Everful

Wholesale makeup remover

Beauty tools and accessories sourced from vetted factories, inspected before shipping.

Sign Up
Makeup Remover

Find the perfect pieces: makeup puffs & sponges, makeup mirrors, eyelid tools

filterShow Filters
Best Seller
New Arrivals
Price Drop
Free Shipping
Heart Shaped Powder Puff Flocking Sponge With Finger Strap For Foundation Setting Powder Soft Velvet Face Makeup Tool
Heart Shaped Powder Puff Flocking Sponge With Finger Strap For Foundation Setting Powder Soft Velvet Face Makeup Tool
like
Find Similar
Pink heart-shaped flocked powder puff with ribbon finger strap for precise makeup - Heart Shaped Puff / Pink
Heart-shaped thumb makeup puff in nude skin tone with integrated finger strap - Heart Shaped Puff / Nude
Light blue heart-shaped flocking makeup puff for powder foundation and setting - Heart Shaped Puff / Blue
Pink heart-shaped velvet makeup puff with red piping for flawless setting and foundation - Heart Shaped Puff / Rose Red
+7
Heart Shaped Powder Puff Flocking Sponge With Finger Strap For Foundation Setting Powder Soft Velvet Face Makeup Tool
$0.10
Mix MOQ : 3
 · 
100 sold recently
Professional Makeup Brushes Collection Soft Synthetic Fiber Bristles Face Eye Shadow Foundation Powder Cosmetic Brushes Storage Bag
Professional Makeup Brushes Collection Soft Synthetic Fiber Bristles Face Eye Shadow Foundation Powder Cosmetic Brushes Storage Bag
like
Find Similar
Pink 13-piece makeup brush set with soft dual-tone bristles on a pink storage pouch - 13Pcs Pink [OPP Bag]
13-piece soft makeup brush set in black with wooden handles and matching storage bag - 13Pcs Black [OPP Bag]
13pcs matcha green makeup brush set with velvet drawstring bag and soft synthetic bristles - 13Pcs Matcha Green + Velvet Bag
13-piece dark red makeup brush set with soft yellow bristles in a yellow drawstring pouch - 13Pcs Goose Yellow + Velvet Bag
+13
Professional Makeup Brushes Collection Soft Synthetic Fiber Bristles Face Eye Shadow Foundation Powder Cosmetic Brushes Storage Bag
-5%
$0.82-1.04
No MOQ
 · 
32 sold recently
Soft Bristle Lash Cleaning Brush Deep Pore Nose Washing Tool Portable Synthetic Fiber Face Brush For Eyelash Extension
Soft Bristle Lash Cleaning Brush Deep Pore Nose Washing Tool Portable Synthetic Fiber Face Brush For Eyelash Extension
like
Find Similar
Detail view of a professional eyelash cleaning brush with white bristles and golden ferrule - Black Without Lash Pattern
Detail view of a white lash cleansing brush with a golden ferrule on minimalist background - White Without Lash Pattern
Detail of pink pore cleansing brush with gold ferrule and soft white bristles - Pink Without Lash Pattern
Portable nose cleaning brush with white bristles and gold ferrule on pink cube - White With Lash Pattern
+5
Soft Bristle Lash Cleaning Brush Deep Pore Nose Washing Tool Portable Synthetic Fiber Face Brush For Eyelash Extension
$0.17-0.20
Mix MOQ : 100
 · 
30 views
Makeup Sponge Beauty Egg With Eggshell Storage Case Portable Silicone Strap Non-Latex Hydrophilic Polyurethane Applicator
Makeup Sponge Beauty Egg With Eggshell Storage Case Portable Silicone Strap Non-Latex Hydrophilic Polyurethane Applicator
like
Find Similar
Detailed view of colorful makeup sponges in frosted translucent packaging with logo - Water Drop - Set / Multicolor
Pink teardrop makeup sponge with a clear egg-shaped storage case and hanging strap - Teardrop / Pink
Pink gourd makeup sponge with protective egg-shaped storage case and hanging hook - Gourd Shape / Pink
Detail of pink teardrop beauty sponge with egg-shaped storage case and hanging rope - Slanted Cut Shape / Pink
+20
Makeup Sponge Beauty Egg With Eggshell Storage Case Portable Silicone Strap Non-Latex Hydrophilic Polyurethane Applicator
$0.46-2.54
No MOQ
 · 
10 views
Oversized Round Powder Puff Soft Velvet Plush Satin Ribbon Handle Body Face Setting Makeup Tool
Oversized Round Powder Puff Soft Velvet Plush Satin Ribbon Handle Body Face Setting Makeup Tool
like
Find Similar
Extra large 130mm white velvet powder puff with satin ribbon handle for body setting - 130mm Super Soft 【White】
Macro view of extra large 11.5cm velvet powder puff being measured with a caliper - 130mm Super Soft 【Skin Color】
Extra large purple velvet body powder puff with silk ribbon handle, size 130mm and 150mm - 130mm Super Soft 【Deep Purple】
Macro shot of 130x30mm light purple velvet powder puff with ribbon handle for body setting - 130mm Super Soft 【Light Purple】
+3
Oversized Round Powder Puff Soft Velvet Plush Satin Ribbon Handle Body Face Setting Makeup Tool
-14%
$0.55-0.69
No MOQ
 · 
130 sold recently
Makeup Brush Cleaner Sponge Box Dry Color Removal Quick Wash Tinplate Portable Cosmetic Tool
Makeup Brush Cleaner Sponge Box Dry Color Removal Quick Wash Tinplate Portable Cosmetic Tool
like
Find Similar
Portable round black activated carbon sponge for dry cleaning makeup brushes - Single Layer Sponge Core / Black
Black and white activated carbon sponge filter for cosmetic brush cleaning box - Double Layer Sponge Core / Black
Silver metal makeup brush cleaner tin with black carbon sponge for dry cleaning - Single Layer Set / Silver
Silver makeup brush cleaner box with charcoal black sponge and center white hole - Double Layer Set / Silver
+2
Makeup Brush Cleaner Sponge Box Dry Color Removal Quick Wash Tinplate Portable Cosmetic Tool
-8%
$0.11-0.47
Mix MOQ : 50
 · 
34 views
Soft Flocking Triangular Makeup Powder Puffs With Ribbon Handle For Setting Loose Powder Face Contouring Tool
Soft Flocking Triangular Makeup Powder Puffs With Ribbon Handle For Setting Loose Powder Face Contouring Tool
like
Find Similar
Detail of soft black triangular powder puff in clear protective hanging packaging - White Empty Bag
Pink triangular powder puff with ribbon handle in a holographic zip lock packaging - Holographic Empty Bag
Black triangular velvet powder puff with satin finger strap for makeup setting - Black Triangle
Soft purple triangular velvet powder puff with silk ribbon handle for setting makeup - Purple Triangle
+6
Soft Flocking Triangular Makeup Powder Puffs With Ribbon Handle For Setting Loose Powder Face Contouring Tool
-25%
$0.03-0.15
Mix MOQ : 3
 · 
293 sold recently
Professional Slant Tip Eyebrow Tweezers 430 Stainless Steel High Precision Hair Removal Makeup Tool For Men Women
