
like
Find Similar
Portable giraffe print makeup bag with watercolor design and secure zipper closure - Watercolor Giraffe Pattern 1 (xy-071-1) / With Strap
Portable giraffe print zipper makeup bag with ivory linen texture and wrist strap - Watercolor Giraffe Pattern 2 (xy-071-2) / With Strap
Portable giraffe print makeup bag with zipper and hand strap on white background - Watercolor Giraffe Pattern 3 (xy-071-3) / With Strap
Portable linen makeup bag with giraffe print and black wrist strap for travel - Watercolor Giraffe Pattern 4 (xy-071-4) / With Strap
+4
Watercolor Giraffe Print Makeup Bag Linen Canvas Cosmetic Pouch Portable Travel Wash Bag With Zipper Wristlet
-5%
$1.26-1.31
No MOQ
Linen Cosmetic Bag Zipper Makeup Pouch Valentine Hearts Gnomes Travel Storage Portable Organizer Case For Women
Linen Cosmetic Bag Zipper Makeup Pouch Valentine Hearts Gnomes Travel Storage Portable Organizer Case For Women
like
Find Similar
Off-white canvas cosmetic bag with red Valentine's truck, hearts and roses print - Retro Truck (xy-066-1) / With Wrist Strap
Portable cream makeup bag with colorful heart patterns and black zipper strap - All-over Heart Print (xy-066-2) / With Wrist Strap
Pink gradient ripple cosmetic bag with Love lettering and handy wrist strap - Pink Gradient Love (xy-066-3) / With Wrist Strap
Canvas makeup bag featuring Valentine Gnomes couple and heart pattern with wrist strap - Gnomes Couple (xy-066-4) / With Wrist Strap
+4
Linen Cosmetic Bag Zipper Makeup Pouch Valentine Hearts Gnomes Travel Storage Portable Organizer Case For Women
-5%
$1.26-1.31
No MOQ
Cosmetic Bag Valentine Day Heart Print Linen Makeup Pouch Travel Toiletry Storage Organizer With Zipper Wristlet
Cosmetic Bag Valentine Day Heart Print Linen Makeup Pouch Travel Toiletry Storage Organizer With Zipper Wristlet
like
Find Similar
Canvas Valentine makeup bag with red heart design and Love BE MY Valentine print - BE MY Valentine Heart Style (With Strap) / 17x25cm
Canvas makeup bag featuring love YOU Forever print and a black wristlet strap - Love YOU Forever Heart Style (With Strap) / 17x25cm
White canvas makeup bag with red love heart print and black wristlet strap - LOVE You Text Background Style (With Strap) / 17x25cm
Valentine's Day gnome print canvas makeup bag with Be Mine lettering and wrist strap - BE MINE Gnomes Style (With Strap) / 17x25cm
+4
Cosmetic Bag Valentine Day Heart Print Linen Makeup Pouch Travel Toiletry Storage Organizer With Zipper Wristlet
-5%
$1.26-1.31
No MOQ
Autumn Fall Harvest Maple Leaf Pumpkin Gnome Print Fine Linen Makeup Bag Zipper Closure Wristlet Travel Toiletry Pouch
Autumn Fall Harvest Maple Leaf Pumpkin Gnome Print Fine Linen Makeup Bag Zipper Closure Wristlet Travel Toiletry Pouch
like
Find Similar
Cream makeup bag with orange maple leaf print and black zipper for Thanksgiving - Single Maple Leaf Print-With Wrist Strap(xy-042-01)
Thanksgiving makeup bag with pumpkin and autumn maple leaf prints on a white background - Pumpkin Maple Leaf Print-With Wrist Strap(xy-042-02)
Portable Thanksgiving makeup bag featuring watercolor pumpkins and autumn floral patterns - Harvest Fruit Floral Print-With Wrist Strap(xy-042-03)
Portable Thanksgiving makeup bag with autumn gnome and pumpkin print on canvas - Gnome with Pumpkin Print-With Wrist Strap(xy-042-04)
+4
Autumn Fall Harvest Maple Leaf Pumpkin Gnome Print Fine Linen Makeup Bag Zipper Closure Wristlet Travel Toiletry Pouch
-5%
$1.26-1.31
No MOQ
Vintage Floral Bird Pattern Linen Makeup Bag Zippered Cosmetic Toiletry Pouch Portable Travel Organizer For Women
