Everful

Wholesale lined notebooks

Factory-direct selection, vetted for quality and ready to order.

Sign Up
Lined Notebooks

Find the perfect pieces: notebooks, sticky notes, planners and more

filterShow Filters
Best Seller
New Arrivals
Price Drop
Free Shipping
Van Gogh Cafe Terrace At Night Hardcover Notebook Vintage Gold Stamping Blue Journal For Office School Writing Gift
Van Gogh Cafe Terrace At Night Hardcover Notebook Vintage Gold Stamping Blue Journal For Office School Writing Gift
like
Find Similar
Blue notebook with Van Gogh Cafe Terrace At Night art and gold foil lettering - Van Gogh Cafe Style (T01042258)
Van Gogh Cafe Terrace At Night Hardcover Notebook Vintage Gold Stamping Blue Journal For Office School Writing Gift
$3.17
Mix MOQ : 2
 · 
11 views
A5 Loose-leaf Plush Card Album Binder Cartoon Animal Faux Fur Photo Card Holder For Idol Cards Cute Stationery Organiser
A5 Loose-leaf Plush Card Album Binder Cartoon Animal Faux Fur Photo Card Holder For Idol Cards Cute Stationery Organiser
like
Find Similar
Detailed size chart for A5 clear inner pages for photo albums and photocard storage - A5 Single Grid Inner Pages 10 Sheets (No Shell)
A5 PVC binder sleeve inserts with double-sided four-slot transparent pockets - A5 Horizontal Double Grid Inner Pages 10 Sheets (No Shell)
A5 size photo card binder pages with 4-pocket layout and clear plastic storage pockets - A5 3-Inch Four Grid Inner Pages 10 Sheets (No Shell)
Detailed size chart for A5 6-ring PVC binder sleeves showing 21.1x15.2cm dimensions - A5 Vertical Double Grid Inner Pages 10 Sheets (No Shell)
+7
A5 Loose-leaf Plush Card Album Binder Cartoon Animal Faux Fur Photo Card Holder For Idol Cards Cute Stationery Organiser
-4%
$0.22-3.81
Mix MOQ : 2
 · 
28 views
Rococo Fantasy Vintage Scrapbook Material Paper Lightweight Paper Gold Stamping Journal Paper Decorative Retro Art Paper
Rococo Fantasy Vintage Scrapbook Material Paper Lightweight Paper Gold Stamping Journal Paper Decorative Retro Art Paper
like
Find Similar
Moonlight Blue Rose vintage sticker set, 30 sheets of rococo style decorative papers - Moonlight Blue Rose
Rococo Fantasy decorative paper set with vintage castle and floral illustrations - Dream Castle
Rococo Fantasy decorative paper set with 10 vintage peacock and rose patterns for scrapbooking - Peacock Love
Rococo fantasy vintage scrapbooking paper set featuring Emerald Butterfly designs - Emerald Butterfly
+1
Rococo Fantasy Vintage Scrapbook Material Paper Lightweight Paper Gold Stamping Journal Paper Decorative Retro Art Paper
-4%
$0.80
No MOQ
 · 
10 sold recently
Papermore Creative Fruit Still Life Sticky Memo Pad For Journal Scrapbooking Korean INS Style Aesthetic Stationery Decor
Papermore Creative Fruit Still Life Sticky Memo Pad For Journal Scrapbooking Korean INS Style Aesthetic Stationery Decor
like
Find Similar
Cute pear shaped sticky notes, writing paper stationery for journaling, 56x74mm 30 sheets - 30 Sheets / Pear
Peach shaped sticky notes 62x63mm daily series aesthetic 30 sheets of writing paper - 30 Sheets / Peach
Minimalist red apple shaped sticky notes 30 sheets for daily creative journaling - 30 Sheets / Red Apple
Cute egg-shaped sticky notes made of premium writing paper for student memo use - 30 Sheets / Egg Yolk Yellow
Papermore Creative Fruit Still Life Sticky Memo Pad For Journal Scrapbooking Korean INS Style Aesthetic Stationery Decor
-10%
$0.53
No MOQ
 · 
33 views
Plush Unicorn Notebook With Lock And Key Rainbow Faux Fur Diary For Girls Stationery Gift Star Sequin Embroidery
Plush Unicorn Notebook With Lock And Key Rainbow Faux Fur Diary For Girls Stationery Gift Star Sequin Embroidery
like
Find Similar
Plush unicorn diary with star embroidery and metal lock, colorful notebook for kids - Tie-dye Multicolor
Pink purple plush unicorn diary with lock and silver sequin stars on gradient faux fur - Tie-Dye Purple