Professional Slant Tip Eyebrow Tweezers 430 Stainless Steel High Precision Hair Removal Makeup Tool For Men Women
like
Find Similar
High-quality purple stainless steel eyebrow tweezers with a matte finish for grooming - Purple
Professional orange stainless steel slant tip eyebrow tweezers for precise grooming - Orange
Light blue precision stainless steel slanted tweezers for eyebrow grooming and beauty care - Blue
Silver stainless steel slanted tweezers for precise eyebrow shaping and beauty use - Silver
+1
Professional Slant Tip Eyebrow Tweezers 430 Stainless Steel High Precision Hair Removal Makeup Tool For Men Women
-4%
$1.34-1.43
Mix MOQ : 2
 · 
24 sold recently
Free Shipping
Mini Makeup Sponges Hydrophilic Polyurethane Soft Elastic Teardrop Shape For Foundation Concealer Dry Wet Use Portable Jar
Mini Makeup Sponges Hydrophilic Polyurethane Soft Elastic Teardrop Shape For Foundation Concealer Dry Wet Use Portable Jar
like
Find Similar
Set of 10 mini teardrop makeup sponges in mixed colors within a transparent jar - 10 Pcs/Jar - Mixed Color (01)
Mini makeup sponge set with 10 multicolor teardrop puffs featuring white snowflake patterns - 10 Pcs/Jar - Mixed Color (02)
Set of 10 nude teardrop makeup sponges in a transparent storage jar for beauty blending - 10 Pcs/Jar - Nude (03)
Set of 10 grey teardrop makeup sponges in a branded storage container with snowflake design - 10 Pcs/Jar - Grey (04)
+8
Mini Makeup Sponges Hydrophilic Polyurethane Soft Elastic Teardrop Shape For Foundation Concealer Dry Wet Use Portable Jar
$1.59
No MOQ
 · 
24 sold recently
Disposable Silicone Eyelash Brushes Spiral Mascara Wands Makeup Tools For Brow Lash Extensions Plastic Handle Multi Shape
Disposable Silicone Eyelash Brushes Spiral Mascara Wands Makeup Tools For Brow Lash Extensions Plastic Handle Multi Shape
like
Find Similar
50pcs disposable silicone eyelash brushes with pink heads and black plastic handles - Tower Shape / Deep Pink
50 pieces of disposable eyelash brushes with black handles and pink silicone brush heads - Ball Shape / Deep Pink
Disposable mascara wands with black handles and pink silicone heads in bulk pack - Knife Shape / Deep Pink
50pcs disposable silicone eyelash brushes with pink brush heads and black handles - Pineapple Shape / Deep Pink
+4
Disposable Silicone Eyelash Brushes Spiral Mascara Wands Makeup Tools For Brow Lash Extensions Plastic Handle Multi Shape
$1.61
No MOQ
 · 
54 sold recently
Mini Makeup Sponge Egg Non Latex Hydrophilic Polyurethane Water Drop Shape Dry Wet Dual Use Soft Blending Concealer Tool
Mini Makeup Sponge Egg Non Latex Hydrophilic Polyurethane Water Drop Shape Dry Wet Dual Use Soft Blending Concealer Tool
like
Find Similar
Soft pink teardrop-shaped makeup sponge for smooth foundation blending on white background - Pink
Black teardrop makeup sponge in non-latex material for dry and wet cosmetic application - Black
Macro shot of a light blue teardrop makeup sponge showing fine non-latex texture - Blue
Mint green teardrop makeup sponge for wet and dry application on a white background - Green
+6
NewMini Makeup Sponge Egg Non Latex Hydrophilic Polyurethane Water Drop Shape Dry Wet Dual Use Soft Blending Concealer Tool
-30%
$0.07
No MOQ
 · 
105 sold recently
Stainless Steel Foundation Spatula Makeup Scraper Palette Knife For Liquid Foundation Concealer Mixing Facial Beauty Tool
Stainless Steel Foundation Spatula Makeup Scraper Palette Knife For Liquid Foundation Concealer Mixing Facial Beauty Tool
like
Find Similar
Silver stainless steel makeup spatula 160mm professional foundation mixing tool - 304 Stainless Steel High Quality/Foundation Spatula / PP Bag
Stainless steel foundation spatula with beige leather storage pouch makeup tool - 304 Stainless Steel High Quality/Foundation Spatula / Leather Case + PP Bag
Faux leather makeup spatula sleeve in beige and khaki dual-tone finish, size 173x28mm - Foundation Spatula Dedicated Leather Case / PP Bag
Heart-shaped stainless steel makeup spatula and facial scraping tool in silver finish - Heart-shaped Massage Plate/Mirror Polish / PP Bag
+7
Stainless Steel Foundation Spatula Makeup Scraper Palette Knife For Liquid Foundation Concealer Mixing Facial Beauty Tool
$0.20-1.15
No MOQ
 · 
1 reviews
Soft Makeup Sponge Puff Hydrophilic Non Latex Dry Wet Dual Use Cartoon Bear Motif Flawless Base Makeup Applicator
Soft Makeup Sponge Puff Hydrophilic Non Latex Dry Wet Dual Use Cartoon Bear Motif Flawless Base Makeup Applicator
like
Find Similar
Waterdrop-shaped beige makeup sponge with cute bear print and Luck lettering detail - Style B-Heart/Cushion Shape
Milk coffee teardrop makeup puff with bear party pattern and ribbon handle - Style A-Teardrop Shape
Soft Makeup Sponge Puff Hydrophilic Non Latex Dry Wet Dual Use Cartoon Bear Motif Flawless Base Makeup Applicator
-4%
$0.58
No MOQ
 · 
107 sold recently
Hydrophilic Non-Latex Makeup Sponge Slant Cut Teardrop Beauty Blender Expanding In Water Foundation Puff For Women Tools
Hydrophilic Non-Latex Makeup Sponge Slant Cut Teardrop Beauty Blender Expanding In Water Foundation Puff For Women Tools
like
Find Similar
Professional brown teardrop makeup sponge with slanted edge for precise application - Slanted Teardrop Shape / Coffee
Flat-cut teardrop makeup sponge in deep red wine color with a polished mirror reflection - Slanted Teardrop Shape / Burgundy
Matcha green teardrop makeup sponge with slanted edge for precise makeup application - Slanted Teardrop Shape / Matcha Green
Hydrophilic latex-free teardrop makeup sponge in black finish for smooth blending - Slanted Teardrop Shape / Black
+1
Hydrophilic Non-Latex Makeup Sponge Slant Cut Teardrop Beauty Blender Expanding In Water Foundation Puff For Women Tools
$0.58
No MOQ
Flannel Headband And Wristbands With Makeup Sponges And Powder Puffs For Skincare Face Washing Cosmetic Application
Flannel Headband And Wristbands With Makeup Sponges And Powder Puffs For Skincare Face Washing Cosmetic Application
like
Find Similar
14-piece pink flannel makeup set with headband, wristbands, powder puffs and sponges - 15pcs Set / Pink
Purple makeup set with flannel headband, wristbands, powder puffs and beauty sponges - 15pcs Set / Purple
15-piece light blue makeup set with headband, wristbands, beauty blenders, and puffs - 15pcs Set / Blue