Vintage Floral Bird Pattern Linen Makeup Bag Zippered Cosmetic Toiletry Pouch Portable Travel Organizer For Women
like
Find Similar
Vintage floral bird print cosmetic bag in off-white canvas with convenient hand strap - Pink Rose Bird Pattern With Wrist Strap (xy-018-01) / 17x25cm
Vintage floral bird print cosmetic pouch with wristlet strap and black zipper - Cyan Bird Pink Rose Pattern With Wrist Strap (xy-018-02) / 17x25cm
Floral butterfly print makeup bag with black zipper and wrist strap in vintage style - Blue Butterfly Pink Flower Pattern With Wrist Strap (xy-018-03) / 17x25cm
Cosmetic bag featuring vintage floral and bird prints with a black zipper and handle strap - Vintage Rose Peony Bird Pattern With Wrist Strap (xy-018-04) / 17x25cm
+4
Vintage Floral Bird Pattern Linen Makeup Bag Zippered Cosmetic Toiletry Pouch Portable Travel Organizer For Women
-5%
$1.26-1.31
No MOQ
Portable Foldable Air Cushion Hair Comb With Makeup Mirror Cute Cartoon Animal Alphabet Pattern ABS Plastic Massage Hairbrush For Travel Women Girls Students
Portable Foldable Air Cushion Hair Comb With Makeup Mirror Cute Cartoon Animal Alphabet Pattern ABS Plastic Massage Hairbrush For Travel Women Girls Students
like
Find Similar
Portable folding hairbrush with mirror and cute cartoon alligator and letter A print - Crocodile Style A
Folding hairbrush with mirror featuring a cute cartoon bear and letter B design - Bear Style B
Foldable air cushion hairbrush with mirror featuring cute orange cat cartoon pattern - Cat Style C
Portable folding hairbrush mirror with cute blue dolphin and yellow letter D design - Dolphin Style D
+22
Portable Foldable Air Cushion Hair Comb With Makeup Mirror Cute Cartoon Animal Alphabet Pattern ABS Plastic Massage Hairbrush For Travel Women Girls Students
$0.92
No MOQ
Pencil Case Large Capacity Canvas Portable Stationery Bag Stand Up Pen Pouch Plaid Aesthetic Makeup Organizer For Students
Pencil Case Large Capacity Canvas Portable Stationery Bag Stand Up Pen Pouch Plaid Aesthetic Makeup Organizer For Students
like
Find Similar
Pink checkered canvas pencil case with green handle and zipper puller on a wood chair - Pink
Vertical yellow canvas pencil case with light blue handles and a macaron color scheme - Yellow
Pencil Case Large Capacity Canvas Portable Stationery Bag Stand Up Pen Pouch Plaid Aesthetic Makeup Organizer For Students
-11%
$2.51
No MOQ
Plush Checkerboard Pencil Case Large Capacity Lamb Wool Makeup Bag Stationery Storage Pouch For Students Japanese Style
Plush Checkerboard Pencil Case Large Capacity Lamb Wool Makeup Bag Stationery Storage Pouch For Students Japanese Style
like
Find Similar
Large capacity waffle fleece pencil case with yellow checkerboard pattern and zipper - Yellow Plaid
Close-up of green waffle lamb wool stationery bag with checkerboard pattern and label - Green Check
Pink and white waffle fleece pencil case with soft lamb wool texture and large capacity - Pink Plaid
Plush Checkerboard Pencil Case Large Capacity Lamb Wool Makeup Bag Stationery Storage Pouch For Students Japanese Style
-12%
$2.00
No MOQ
Quilted Cotton Pencil Case Gingham Bow Print Makeup Bag Large Capacity Stationery Storage Pouch For Girls Students
Quilted Cotton Pencil Case Gingham Bow Print Makeup Bag Large Capacity Stationery Storage Pouch For Girls Students
like
Find Similar
Quilted floral pencil case and makeup bag in beige cotton with blue flowers - Small / Blue Floral