Plush Unicorn Notebook With Lock And Key Rainbow Faux Fur Diary For Girls Stationery Gift Star Sequin Embroidery
$3.72
Mix MOQ : 2
Plush Dog Notebook With Lock And Keys Cartoon Tie Dye Faux Fur Secret Diary For Girls Cute Journal
Plush Dog Notebook With Lock And Keys Cartoon Tie Dye Faux Fur Secret Diary For Girls Cute Journal
like
Find Similar
Detail of cute rainbow plush dog notebook with a secure metal lock and key for kids - Multicolor (With Lock)
Plush Dog Notebook With Lock And Keys Cartoon Tie Dye Faux Fur Secret Diary For Girls Cute Journal
-4%
$3.70
Mix MOQ : 2
Vintage Minimalist Writable Paper Memo Pad Life Mark Series Black White Stationery For Journaling Scrapbooking School Office
Vintage Minimalist Writable Paper Memo Pad Life Mark Series Black White Stationery For Journaling Scrapbooking School Office
like
Find Similar
Minimalist vintage habit tracker notepad with diet plan layout and 50 sheets - Habit Tracking
Minimalist white notepad Love My Life variant with torn edge design and 50 sheets - Human Observation
Minimalist white Daily Essay notepad with 50 sheets and motivational quotes, 65x89mm size - Daily Essays
Minimalist vintage memo pad with 50 sheets of white paper for scrapbooking and notes - Mind Notes
+2
Vintage Minimalist Writable Paper Memo Pad Life Mark Series Black White Stationery For Journaling Scrapbooking School Office
-10%
$0.52
No MOQ
 · 
96 views
Vintage Nordic Style Collage Material Paper For DIY Journaling Scrapbook Decoration Aesthetic Landscape Butterfly Background Paper
Vintage Nordic Style Collage Material Paper For DIY Journaling Scrapbook Decoration Aesthetic Landscape Butterfly Background Paper
like
Find Similar
Vintage scrapbooking paper with mountain and pine forest motifs for DIY journaling - Thin Snow in Mountain Forest
Vintage style collage sticky notes set with floral and text patterns for DIY journaling - Butterfly Dance on Reeds
Vintage collage memo pads with 25 sheets featuring botanical sketches and retro handwriting - Everlasting Echo
Retro mushroom collage notepad with 25 sheets of forest memories scrapbooking paper - Forest Memories
Vintage Nordic Style Collage Material Paper For DIY Journaling Scrapbook Decoration Aesthetic Landscape Butterfly Background Paper
$0.92
No MOQ
 · 
29 views
Minimalist M5 PVC Transparent Glitter Loose Leaf Binder Cover Kawaii Mini Handbook Notebook Shell Card Collector For Women
Minimalist M5 PVC Transparent Glitter Loose Leaf Binder Cover Kawaii Mini Handbook Notebook Shell Card Collector For Women
like
Find Similar
Mini black glitter PVC 3-ring binder notebook with secure metal button closure - 3 Holes Style / Black Glitter
Transparent PVC 6-ring binder cover with silver metal clasp and dual snap button closure - 6 Holes Style / Transparent
Minimalist M5 PVC Transparent Glitter Loose Leaf Binder Cover Kawaii Mini Handbook Notebook Shell Card Collector For Women
$1.96
No MOQ
 · 
36 views
Vintage Washi Sticker Paper Book Scenery Aesthetic Material Paper For Scrapbooking Journaling DIY Decor Craft Stationery
Vintage Washi Sticker Paper Book Scenery Aesthetic Material Paper For Scrapbooking Journaling DIY Decor Craft Stationery
like
Find Similar
6 options
Vintage Washi Sticker Paper Book Scenery Aesthetic Material Paper For Scrapbooking Journaling DIY Decor Craft Stationery
-9%
$0.75
No MOQ
 · 
12 sold recently
Retro Vintage Floral Butterfly Decorative Material Paper For Journaling DIY Scrapbooking Background Printed Memo Pad
Retro Vintage Floral Butterfly Decorative Material Paper For Journaling DIY Scrapbooking Background Printed Memo Pad
like
Find Similar
Vintage floral collage sticky notes for scrapbooking with 30 sheets of retro flower paper - Collage Story
Vintage Cryptophora Gardenia floral sticky notes 30 sheets for journaling DIY - Garden Butterfly
Vintage floral sticky notes for journaling with 30 sheets of grid paper and dried flower designs - Time Traveling