15pcs black flannel spa headband set with wristbands and makeup powder puffs - 15pcs Set / Black
Flannel Headband And Wristbands With Makeup Sponges And Powder Puffs For Skincare Face Washing Cosmetic Application
$3.89
Mix MOQ : 3
 · 
59 views
Non Latex Mini Makeup Sponge Set Water Drop Shape Cosmetic Puffs For Liquid Foundation Cream Dry Wet Use Makeup Blender Set With Bucket
Non Latex Mini Makeup Sponge Set Water Drop Shape Cosmetic Puffs For Liquid Foundation Cream Dry Wet Use Makeup Blender Set With Bucket
like
Find Similar
12-piece pink teardrop makeup sponge set with clear storage jar for dry and wet use - Set of 12 / Pink
Set of 12 black teardrop makeup sponges in a clear storage jar for wet and dry use - Set of 12 / Black
Pink teardrop makeup sponge set in transparent storage jar for seamless blending - Set of 12 / Rose Red
Detail of 12 green non-latex teardrop makeup sponges in a clear storage jar - Set of 12 / Matcha Green
+7
Non Latex Mini Makeup Sponge Set Water Drop Shape Cosmetic Puffs For Liquid Foundation Cream Dry Wet Use Makeup Blender Set With Bucket
-32%
$1.01
No MOQ
 · 
10 views
Hydrophilic Sponge Makeup Puff And Flat Foundation Brush With Stainless Steel Mixing Palette Professional Cosmetic Face Tool
Hydrophilic Sponge Makeup Puff And Flat Foundation Brush With Stainless Steel Mixing Palette Professional Cosmetic Face Tool
like
Find Similar
Macro detail of purple and green makeup sponges in clear cases on knit fabric - Green + Purple 2-Piece Set / Transparent Box Packaging
Purple sponge makeup puff with SISSIMU strap for flawless foundation application - Purple / Transparent Box Packaging
Detail showing a purple leaf-shaped makeup sponge and flat foundation brush with silver handle - Purple Puff + Foundation Brush Set / Transparent Box Packaging / Purple
Bright green teardrop makeup sponge with wide finger strap on a clean white background - Green / Transparent Box Packaging
+26
Hydrophilic Sponge Makeup Puff And Flat Foundation Brush With Stainless Steel Mixing Palette Professional Cosmetic Face Tool
-5%
$0.41-3.08
Mix MOQ : 3
 · 
109 sold recently
Free Shipping
Makeup Brushes Professional Gradient Synthetic Fiber Transparent Glitter Liquid Handle Face Eye Beauty Tools
Makeup Brushes Professional Gradient Synthetic Fiber Transparent Glitter Liquid Handle Face Eye Beauty Tools
like
Find Similar
7pcs glitter liquid sand handle makeup brush set with blue gradient bristles and PVC pouch - With Bag / Blue
7-piece transparent glitter handle makeup brush set with soft blue and purple bristles - Without Bag / Blue
7-piece pink glitter makeup brush set with transparent liquid sand crystal handles - Without Bag / Pink
Makeup Brushes Professional Gradient Synthetic Fiber Transparent Glitter Liquid Handle Face Eye Beauty Tools
$1.44-1.59
No MOQ
 · 
22 sold recently
Peach Shape Makeup Sponge Cosmetic Puff Non Latex Hydrophilic Polyurethane Soft Wet Dry Use With Transparent Storage Case
Peach Shape Makeup Sponge Cosmetic Puff Non Latex Hydrophilic Polyurethane Soft Wet Dry Use With Transparent Storage Case
like
Find Similar
Peach-shaped makeup blender sponge in cherry blossom pink with a clear storage case - Ice Cream Box Cherry Pink / Sakura Pink
Macro detail of peach beauty blender with translucent matte storage case and white lid - Ice Cream Box Light Brown / Tan
Violet teardrop makeup sponge with its translucent storage jar on a white background - Ice Cream Box Violet / Violet
Lemon yellow peach beauty blender with a transparent peach-shaped storage jar - Ice Cream Box Lemon Yellow / Lemon Yellow
+2
Peach Shape Makeup Sponge Cosmetic Puff Non Latex Hydrophilic Polyurethane Soft Wet Dry Use With Transparent Storage Case
$0.43-0.58
No MOQ
 · 
72 sold recently
Plastic Face Mask Spatulas PP Mixing Sticks Skin Care Makeup Tools Applicator Scraper For DIY Facial Beauty Tool
Plastic Face Mask Spatulas PP Mixing Sticks Skin Care Makeup Tools Applicator Scraper For DIY Facial Beauty Tool
like
Find Similar
Light green plastic facial mask mixing spatula tool on dark wood background - Pack of 100 / Transparent Yellow
Blue silicone spatula tool for mixing masks with rounded handle on wood texture - Pack of 100 / Transparent Blue
Single purple plastic facial mask spatula on a dark wood texture background - Pack of 100 / Transparent Purple
Vibrant bright green plastic facial mask mixing stick on a textured brown wood background - Pack of 100 / Transparent Green
+12
Plastic Face Mask Spatulas PP Mixing Sticks Skin Care Makeup Tools Applicator Scraper For DIY Facial Beauty Tool
$0.02-2.02
No MOQ
 · 
18 views
Stainless Steel Beauty Scissors Curved Pointed Eyebrow Trimmer Sharp Manicure Nose Hair Precision Grooming For Men Women
Stainless Steel Beauty Scissors Curved Pointed Eyebrow Trimmer Sharp Manicure Nose Hair Precision Grooming For Men Women
like
Find Similar
Thickened stainless steel beauty scissors in silver finish for facial grooming - Pointed Tip Beauty Scissors / Silver/Stainless Steel
Professional round-tip stainless steel grooming scissors for nose hair and eyebrow trimming - Round Tip Nose Hair Scissors / Silver/Stainless Steel
Sharp stainless steel beauty scissors with ergonomic purple handles on a soft pink backdrop - Pointed Tip Beauty Scissors / Purple
Blue-grey handle stainless steel nose hair scissors with sharp curved blades for grooming - Pointed Tip Beauty Scissors / Blue
+5
Stainless Steel Beauty Scissors Curved Pointed Eyebrow Trimmer Sharp Manicure Nose Hair Precision Grooming For Men Women
$0.09-0.14
Mix MOQ : 3
 · 
3K+ sold recently
Chubby Foundation Brush Portable Soft Synthetic Fiber Round Flat Top Face Makeup Tool For Powder Blush
Chubby Foundation Brush Portable Soft Synthetic Fiber Round Flat Top Face Makeup Tool For Powder Blush
like
Find Similar
Portable kabuki makeup brushes in black, pink, and white with soft synthetic bristles - Small Chubby Flat Top Black Handle Silver Tube White Tip
Portable foundation brush with pink yellow purple gradient bristles and pink handle - Small Chubby Light Pink Silver Rainbow Hair
Portable chubby foundation brush with pink gradient bristles and gold white handle - Big Chubby White Gold Pink Hair (With Net)
Pink gradient makeup brush with gold ferrule and pink handle on white background - Big Chubby Pink Gold Pink Hair (With Net)