Quilted white pencil case with pink bows and zipper, sweet aesthetic stationery bag - Small / Korean Style Bow Pink
Quilted cream pencil case with pink floral patterns and ribbon bow detailing - Small / Rose Ribbon Pink
Quilted white pencil case with blue bow pattern and smooth zipper closure - Small / Korean Style Bow Blue
+1
Quilted Cotton Pencil Case Gingham Bow Print Makeup Bag Large Capacity Stationery Storage Pouch For Girls Students
$1.59
No MOQ
Quilted Heart Pattern Drawstring Storage Bag Floral Lining Mini Bucket Makeup Pouch Desktop Jewelry Organizer For Women
Quilted Heart Pattern Drawstring Storage Bag Floral Lining Mini Bucket Makeup Pouch Desktop Jewelry Organizer For Women
like
Find Similar
Detail of pink quilted drawstring storage bag with heart pattern and floral trim - Crinkle Heart Light Pink
Detail of light blue quilted drawstring pouch with heart patterns and floral fabric trim - Crinkle Heart Light Blue
Close-up of quilted blue striped drawstring storage bag with floral lining and tassel detail - Blue Stripe Heart
Detail of drawstring storage bag with heart quilted fabric and floral inner lining - Pink Stripe Heart
+1
Quilted Heart Pattern Drawstring Storage Bag Floral Lining Mini Bucket Makeup Pouch Desktop Jewelry Organizer For Women
-5%
$2.16
No MOQ
Plush Checkerboard Pencil Case Cute Bear Makeup Bag Fuzzy Portable Cosmetic Storage Pouch With Hand Strap Ins Style
Plush Checkerboard Pencil Case Cute Bear Makeup Bag Fuzzy Portable Cosmetic Storage Pouch With Hand Strap Ins Style
like
Find Similar
Detail of checkered plush makeup bag with teddy bear patch and woven carrying handle - Khaki
Detail of plush checkerboard makeup bag with cute bear label and side woven handle - Gray
Detail of plush checkered makeup bag with cute bear patch and woven carrying strap - Black
Plush Checkerboard Pencil Case Cute Bear Makeup Bag Fuzzy Portable Cosmetic Storage Pouch With Hand Strap Ins Style
$1.15
Mix MOQ : 2
Makeup Train Case With LED Lighted Mirror Quilted PU Leather Large Capacity Portable Travel Organizer Cosmetic Box Handle
Makeup Train Case With LED Lighted Mirror Quilted PU Leather Large Capacity Portable Travel Organizer Cosmetic Box Handle
like
Find Similar
Pink quilted large capacity makeup bag with gold zippers and leather handle - Pink LED 3-Color Light
Large black diamond pattern PU leather cosmetic box with gold zippers and top handle - Black LED 3-Color Light
Quilted beige PU leather makeup case with reinforced top handle and gold zipper - Beige LED 3-Color Light
Makeup Train Case With LED Lighted Mirror Quilted PU Leather Large Capacity Portable Travel Organizer Cosmetic Box Handle
$18.99
Mix MOQ : 3
Floral Makeup Bag Printed Cotton Canvas Zipper Pouch Travel Cosmetic Organizer Handheld Phone Storage Retro Style
Floral Makeup Bag Printed Cotton Canvas Zipper Pouch Travel Cosmetic Organizer Handheld Phone Storage Retro Style
like
Find Similar
Top view of blue and green floral liberty print makeup bag on a minimalist white background - Ocean Blue Large Floral
Floral print canvas makeup pouch with simple wish label and blue botanical patterns - Ocean Blue Small Floral
Close-up of pink floral liberty print canvas makeup bag with a simple wish woven label - Rose Pink Large Floral
Detailed close-up of floral liberty print cotton makeup bag with simple wish label - Rose Pink Small Floral
Floral Makeup Bag Printed Cotton Canvas Zipper Pouch Travel Cosmetic Organizer Handheld Phone Storage Retro Style
$4.38
No MOQ