A Song of Life vintage floral sticky notes for journaling with hand-drawn botanical art - A Song of Life
+1
Retro Vintage Floral Butterfly Decorative Material Paper For Journaling DIY Scrapbooking Background Printed Memo Pad
$0.49
No MOQ
 · 
38 sold recently
Cartoon Shaped Sticky Notes Set Kawaii Animals Heart Cloud Memo Pads For School Office Scrapbooking Paper Stationary
Cartoon Shaped Sticky Notes Set Kawaii Animals Heart Cloud Memo Pads For School Office Scrapbooking Paper Stationary
like
Find Similar
Cute green plaid bear memo pad set with 90 sheets for student journaling and notes - 8# Rain on Lotus
Cartoon sticky notes in orange, yellow and green grid patterns for students - 6# Sunny Island Bellflower
Purple plaid 'Approaching Romance' sticky notes set with three color patterns for journaling - 7# Rose Island
Cute Korean bear plaid memo pad set featuring green, pink, and orange grid designs - 4# Mist Field Camellia
+4
Cartoon Shaped Sticky Notes Set Kawaii Animals Heart Cloud Memo Pads For School Office Scrapbooking Paper Stationary
-4%
$0.47
No MOQ
 · 
584 sold recently
Top 3% Best Sellers
in Labels, Indexes & Stamps
Desk Calendar 2025-2026 Weekly And Monthly Planner Paper Stand Up Schedule Organizer With Memo Pad And Sticky Notes
Desk Calendar 2025-2026 Weekly And Monthly Planner Paper Stand Up Schedule Organizer With Memo Pad And Sticky Notes
like
Find Similar
Black 2025-2026 spiral desk calendar in 18-month format for office planning - Black Mini 2026.7-2027.12
2025 Desktop Calendar with kraft stand, watercolor cactus art, and colorful sticky notes - K02 Luck Plant with Sticky Notes 2026.7-2027.12
2025 Kraft desk calendar featuring colorful sticky notes and minimalist English layout - K05 Minimalist with Sticky Notes 2026.7-2027.12
2025 desk calendar with kraft base, watercolor succulent floral art and sticky notes - K03 Succulent with Sticky Notes 2026.7-2027.12
+5
Desk Calendar 2025-2026 Weekly And Monthly Planner Paper Stand Up Schedule Organizer With Memo Pad And Sticky Notes
$1.73-3.46
Mix MOQ : 2
 · 
50 views
Vintage Pearlescent Paper Hollow Embossed Scrapbooking Material For DIY Craft Journal Decoration Card Making Supplies
Vintage Pearlescent Paper Hollow Embossed Scrapbooking Material For DIY Craft Journal Decoration Card Making Supplies
like
Find Similar
Lace paper material pack with oval cut-out frames in black and white for DIY journaling - Poetry Lace
Vintage Moonlight Magic laser-cut lace paper with moon and star patterns for scrapbooking - Moonlight Magic
Black and white floral hollowed-out lace paper stickers in pink decorative packaging - Messenger Flowers
Vintage Pearlescent Paper Hollow Embossed Scrapbooking Material For DIY Craft Journal Decoration Card Making Supplies
-9%
$1.27
No MOQ
 · 
11 sold recently
Free Shipping
Magnetic Fridge Notepad Memo Pad With Lined Paper Grocery List For Kitchen Shopping Reminder Multi Pattern Decorative
Magnetic Fridge Notepad Memo Pad With Lined Paper Grocery List For Kitchen Shopping Reminder Multi Pattern Decorative
like
Find Similar
Magnetic notepad with Thanksgiving turkey and pumpkin designs featuring full magnetic backing - Pumpkin Lantern and Bird / 23*9
Tropical green leaf magnetic notepad with monstera patterns and lined white paper - Palm Tree / 23*9
Magnetic notepad with autumn pumpkin and maple leaf patterns for fridge or desk memo - Pumpkin / 23*9
Magnetic Fridge Notepad Memo Pad With Lined Paper Grocery List For Kitchen Shopping Reminder Multi Pattern Decorative
-5%
$0.74
No MOQ
 · 
213 sold recently
Top 10% Reordered
in Notebooks & Writing Pads
Unicorn Plush Notebook With Lock Rainbow Tie Dye Secret Diary Soft Furry Writing Journal For Kids Girls Cute Stationery
Unicorn Plush Notebook With Lock Rainbow Tie Dye Secret Diary Soft Furry Writing Journal For Kids Girls Cute Stationery