+61
Chubby Foundation Brush Portable Soft Synthetic Fiber Round Flat Top Face Makeup Tool For Powder Blush
$0.43-1.14
Mix MOQ : 3
 · 
2K+ sold recently
Makeup Sponges Hydrophilic Non-Latex Soft For Wet Dry Foundation Blending Multiple Shapes Colorful Beauty Tools
Makeup Sponges Hydrophilic Non-Latex Soft For Wet Dry Foundation Blending Multiple Shapes Colorful Beauty Tools
like
Find Similar
Set of 7 soft makeup sponges in strawberry, mango, avocado, and taro shades - 7-Piece Fat Bottle Set / Yellow Series
Set of 4 makeup sponge boxes in purple, green, yellow, and pink colors for wet or dry use - 4-Grid Makeup Sponge Set / Pink Series
32-piece soft makeup sponge set with 4 boxes of colorful teardrop beauty blenders - 8-Grid Makeup Sponge Set / Pink Series
Soft makeup sponge set with four teardrop blenders in a portable plastic storage box - 4-Grid Color Box Makeup Sponge Set / Pink Series
+28
Makeup Sponges Hydrophilic Non-Latex Soft For Wet Dry Foundation Blending Multiple Shapes Colorful Beauty Tools
$0.58-1.30
No MOQ
 · 
42 sold recently
Professional Makeup Brushes Synthetic Fiber For Powder Foundation Eyeshadow Concealer Blending Face Eye Beauty Tools
Professional Makeup Brushes Synthetic Fiber For Powder Foundation Eyeshadow Concealer Blending Face Eye Beauty Tools
like
Find Similar
12pcs holiday makeup brush set with silver gray handles on beige pleated cloth - Chujian 14Pcs Set + OPP Bag
9-piece makeup brush set with purple handles and gold ferrules for powder and eyeshadow - Purple Sweet Potato 9Pcs Set
Pink 8-piece makeup brush set for powder and eyeshadow in a clear zip storage bag - 8Pcs Pink Set
Pink 8-piece makeup brush set with silver ferrules in a clear zippered travel pouch - 8Pcs Apricot Set
+37
Professional Makeup Brushes Synthetic Fiber For Powder Foundation Eyeshadow Concealer Blending Face Eye Beauty Tools
-5%
$0.47-4.20
No MOQ
 · 
39 views
Heart Shaped Compressed Facial Sponges Cellulose Wood Pulp Cotton Soft Exfoliating Face Wash Sponge Makeup Removal
Heart Shaped Compressed Facial Sponges Cellulose Wood Pulp Cotton Soft Exfoliating Face Wash Sponge Makeup Removal
like
Find Similar
Purple heart-shaped compressed facial sponge made of natural cellulose for skin cleansing - Purple Heart 70x60x8mm 10 Pcs
Stack of white heart-shaped compressed cellulose sponges in clear plastic bag - White Heart 70x60x8mm 20 Pcs
Pink heart-shaped compressed cellulose sponge for facial cleansing and makeup removal - Pink Heart 60*6mm 10 Pcs
Pink heart-shaped compressed cellulose face sponges in clear bulk packaging - Pink Heart 60*6mm 20 Pcs
+14
Heart Shaped Compressed Facial Sponges Cellulose Wood Pulp Cotton Soft Exfoliating Face Wash Sponge Makeup Removal
-9%
$0.10-6.54
No MOQ
 · 
21 sold recently
Mermaid Tail Handle Makeup Brushes Gradient Fish Scale Synthetic Fiber For Foundation Eyeshadow Powder Blending
Mermaid Tail Handle Makeup Brushes Gradient Fish Scale Synthetic Fiber For Foundation Eyeshadow Powder Blending
like
Find Similar
10pcs mermaid makeup brush set with purple gradient fish scale handles and rose gold ferrule - 15Pcs Light Blue Gradient
Detailed dimensions of mermaid makeup brush with a 17.5cm length and 4cm brush head width - Single Large Fan Brush Gold
Detail of mermaid tail makeup brushes with gradient glitter handles and purple fiber tips - 6Pcs Frosted Purple Gradient
Detail of 6pcs mermaid tail makeup brushes with pink green gradient handles and soft bristles - 6Pcs Light Blue Gradient
+4
Mermaid Tail Handle Makeup Brushes Gradient Fish Scale Synthetic Fiber For Foundation Eyeshadow Powder Blending
-5%
$1.45-5.48
No MOQ
 · 
44 sold recently
Free Shipping
Mushroom Head Makeup Sponge With Handle Hydrophilic Non-latex Foundation Beauty Blender Soft Face Cosmetic Puff For Wet Dry Use
Mushroom Head Makeup Sponge With Handle Hydrophilic Non-latex Foundation Beauty Blender Soft Face Cosmetic Puff For Wet Dry Use
like
Find Similar
Pink mushroom head makeup sponge blender with metallic handle in clear PVC box - Mushroom Makeup Puff / Light Pink
Mushroom Head Makeup Sponge With Handle Hydrophilic Non-latex Foundation Beauty Blender Soft Face Cosmetic Puff For Wet Dry Use
-4%
$1.79
No MOQ
 · 
11 sold recently
Eyebrow Shaping Cream Waterproof Sweatproof Long Lasting Brow Styling Wax With Double Ended Brush Wild Eye Makeup Effect
Eyebrow Shaping Cream Waterproof Sweatproof Long Lasting Brow Styling Wax With Double Ended Brush Wild Eye Makeup Effect
like
Find Similar
Transparent eyebrow shaping wax 01# with brush for professional brow styling look - No.1 Transparent Styling Soap
Eyebrow shaping wax set in 06 white shade including a dual-ended brush for styling - No.6 White
Brown eyebrow shaping balm in shade 02 with application brush for wild brow look - No.2 Coffee
Eyebrow shaping kit in dark brown including styling wax and dual-ended brush applicator - No.3 Dark Brown
+2
Eyebrow Shaping Cream Waterproof Sweatproof Long Lasting Brow Styling Wax With Double Ended Brush Wild Eye Makeup Effect
$1.01
No MOQ
 · 
22 sold recently
Silicone Makeup Brush Cleaner Bowl Foldable Scrubber Box Hanging Drying Rack Storage Organizer Portable Cosmetic Tool
Silicone Makeup Brush Cleaner Bowl Foldable Scrubber Box Hanging Drying Rack Storage Organizer Portable Cosmetic Tool
like
Find Similar
Purple Cleaning Bowl OPP Package
Light brown silicone makeup brush cleaning mat with various textures in a polybag - Apricot Cleaning Bowl OPP Package
Purple Cleaning Bowl With Storage Box
Beige silicone makeup brush cleaning bowl with multi-texture bottom and drying rack box - Apricot Cleaning Bowl With Storage Box
+2
Silicone Makeup Brush Cleaner Bowl Foldable Scrubber Box Hanging Drying Rack Storage Organizer Portable Cosmetic Tool
$2.45-4.61
Mix MOQ : 3
Soft Non-Latex Makeup Sponge For Dry Wet Use Teardrop Gourd Beveled Beauty Blender High Density Cosmetic Puff For Liquid Foundation
Soft Non-Latex Makeup Sponge For Dry Wet Use Teardrop Gourd Beveled Beauty Blender High Density Cosmetic Puff For Liquid Foundation
like
Find Similar
Sky blue drop-shaped makeup sponge for smooth foundation blending and flawless makeup application - Teardrop / Blue
Pink teardrop makeup sponge for flawless foundation blending with soft texture - Teardrop / Pink