Quilted Storage Bag Cloud Texture Polyester Portable Zipper Square Pouch For Sanitary Napkin Makeup Travel Macaron Color
Quilted Storage Bag Cloud Texture Polyester Portable Zipper Square Pouch For Sanitary Napkin Makeup Travel Macaron Color
like
Find Similar
Detail of light yellow quilted makeup bag with cloud patterns and a metal zipper - Yellow
Detail of pink quilted storage bag with cloud stitching on a white wavy surface - Pink
Detail of white quilted cloud pattern on soft portable travel storage cosmetic bag - White
Close-up of light blue cloud-quilted fabric storage bag with color-matched zipper - Blue
Quilted Storage Bag Cloud Texture Polyester Portable Zipper Square Pouch For Sanitary Napkin Makeup Travel Macaron Color
$1.44
Mix MOQ : 3
Vertical Stripe Drawstring Storage Pouch Fabric Portable Small Makeup Bag Jewelry Organizer Gadget Pocket For Women
Vertical Stripe Drawstring Storage Pouch Fabric Portable Small Makeup Bag Jewelry Organizer Gadget Pocket For Women
like
Find Similar
Close-up of a striped drawstring storage pouch with blue cords and colorful sozakka label - Jacquard Striped White
Detail of pink striped drawstring pouch with soft fabric texture and woven label - Jacquard Striped Pink
Close-up of striped drawstring storage pouch with pink cords on beige fabric surface - Jacquard Striped Brown
Vertical Stripe Drawstring Storage Pouch Fabric Portable Small Makeup Bag Jewelry Organizer Gadget Pocket For Women
-12%
$1.24
No MOQ
Free Shipping
Sunflower Butterfly Print Makeup Bag Linen Polyester Cosmetic Pouch Zipper Portable Storage Case For Women Students
Sunflower Butterfly Print Makeup Bag Linen Polyester Cosmetic Pouch Zipper Portable Storage Case For Women Students
like
Find Similar
Spring cosmetic bag with butterfly and sunflower prints featuring a black wrist strap - Sunflower Butterfly Print Style(xy-095-1) / 17x25cm (Fine Linen) with Webbing
Sunflower Butterfly Print Makeup Bag Linen Polyester Cosmetic Pouch Zipper Portable Storage Case For Women Students
-5%
$1.26-1.31
No MOQ
Makeup Bag Imitation Linen Cosmetic Pouch Heart Print Valentine Theme Zipper Toiletry Organizer With Wrist Strap For Women
Makeup Bag Imitation Linen Cosmetic Pouch Heart Print Valentine Theme Zipper Toiletry Organizer With Wrist Strap For Women
like
Find Similar
Beige canvas makeup bag featuring pink beetle car and heart gift box print with black handle - Pink Vintage Car & Heart
Pink striped makeup bag with HUGS kisses print and black zipper closure - HUGS Kisses Gradient Stripe
Beige cosmetic bag with pink heart prints, black zipper and convenient handle - All-over Heart Candy Print
Pink gradient canvas makeup bag with Better Together heart print in minimalist style - BETTER Together Gradient Pink
Makeup Bag Imitation Linen Cosmetic Pouch Heart Print Valentine Theme Zipper Toiletry Organizer With Wrist Strap For Women
-5%
$1.51
No MOQ
 · 
10 views
Quilted Floral Patchwork Makeup Bag Polyester Lace Hollow Out Cosmetic Pouch Soft Large Capacity Storage Organizer Clutch For Women
Quilted Floral Patchwork Makeup Bag Polyester Lace Hollow Out Cosmetic Pouch Soft Large Capacity Storage Organizer Clutch For Women
like
Find Similar
Detail of floral quilted cosmetic bag with brand label and soft fabric texture closeup - Pink Plaid
Macro view of floral quilted cotton makeup bag with knit texture and Sozakka label - Purple Plaid
Flat lay of a floral quilted lace makeup bag with zipper on a minimalist white desk - Blue Plaid
Quilted Floral Patchwork Makeup Bag Polyester Lace Hollow Out Cosmetic Pouch Soft Large Capacity Storage Organizer Clutch For Women