Rose pink teardrop makeup sponge made of soft latex-free material for foundation - Teardrop / Rose Red
Classic beige gourd-shaped makeup sponge blender for smooth liquid foundation application - Gourd Shape / Nude
+40
Soft Non-Latex Makeup Sponge For Dry Wet Use Teardrop Gourd Beveled Beauty Blender High Density Cosmetic Puff For Liquid Foundation
-64%
$0.10-0.43
No MOQ
 · 
13 views
Makeup Brush Collection Professional Beauty Tools Soft Synthetic Fiber Bristles Pink Plastic Handle Portable Eye Face
Makeup Brush Collection Professional Beauty Tools Soft Synthetic Fiber Bristles Pink Plastic Handle Portable Eye Face
like
Find Similar
5-Piece makeup brush set in pink featuring soft bristles and transparent OPP packaging - 5Pcs Set (OPP Bag)
Pink 5-piece makeup brush set with gradient bristles in clear PVC packaging bag - 5Pcs Set (PVC Bag)
Pink makeup brush with gradient bristles and matte handle in protective packaging - Single Large Foundation Brush
Pink makeup brush with silver ferrule and soft ombre bristles in clear plastic bag - Single Eyeshadow Brush
+1
Makeup Brush Collection Professional Beauty Tools Soft Synthetic Fiber Bristles Pink Plastic Handle Portable Eye Face
$0.05-0.36
No MOQ
 · 
216 sold recently
Evil Eye Print Makeup Bag Polyester Portable Zipper Toiletry Travel Organizer Pouch For Women Mystical Bohemian Style
Evil Eye Print Makeup Bag Polyester Portable Zipper Toiletry Travel Organizer Pouch For Women Mystical Bohemian Style
like
Find Similar
Detail of black cosmetic bag with evil eye and star print and smooth zipper closure - Black Star Moon Eye 658
Macro detail of beige Evil Eye makeup bag showing fabric texture and zipper closure - Beige All-seeing Eye 661
Detailed view of black travel cosmetic bag with golden evil eye print and side loop handle - Black Radiance Eye 663
Black cosmetic bag with golden evil eye and celestial patterns on white background - Black Eye of Providence 664
+7
Evil Eye Print Makeup Bag Polyester Portable Zipper Toiletry Travel Organizer Pouch For Women Mystical Bohemian Style
$1.59
No MOQ
 · 
219 sold recently
Portable Metal Eyelash Curler Rainbow Colorful Wide Angle Eye Lash Curling Tool With Silicone Pad For Women Makeup
Portable Metal Eyelash Curler Rainbow Colorful Wide Angle Eye Lash Curling Tool With Silicone Pad For Women Makeup
like
Find Similar
Silver stainless steel eyelash curler with dimensions 11cm height and 3.8cm width - A5 With Spring Chrome Plated
Portable rose gold stainless steel eyelash curler with black pad and spring-loaded grip - A5 With Spring Electrophoresis Rose Red
Portable rose gold eyelash curler with dimensions and professional wide-angle design - A5 Electroplated Rose Gold
Portable rainbow titanium eyelash curler with 4cm wide angle head for curly lashes - A5 Rose Gold Rubber Grip Handle
+11
Portable Metal Eyelash Curler Rainbow Colorful Wide Angle Eye Lash Curling Tool With Silicone Pad For Women Makeup
$0.36-0.73
Mix MOQ : 3
 · 
17 sold recently
Heart Shaped Powder Puff Plush Velour Setting Sponge With Ribbon Handle Soft Cosmetic Face Makeup Tool
Heart Shaped Powder Puff Plush Velour Setting Sponge With Ribbon Handle Soft Cosmetic Face Makeup Tool
like
Find Similar
Professional heart-shaped black velvet powder puff with finger strap for makeup - Black
Detail view of pink heart-shaped powder puff with soft velvet texture and finger strap - Nude
Detail of pink heart-shaped powder puff with ribbon handle and plush texture - Pink
Detail of a heart-shaped teal velvet powder puff with matching finger ribbon strap - Green
+4
Heart Shaped Powder Puff Plush Velour Setting Sponge With Ribbon Handle Soft Cosmetic Face Makeup Tool
-8%
$0.22
No MOQ
 · 
238 sold recently
Makeup Brushes Crystal Diamond Cut Handle Synthetic Fiber Professional Face Eye Beauty Tool Gradient Iridescent
Makeup Brushes Crystal Diamond Cut Handle Synthetic Fiber Professional Face Eye Beauty Tool Gradient Iridescent
like
Find Similar
Detail of 10-piece makeup brush set with purple crystal handles and gradient bristles - 10Pcs Purple Handle Brown Bristles
Five professional crystal handle makeup brushes with white bristles and silver ferrules - 5Pcs White Handle White Bristles
Detailed row of 11 blue crystal makeup brushes with gradient handles on white background - 10Pcs Crystal Blue Handle Blue Bristles
Detail of 10-piece crystal makeup brush set with pink bristles and diamond handles - 10Pcs Crystal Pink Handle Pink Bristles
+10
Makeup Brushes Crystal Diamond Cut Handle Synthetic Fiber Professional Face Eye Beauty Tool Gradient Iridescent
$2.85-6.05
Mix MOQ : 2
 · 
73 views
Makeup Sponge Blender Foundation Applicator With Handle Water Drop Shape Non Latex Synthetic Sponge For Liquid BB Cream Wet Dry Use Soft
Makeup Sponge Blender Foundation Applicator With Handle Water Drop Shape Non Latex Synthetic Sponge For Liquid BB Cream Wet Dry Use Soft
like
Find Similar
Set of 9 makeup tools featuring teardrop sponges, plush puffs and triangular velvet sponges - Black 9-Piece Set: Transparent OPP Bag
Set of 9 makeup sponges including teardrop blenders, puff balls and triangle puffs - Rose Red 9-Piece Set: Transparent OPP Bag
9-piece makeup set including teardrop brushes, plush puffs, and triangular sponge applicators - Nude 9-Piece Set: Transparent OPP Bag
Professional 16-piece makeup kit with sponge brushes and triangular powder puffs - Black 16-Piece Set: Transparent OPP Bag
+4
Makeup Sponge Blender Foundation Applicator With Handle Water Drop Shape Non Latex Synthetic Sponge For Liquid BB Cream Wet Dry Use Soft
$0.46-1.99
Mix MOQ : 3
 · 
14 views
Hydrophilic Non-Latex Makeup Puff Black Round Air Cushion Sponge For Liquid Foundation BB Cream Wet Dry Use Cosmetic Blender
Hydrophilic Non-Latex Makeup Puff Black Round Air Cushion Sponge For Liquid Foundation BB Cream Wet Dry Use Cosmetic Blender
like
Find Similar
1 option
Hydrophilic Non-Latex Makeup Puff Black Round Air Cushion Sponge For Liquid Foundation BB Cream Wet Dry Use Cosmetic Blender
$0.27
No MOQ
Professional Metal Eyelash Curler With Silicone Pad Long Lasting 3D Curl Portable Eye Makeup Tool For Women
Professional Metal Eyelash Curler With Silicone Pad Long Lasting 3D Curl Portable Eye Makeup Tool For Women
like
Find Similar
Black metal 3D curling eyelash curler with white silicone pad in pink blister packaging - Model 7017 / Black
Professional Metal Eyelash Curler With Silicone Pad Long Lasting 3D Curl Portable Eye Makeup Tool For Women
-5%
$0.34
No MOQ
 · 
73 sold recently
Portable Retractable Makeup Brush With Lid Aluminum Handle Synthetic Fiber For Loose Powder Blush Foundation Cosmetic Beauty Tool
Portable Retractable Makeup Brush With Lid Aluminum Handle Synthetic Fiber For Loose Powder Blush Foundation Cosmetic Beauty Tool
like
Find Similar
Detail of portable retractable makeup brush with soft beige bristles and black case - Small Round Head / Plastic Handle White Bristles
Portable retractable makeup brush with black cylindrical handle and dual-color bristles - Black Lipstick Style Telescopic Brush / Black
Portable retractable makeup brush in sleek black finish for loose powder and blush application - Small / Plastic Handle Black Bristles
Portable retractable powder brush in soft pink finish with protective cap and fiber bristles - Small / Plastic Handle Pink Bristles
+57
Portable Retractable Makeup Brush With Lid Aluminum Handle Synthetic Fiber For Loose Powder Blush Foundation Cosmetic Beauty Tool
-5%
$1.23-2.20
No MOQ
 · 
53 sold recently
Free Shipping
Makeup Brush Cleaning Box Silicone Scrubber Mat Heart Bear Shape Cosmetic Tool Sponge Dry Wet Dual Use Portable
Makeup Brush Cleaning Box Silicone Scrubber Mat Heart Bear Shape Cosmetic Tool Sponge Dry Wet Dual Use Portable
like
Find Similar
Pink bear-shaped silicone makeup brush cleaning pad with dual-sided dry sponge - Little Bear Dry Cleaning Sponge Pad / Pink
Mint green silicone makeup brush cleaning mat and dry sponge box with cat ears - Little Bear Dry Cleaning Sponge Pad / Green
Pink bear-shaped silicone makeup brush cleaning mat and dry sponge set for tools - Little Bear Dry Cleaning Sponge Pad / Rose Red
Beige bear silicone makeup brush cleaner mat and dry sponge box set for beauty tools - Little Bear Dry Cleaning Sponge Pad / Nude
+14
Makeup Brush Cleaning Box Silicone Scrubber Mat Heart Bear Shape Cosmetic Tool Sponge Dry Wet Dual Use Portable
$0.58-0.66
No MOQ
Cosmetic Bag PU Leather Large Capacity Makeup Organizer Portable Travel Toiletry Pouch Quilted Stripe Top Handle Waterproof
Cosmetic Bag PU Leather Large Capacity Makeup Organizer Portable Travel Toiletry Pouch Quilted Stripe Top Handle Waterproof
like
Find Similar
Portable light purple quilted leather makeup bag with double handles and dual zippers - Gray
Portable light green PU leather makeup bag with vertical stripes and top handle - Light Green
Brown textured PU leather makeup bag with top handle and gold-tone double zippers - Coffee
Cream white makeup bag with vertical stitching, handle, and round double metal zippers - Beige
+3
Cosmetic Bag PU Leather Large Capacity Makeup Organizer Portable Travel Toiletry Pouch Quilted Stripe Top Handle Waterproof
-5%
$2.24
No MOQ
 · 
192 sold recently
Top 10% Best Sellers
in Makeup Bags & Organizers
Soft Makeup Puffs Hydrophilic Non-Latex Sponge Dry Wet Use Foundation Base Applicator For BB Cream Square Shape
Soft Makeup Puffs Hydrophilic Non-Latex Sponge Dry Wet Use Foundation Base Applicator For BB Cream Square Shape
like
Find Similar
Soft yellow square air cushion powder puff with 'Butter' ribbon for makeup base - Bulk Packaging / 8.5t Butter Puff
Square brown sponge cushion puff with Chocolate ribbon for soft foundation application - Bulk Packaging / 8.5t Chocolate Puff
Soft purple square makeup sponge with Grape ribbon for flawless foundation application - Bulk Packaging / 8.5t Grape Puff
Soft green square makeup sponge puff with Avocado ribbon handle for foundation application - Bulk Packaging / 8.5t Avocado Puff
+20
Soft Makeup Puffs Hydrophilic Non-Latex Sponge Dry Wet Use Foundation Base Applicator For BB Cream Square Shape
-9%
$0.12-1.04
Mix MOQ : 3
 · 
100 sold recently
Portable Electric Heated Eyelash Curler Quick Heating Constant Temperature Eye Makeup Tool For Long Lasting Natural Curl
Portable Electric Heated Eyelash Curler Quick Heating Constant Temperature Eye Makeup Tool For Long Lasting Natural Curl
like
Find Similar
Electric eyelash curler with white and pink finish featuring heated pad and indicator light - Pink
Electric eyelash curler in white and pink design with cute paw pattern heating pad - Purple
Electric eyelash curler set with pink manual applicator tool in white background - Electric Curler + Eyelash Card
Electric eyelash curler in pink and white paired with aloe temperature color changing lipstick - Electric Curler + Lipstick
+6
Portable Electric Heated Eyelash Curler Quick Heating Constant Temperature Eye Makeup Tool For Long Lasting Natural Curl
$0.99-1.35
No MOQ
 · 
50 sold recently
Disposable Eyelash Brush With Portable Tube Glitter Handle Mascara Wand Spoolie For Eyelash Extensions Eyebrow Grooming
Disposable Eyelash Brush With Portable Tube Glitter Handle Mascara Wand Spoolie For Eyelash Extensions Eyebrow Grooming
like
Find Similar
Disposable mascara wand with silver glitter handle in a clear protective storage tube - Black
Portable eyelash brush with yellow spiral head in a clear tube with gold glitter cap - Yellow
Pink disposable mascara wand in crystal tube with glitter handle and rhinestone cap - Red
Pink glitter crystal spoolie brush for eyelash extensions in a clear protective tube - Rose Red
+6
Disposable Eyelash Brush With Portable Tube Glitter Handle Mascara Wand Spoolie For Eyelash Extensions Eyebrow Grooming
$0.12
No MOQ
 · 
36 sold recently
Giant Makeup Sponge Egg Hydrophilic Polyurethane Multi-Faceted Slanted Cut Water Expandable Cosmetic Puff
Giant Makeup Sponge Egg Hydrophilic Polyurethane Multi-Faceted Slanted Cut Water Expandable Cosmetic Puff
like
Find Similar
Pink teardrop makeup sponge with slanted cut surface for professional makeup - Bulk/Loose Packaging / Honey Pink
Pink multi-faceted giant makeup sponge puff with unique three-cut surface design - OPP Bag / Nude
Pink giant beauty sponge in a black transparent hanging pouch for makeup application - Self-sealing Bag / Honey Pink
Pink multi-angle cut makeup sponge stored in a clear cylindrical plastic jar with white lid - Cylindrical Box / Honey Pink
+4
Giant Makeup Sponge Egg Hydrophilic Polyurethane Multi-Faceted Slanted Cut Water Expandable Cosmetic Puff
$0.78-0.92
No MOQ