-5%
$2.16
No MOQ
Striped Makeup Bag And Lipstick Pouch Large Capacity Cosmetic Organizer Portable Zippered Travel Daily Use Women Knit Fabric
Striped Makeup Bag And Lipstick Pouch Large Capacity Cosmetic Organizer Portable Zippered Travel Daily Use Women Knit Fabric
like
Find Similar
Detailed macro view of striped knit cosmetic bag with a secure zipper closure - Lipstick Pouch
Detailed close-up of striped textured canvas makeup bag with sozakka beaute woven label - Makeup Bag
Striped Makeup Bag And Lipstick Pouch Large Capacity Cosmetic Organizer Portable Zippered Travel Daily Use Women Knit Fabric
-5%
$1.18-1.89
No MOQ
Makeup Bag And Pouch Canvas Colorful Embroidered Polka Dot Zipper Cosmetic Travel Portable Storage Organizer For Women
Makeup Bag And Pouch Canvas Colorful Embroidered Polka Dot Zipper Cosmetic Travel Portable Storage Organizer For Women
like
Find Similar
White canvas cosmetic bag with colorful embroidered dots on a bright minimalist desk - White with Colorful Polka Dots
Makeup Bag And Pouch Canvas Colorful Embroidered Polka Dot Zipper Cosmetic Travel Portable Storage Organizer For Women
-5%
$1.89
No MOQ
 · 
23 views
Large Capacity Corduroy Makeup Bag Solid Color Portable Cosmetic Pouch For Women Travel Toiletry Storage Zip Bag
Large Capacity Corduroy Makeup Bag Solid Color Portable Cosmetic Pouch For Women Travel Toiletry Storage Zip Bag
like
Find Similar
Light blue corduroy makeup bag with zipper closure shown with cosmetics inside - Light Green
Green corduroy makeup bag with soft ribbed texture and zipper closure in Morandi style - Dark Green
Pink corduroy makeup bag with internal space for brushes and cosmetics on fabric - Dusty Pink
Pink corduroy makeup pouch with zipper closure and soft striped texture - Pink
+2
Large Capacity Corduroy Makeup Bag Solid Color Portable Cosmetic Pouch For Women Travel Toiletry Storage Zip Bag
$1.59
Mix MOQ : 5
Linen Makeup Bag Heart Printed XOXO Cosmetic Pouch With Zipper And Wristlet For Travel Valentine Gift
Linen Makeup Bag Heart Printed XOXO Cosmetic Pouch With Zipper And Wristlet For Travel Valentine Gift
like
Find Similar
Portable heart print makeup bag with zipper and hand strap on white background - Black Vine Heart Style (Style 1)
Cream canvas cosmetic bag with red I Heart U print and sturdy black zipper handle - Beige I Heart U (Style 2)
Black canvas cosmetic bag with red heart pattern and portable wrist strap - Black Spiral Pattern Heart Style (Style 3)
Portable cream canvas cosmetic bag with red heart pattern and XOXO print for women - Beige XOXO Heart Style (Style 4)
Linen Makeup Bag Heart Printed XOXO Cosmetic Pouch With Zipper And Wristlet For Travel Valentine Gift
-4%
$1.37
No MOQ
Quilted Makeup Bag Bow Print Cosmetic Pouch Ruffle Edge Aesthetic Zipper Travel Organizer For Women Girls
Quilted Makeup Bag Bow Print Cosmetic Pouch Ruffle Edge Aesthetic Zipper Travel Organizer For Women Girls
like
Find Similar
Quilted bow makeup bag set with ruffled blue edges and floral patterns in two sizes - Large / Blue
Quilted cream cosmetic bag set with pink bow pattern and ruffle trim detailing - Large / Pink
Quilted white cosmetic bag set with black bow patterns and ruffle trim details - Large / Black
+3
Quilted Makeup Bag Bow Print Cosmetic Pouch Ruffle Edge Aesthetic Zipper Travel Organizer For Women Girls
$2.45-2.65
No MOQ
Quilted Cosmetic Bag Cute Teddy Bear Flower Pattern Large Capacity Toiletry Organizer Travel Pouch Handheld Makeup Case For Women Girls