 · 
22 sold recently
Makeup Brush Cleaner Box TPR Plastic Cleaning Mat Drying Rack Hanging Organizer For Cosmetic Brushes Sponges
Makeup Brush Cleaner Box TPR Plastic Cleaning Mat Drying Rack Hanging Organizer For Cosmetic Brushes Sponges
like
Find Similar
Pink animal-themed makeup brush cleaning box with portable handle and textured mat - Pink Bear
Panda-shaped multi-functional makeup brush cleaning box in creamy white finish - Panda White
Purple silicone makeup brush cleaning bowl with grey handle and textured bottom - Simple Purple
Beige makeup brush cleaning drying rack with grey handle and grid base in beige - Simple White
Makeup Brush Cleaner Box TPR Plastic Cleaning Mat Drying Rack Hanging Organizer For Cosmetic Brushes Sponges
-4%
$1.81
Mix MOQ : 2
 · 
10 sold recently
Disposable Crystal Handle Eyelash Brushes Spiral Mascara Spoolies Wands For Extensions Eyebrow Brushes Multi-Color Makeup Tools
Disposable Crystal Handle Eyelash Brushes Spiral Mascara Spoolies Wands For Extensions Eyebrow Brushes Multi-Color Makeup Tools
like
Find Similar
Disposable pink mascara wands with glitter crystal handles for eyelash extensions. - 50 Brushes / Crystal Pink
Disposable pink eyelash brushes with glitter crystal handles for makeup extension - 50 Brushes / Crystal Red
Disposable pink eyelash brushes with clear glitter crystal handles for makeup - 50 Brushes / Crystal Rose Red
Disposable purple eyelash brushes with glitter crystal stems for makeup extensions - 50 Brushes / Crystal Purple
+7
Disposable Crystal Handle Eyelash Brushes Spiral Mascara Spoolies Wands For Extensions Eyebrow Brushes Multi-Color Makeup Tools
-5%
$0.16-0.38
No MOQ
 · 
166 sold recently
Rose Flower Nail Dust Cleaning Brush Multi-functional Soft Synthetic Fiber Makeup Brush For Manicure And Face Powder Women Beauty Tools
Rose Flower Nail Dust Cleaning Brush Multi-functional Soft Synthetic Fiber Makeup Brush For Manicure And Face Powder Women Beauty Tools
like
Find Similar
Set of 4 gradient nail dust brushes with rhinestone handles in pink, yellow, blue and red - No. 2 (Short Mushroom Brush) / Black Handle With Colored Rhinestones
Elegant black makeup brush with fiber bristles for powder and blush application - No. 3 (Elegant Black)
Rose gold makeup brush with soft pink fiber bristles in fan shape, 15cm long size - No. 4 (Rose Gold Pink)
Wooden nail dust brush with purple gradient synthetic bristles for manicure cleaning - No. 5 (Vintage Brush) / Wooden Handle
+11
Rose Flower Nail Dust Cleaning Brush Multi-functional Soft Synthetic Fiber Makeup Brush For Manicure And Face Powder Women Beauty Tools
$0.52-1.87
No MOQ
 · 
70 sold recently
Free Shipping
Makeup Sponges Non-Latex Hydrophilic Polyurethane Beauty Egg With Metal Stand Dry Wet Use Soft Elastic Beveled Teardrop
Makeup Sponges Non-Latex Hydrophilic Polyurethane Beauty Egg With Metal Stand Dry Wet Use Soft Elastic Beveled Teardrop
like
Find Similar
Pink makeup sponge set with teardrop blenders and rose gold stand in a gift box - Pink
Purple and pink makeup sponge set with rose gold metal holder in space themed packaging - Purple
Makeup Sponges Non-Latex Hydrophilic Polyurethane Beauty Egg With Metal Stand Dry Wet Use Soft Elastic Beveled Teardrop
-4%
$1.15
Mix MOQ : 12
 · 
53 sold recently
Hydrophilic Polyurethane Makeup Puffs Non Latex Dry Wet Use Soft Sponge For Foundation BB Cream With Storage Case
Hydrophilic Polyurethane Makeup Puffs Non Latex Dry Wet Use Soft Sponge For Foundation BB Cream With Storage Case
like
Find Similar
7-piece strawberry pink round cushion puff set with portable storage case for BB cream - Round Shape (7 Pcs Set) / Strawberry Pink
7-piece set of round brown makeup puffs with translucent orange storage box - Round Shape (7 Pcs Set) / Egg Yolk Coffee
Teardrop makeup sponge set in dark green with storage case for BB cream application - Waterdrop Shape (7 Pcs Set) / Pineapple Dark Green
7-piece dark green round non-latex makeup puff set with matching storage case - Round Shape (7 Pcs Set) / Pineapple Dark Green
Hydrophilic Polyurethane Makeup Puffs Non Latex Dry Wet Use Soft Sponge For Foundation BB Cream With Storage Case
$0.69
No MOQ
 · 
73 sold recently
Makeup Palette Clear Acrylic Mixing Plate With Thumb Hole For Foundation Lipstick Nail Art Professional Cosmetic Tools
Makeup Palette Clear Acrylic Mixing Plate With Thumb Hole For Foundation Lipstick Nail Art Professional Cosmetic Tools
like
Find Similar
Heart-shaped clear acrylic makeup palette for foundation mixing and beauty blending - Heart
Professional clear acrylic makeup mixing palette with thumb hole for foundation blending - Ellipse
Clear acrylic butterfly makeup palette with brush for mixing foundation and cosmetics - Butterfly
Transparent acrylic makeup mixing palette with two foundation samples held in hand - Round
+3
Makeup Palette Clear Acrylic Mixing Plate With Thumb Hole For Foundation Lipstick Nail Art Professional Cosmetic Tools
-5%
$0.19
No MOQ
 · 
26 sold recently
Hairline Shadow Powder Waterproof Sweatproof Hair Root Concealer With Mirror And Puff Portable Forehead Filling
Hairline Shadow Powder Waterproof Sweatproof Hair Root Concealer With Mirror And Puff Portable Forehead Filling
like
Find Similar
MAYCHEER Hairline Shadow Powder #08 Light Yellow for blonde and light hair colors - 8# Pale Yellow
Hairline shadow powder #17 light camel for light brown hair with built-in puff and mirror - 17# Light Camel
Hairline shadow powder in shade #22 light beige for blonde or silver hair styling - 22# Beige
Hairline Shadow Powder in Rock Grey shade with applicator sponge and compact mirror - 23# Rock Grey
+25
Hairline Shadow Powder Waterproof Sweatproof Hair Root Concealer With Mirror And Puff Portable Forehead Filling
-5%
$1.86
No MOQ
 · 
24 sold recently
Folding Eyebrow Razor For Women Stainless Steel Safety Micro Guard Blade Portable ABS Handle Makeup Trimmer Tool Beginners
Folding Eyebrow Razor For Women Stainless Steel Safety Micro Guard Blade Portable ABS Handle Makeup Trimmer Tool Beginners
like
Find Similar
Safety folding eyebrow razor 3-piece set with pink, white, and blue protective blades - New 3pcs Mixed Color Boxed
Pink folding eyebrow razor with micro-guard blade in retail hanging card packaging - Single Pack (Pink)
Portable folding eyebrow razor in white finish with protective macro safety guard design - Single Pack (White)
Foldable safety eyebrow razor with protective micro-guard in light green color - Single Pack (Green)
+12
Folding Eyebrow Razor For Women Stainless Steel Safety Micro Guard Blade Portable ABS Handle Makeup Trimmer Tool Beginners
-6%
$0.14-1.11
No MOQ
 · 
262 sold recently
Makeup Sponges Beauty Blender Non-Latex Super Soft Teardrop Shape Wet Dry Dual Use Foundation Applicator
Makeup Sponges Beauty Blender Non-Latex Super Soft Teardrop Shape Wet Dry Dual Use Foundation Applicator
like
Find Similar
Pink teardrop makeup sponge with transparent storage box for dry and wet use - Pink Box
Soft purple teardrop makeup sponge set in clear storage box for wet and dry application - Boxed Purple
Coral pink teardrop makeup sponge blender with clear protective storage case for face makeup - Boxed Red
Pink teardrop makeup sponge made of soft skin-friendly material with clear box packaging - Boxed Honey Pink
+1
Makeup Sponges Beauty Blender Non-Latex Super Soft Teardrop Shape Wet Dry Dual Use Foundation Applicator
-5%
$0.49
No MOQ
 · 
13 views
Portable Bamboo Charcoal Face Oil Absorbing Paper With Mirror And Powder Puff Gentle Refreshing Plant Fiber Oil Control Tool
Portable Bamboo Charcoal Face Oil Absorbing Paper With Mirror And Powder Puff Gentle Refreshing Plant Fiber Oil Control Tool
like
Find Similar
Portable bamboo charcoal facial oil blotting sheets with puff and built-in mirror case - Portable Set (G2086) / Pack of 100
GECOMO charcoal oil absorbing tissues refill pack containing 100 sheets for face care - Refill (G2086-1) / Pack of 100
Portable Bamboo Charcoal Face Oil Absorbing Paper With Mirror And Powder Puff Gentle Refreshing Plant Fiber Oil Control Tool
$0.63-1.38
No MOQ
 · 
111 sold recently
Portable Eyebrow Razor Facial Hair Shaver Trimmer Stainless Steel Blade Safety Guard Ergonomic Handle Beauty Makeup Tool
Portable Eyebrow Razor Facial Hair Shaver Trimmer Stainless Steel Blade Safety Guard Ergonomic Handle Beauty Makeup Tool
like
Find Similar
Portable eyebrow razor in black with a 14.5cm handle and 4cm protective blade - 5g/With Protective Net / Black
Orange portable eyebrow razor with 14.5cm handle and 4cm stainless steel blade - 5g/Without Protective Net / Orange
Pink portable safety eyebrow razor with dimensions of 14.5 cm for precise facial grooming - 5g/Without Protective Net / Pink
Blue portable safety eyebrow razor for beginners, 14.5cm total length with 4cm blade - 5g/Without Protective Net / Blue
+12
Portable Eyebrow Razor Facial Hair Shaver Trimmer Stainless Steel Blade Safety Guard Ergonomic Handle Beauty Makeup Tool
$0.05-0.06
Mix MOQ : 2
 · 
1K+ sold recently
Makeup Puff Sponge Double Sided Hydrophilic Polyurethane Super Soft Foundation Applicator Wet Dry Use Cushion Cosmetic Tool
Makeup Puff Sponge Double Sided Hydrophilic Polyurethane Super Soft Foundation Applicator Wet Dry Use Cushion Cosmetic Tool
like
Find Similar
Orange-brown round cosmetic powder puff with satin ribbon in clear plastic packaging - Orange (Transparent Bag)
Single round orange makeup sponge puff in sealed clear plastic packaging for dry or wet use - Yellow (Transparent Bag)
Dark green round cushion puff with satin ribbon in a sealed transparent plastic bag - Dark Green (Transparent Bag)
Blue XL round makeup sponge puff with ribbon handle in transparent packaging - Dark Blue (Transparent Bag)
+23
Makeup Puff Sponge Double Sided Hydrophilic Polyurethane Super Soft Foundation Applicator Wet Dry Use Cushion Cosmetic Tool
$0.33-1.52
Mix MOQ : 3
 · 
32 sold recently
Mini Thumb Makeup Puff Marble Pattern Finger Cushion Sponge Non-Latex Dry Wet Use With Independent Case
Mini Thumb Makeup Puff Marble Pattern Finger Cushion Sponge Non-Latex Dry Wet Use With Independent Case
like
Find Similar
Purple marble finger puff set with round and teardrop shapes in a mini storage box - Purple Potato Pie + Purple White Thumb Puff Set
Mini drop-shaped finger puff featuring unique purple and white marble sponge pattern - Single Purple White Marble Thumb Puff
Mini finger cushion puff with purple marble pattern for precise makeup application - Single Round Purple White Marble Puff
Mini round finger powder puff with purple marble pattern and white cushion for makeup - Single Teardrop Purple White Marble Puff
+13
Mini Thumb Makeup Puff Marble Pattern Finger Cushion Sponge Non-Latex Dry Wet Use With Independent Case
-9%
$0.10-0.87
Mix MOQ : 3
 · 
32 sold recently
Silicone Makeup Brush Cleaning Mat Heart Shaped Scrubber Pad Finger Tool Portable Multi Texture Washing Board
Silicone Makeup Brush Cleaning Mat Heart Shaped Scrubber Pad Finger Tool Portable Multi Texture Washing Board
like
Find Similar
4 options
Silicone Makeup Brush Cleaning Mat Heart Shaped Scrubber Pad Finger Tool Portable Multi Texture Washing Board
-5%
$0.52
No MOQ
Large Portable Makeup Bag Waterproof Toiletry Organizer Travel Case With Handle Double Zipper Fresh Printed Pattern For Women
Large Portable Makeup Bag Waterproof Toiletry Organizer Travel Case With Handle Double Zipper Fresh Printed Pattern For Women
like
Find Similar
Grey travel makeup bag with pink flamingo print, top handle and double zipper closure - Large Size (22x16.5x16cm) / Large Flamingo Gray
Waterproof black cosmetic bag with yellow lemon prints and double zippers - Large Size (22x16.5x16cm) / Large Lemon Black
Portable toiletry bag with lemon print pattern and reinforced handle for travel - Large Size (22x16.5x16cm) / Large Lemon Gray
Portable pink travel makeup bag with cute cherry pattern and dual zippers - Large Size (22x16.5x16cm) / Large Pink Cherry
+6
Large Portable Makeup Bag Waterproof Toiletry Organizer Travel Case With Handle Double Zipper Fresh Printed Pattern For Women
$1.06
Mix MOQ : 3
 · 
3K+ sold recently
Top 3% Best Sellers
in Makeup Bags & Organizers
Go to

More in beauty

Explore more in makeup remover

diytoolsplasticnaturalheartfiber false eyelashespartyglovelayerfacial cleaning puffs
carecleaningdoublefingertravelhangingstrapstylewoven

Ready to source like an insider

Get a direct line to the factory floor — no minimums, no middlemen, no guesswork.
iconReal factory pricing, no markup in betweeniconEvery order hand-inspected before it shipsicon5,000+ new products added daily
Get Inside Access