Quilted Cosmetic Bag Cute Teddy Bear Flower Pattern Large Capacity Toiletry Organizer Travel Pouch Handheld Makeup Case For Women Girls
like
Find Similar
Detail of beige quilted cosmetic bag with teddy bear print and a red zipper closure - Quilted Bear Pencil Case
Detail of cream quilted cotton pencil bag with vintage bear and flower prints and red zipper - Quilted Floral Bear Pencil Case
Detailed view of cream quilted cosmetic bag with cute cartoon bears and colorful floral patterns - Quilted Floral Bear Cosmetic Bag (Medium)
Beige quilted bear cosmetic bag with zipper, portable pouch for travel and makeup storage - Quilted Bear Cosmetic Bag (Medium)
+2
Quilted Cosmetic Bag Cute Teddy Bear Flower Pattern Large Capacity Toiletry Organizer Travel Pouch Handheld Makeup Case For Women Girls
-5%
$1.48-3.12
No MOQ
 · 
13 views
Cute Angel Wings Makeup Bag Fabric Star Print Portable Camera Storage Pouch Zipper Handheld Kawaii Organizer
Cute Angel Wings Makeup Bag Fabric Star Print Portable Camera Storage Pouch Zipper Handheld Kawaii Organizer
like
Find Similar
Compact white pencil pouch with silver star pattern and carabiner for school use - Multi-layer Card Bag / White
Light blue fabric pencil pouch with silver star pattern and secure snap closure - Multi-layer Card Bag / Blue
Quilted pencil case with stars and polka dots in light blue and white - Quilted Storage Bag / Blue
Pink and white quilted star pattern pencil case with snap closure - Quilted Storage Bag / Pink
+6
Cute Angel Wings Makeup Bag Fabric Star Print Portable Camera Storage Pouch Zipper Handheld Kawaii Organizer
$2.02-3.69
No MOQ
Free Shipping
Quilted Gingham Cosmetic Bag Large Capacity Cotton Makeup Organizer Portable Travel Toiletry Wash Pouch For Women Girls
Quilted Gingham Cosmetic Bag Large Capacity Cotton Makeup Organizer Portable Travel Toiletry Wash Pouch For Women Girls
like
Find Similar
Close-up of pink checkered quilted makeup bag with yellow zipper and woven red pull cord - Orange
Close-up of purple checkered quilted makeup bag with lime green zipper and logo detail - Purple
Detail of green checkered quilted cosmetic bag with orange zipper and pink cord pulls - Green
Detail of blue plaid quilted makeup bag with yellow zipper and woven knot puller - Blue
Quilted Gingham Cosmetic Bag Large Capacity Cotton Makeup Organizer Portable Travel Toiletry Wash Pouch For Women Girls
$3.60
No MOQ
Gingham Plaid Cosmetic Bag Cotton Fabric Travel Wash Pouch Large Capacity Makeup Organizer Soft Contrast Color Portable
Gingham Plaid Cosmetic Bag Cotton Fabric Travel Wash Pouch Large Capacity Makeup Organizer Soft Contrast Color Portable
like
Find Similar
Pink and white checkered cosmetic bag with zipper closure and large capacity storage - Pink
Detailed view of sky blue checkered cotton pouch with zipper in a lifestyle setting - Blue
Detail of light yellow plaid fabric cosmetic bag with zipper on a minimalist white desk - Yellow
Gingham Plaid Cosmetic Bag Cotton Fabric Travel Wash Pouch Large Capacity Makeup Organizer Soft Contrast Color Portable
-4%
$0.96
No MOQ
Floral Cotton Makeup Bag Portable Canvas Zipper Pouch Cosmetic Storage Small Travel Organizer Fresh Sweet Style Women
Floral Cotton Makeup Bag Portable Canvas Zipper Pouch Cosmetic Storage Small Travel Organizer Fresh Sweet Style Women
like
Find Similar
Detail of floral cotton makeup bag with simple wish label and smooth zipper closure - Yellow Floral
Floral cotton small cosmetic bag with zipper and simple wish label on a home desk - Grey Floral
Floral cotton small cosmetic pouch with zipper closure and simple wish woven label detail - Blue and Yellow Flowers
Floral Cotton Makeup Bag Portable Canvas Zipper Pouch Cosmetic Storage Small Travel Organizer Fresh Sweet Style Women
$3.46
No MOQ
Floral Cosmetic Bag Cotton Canvas Zipper Pouch Makeup Storage Organizer Portable Travel Handheld Toiletry Case For Women
Floral Cosmetic Bag Cotton Canvas Zipper Pouch Makeup Storage Organizer Portable Travel Handheld Toiletry Case For Women
like
Find Similar
Floral makeup bag with pink and green patterns, large capacity fabric storage pouch - Pink Floral
Light blue floral cotton cosmetic bag with yellow flowers and a zipper closure - Blue Floral
Floral print cotton makeup bag in cream white with blue and purple flower patterns - Blue Floral
Floral Cosmetic Bag Cotton Canvas Zipper Pouch Makeup Storage Organizer Portable Travel Handheld Toiletry Case For Women
-5%
$2.16
No MOQ
Makeup Brush Storage Bag Roll Up Case Floral Print Canvas Cotton Portable Travel Pouch Ribbon Tie Organizer
Makeup Brush Storage Bag Roll Up Case Floral Print Canvas Cotton Portable Travel Pouch Ribbon Tie Organizer
like
Find Similar
Floral fabric makeup brush roll organizer with pink ribbon tie on a white surface - Twill Floral Beige
Floral fabric roll-up organizer for makeup brushes with pink ribbon tie and corduroy texture - Twill Floral Blue
Detail of floral makeup brush roll bag with pink ribbon bow on a decorative desk - Twill Floral Pink
Top view of floral fabric rolls tied with pink ribbon for makeup bag sewing - Twill Flowers
+1
Makeup Brush Storage Bag Roll Up Case Floral Print Canvas Cotton Portable Travel Pouch Ribbon Tie Organizer
-4%
$2.44
No MOQ
Cherry Embroidery Quilted Fabric Pencil Case Large Capacity Portable Handheld Cosmetic Makeup Bag For Students Travel
Cherry Embroidery Quilted Fabric Pencil Case Large Capacity Portable Handheld Cosmetic Makeup Bag For Students Travel
like
Find Similar
Detail of white quilted cherry embroidery cosmetic bag with zip and side handle strap - Black Cherry Embroidery
Close-up of cute cherry embroidery on a white quilted vanity bag with top handle - Red Cherry Embroidery
Cherry Embroidery Quilted Fabric Pencil Case Large Capacity Portable Handheld Cosmetic Makeup Bag For Students Travel
-4%
$1.78
Mix MOQ : 2
Mini Quilted Coin Purse Shiny Double Lattice Bows Lipstick Storage Bag Portable Makeup Pouch Korean Sweet For Women
Mini Quilted Coin Purse Shiny Double Lattice Bows Lipstick Storage Bag Portable Makeup Pouch Korean Sweet For Women
like
Find Similar
Detail of white quilted cosmetic bag with gingham bows on a lifestyle desktop - Off-white
Detailed top view of a mint green quilted cosmetic bag with cute decorative bows - Light Green
Detailed view of pink quilted lipstick bag with bow accents on a desk setup - Pink
Close-up of a purple quilted cosmetic bag with pink and red checkered bows on a desk - Purple
+2
Mini Quilted Coin Purse Shiny Double Lattice Bows Lipstick Storage Bag Portable Makeup Pouch Korean Sweet For Women
$1.67
No MOQ
Go to

More in beauty

Explore more in makeup remover

diytoolsplasticnaturalheartfiber false eyelashespartyglovelayerfacial cleaning puffs
carecleaningdoublefingertravelhangingstrapstylewoven

Ready to source like an insider

Get a direct line to the factory floor — no minimums, no middlemen, no guesswork.
iconReal factory pricing, no markup in betweeniconEvery order hand-inspected before it shipsicon5,000+ new products added daily
Get Inside Access