like
Find Similar
Detail of A5 plush unicorn notebook with metallic lock and rainbow faux fur texture - Tie-Dye Purple
Detail of A5 plush unicorn notebook with rainbow gradient fur and metal lock with keys - Tie-dye Multicolor
Unicorn Plush Notebook With Lock Rainbow Tie Dye Secret Diary Soft Furry Writing Journal For Kids Girls Cute Stationery
-5%
$3.56
Mix MOQ : 2
 · 
39 views
Planet Sticky Notes Circular Galaxy Earth Moon Paper Memo Pads Self Adhesive Stationery For Office School Decorative
Planet Sticky Notes Circular Galaxy Earth Moon Paper Memo Pads Self Adhesive Stationery For Office School Decorative
like
Find Similar
Round Earth planet sticky notes with realistic blue ocean and starry space background - Earth
Mars planet sticky notes with orange surface texture and starry space background - Mars
Round moon-shaped memo pads featuring realistic lunar surface craters and black moon design - Black and White Moon
Mercury planet circular sticky note with realistic lunar texture on black starry background - Mercury
+2
Planet Sticky Notes Circular Galaxy Earth Moon Paper Memo Pads Self Adhesive Stationery For Office School Decorative
-5%
$0.16
Mix MOQ : 2
 · 
2K+ sold recently
Top 10% Best Sellers
in Notebooks & Writing Pads
Vintage Aviation Air Mail Letter Paper And Envelope With Decorative Stickers Retro Floral Watercolor Writing Stationery
Vintage Aviation Air Mail Letter Paper And Envelope With Decorative Stickers Retro Floral Watercolor Writing Stationery
like
Find Similar
Retro airmail stationery set with 10 vintage paper styles, envelopes and stamp stickers - Aviation Stamp Style
Vintage writing paper set with envelopes and wax seal stickers in old parchment styles - Retro Wax Seal Style
160pcs watercolor floral stationery set with envelopes and stickers in 10 diverse designs - Floral Watercolor Style
160pcs watercolor stationery set including lined writing paper, envelopes, and seal stickers - Iridescent Watercolor Style
Vintage Aviation Air Mail Letter Paper And Envelope With Decorative Stickers Retro Floral Watercolor Writing Stationery
$5.19
Mix MOQ : 2
 · 
33 views
Vintage Black White Film Frame Memo Pad White Kraft Paper Scrapbooking Decorative Note Paper For Hand Account Material
Vintage Black White Film Frame Memo Pad White Kraft Paper Scrapbooking Decorative Note Paper For Hand Account Material
like
Find Similar
Vintage style white kraft paper stationery memo pad with 50 sheets and retro design - Post Notes (You Jian)
Retro style white kraft paper memo pad with Today's Letter art text and white borders - Paper Whisper (Zhi Yu)
Vintage Black White Film Frame Memo Pad White Kraft Paper Scrapbooking Decorative Note Paper For Hand Account Material
$0.88
No MOQ
Plush Rabbit Notebook With Lock Cute Faux Fur Diary Secret Journal For Girls Cartoon Embroidery Sequins Gift
Plush Rabbit Notebook With Lock Cute Faux Fur Diary Secret Journal For Girls Cartoon Embroidery Sequins Gift
like
Find Similar
Pink plush A5 notebook with a cute long-eared bunny design and metal security lock - Pink
Detail of A5 fluffy rabbit journal with soft plush texture, lock and metal key - Tie-Dye Purple
Plush Rabbit Notebook With Lock Cute Faux Fur Diary Secret Journal For Girls Cartoon Embroidery Sequins Gift
$3.72
Mix MOQ : 2
Vintage Specimen Theme Hollowed Out Decorative Paper For Journaling Scrapbooking White Kraft Paper Retro Memo Pad Labels
Vintage Specimen Theme Hollowed Out Decorative Paper For Journaling Scrapbooking White Kraft Paper Retro Memo Pad Labels
like
Find Similar
Vintage specimen theme decorative scrapbooking notes in white kraft paper 30pcs - Showcase / 30 Sheets
Vintage plant specimen frame stickers made of white kraft paper for DIY journaling - Spirit Mirror / 30 Sheets
Easel-themed vintage white kraft paper decorative cards with frame and seal designs - Easel / 30 Sheets
Vintage Specimen Catalogue scrapbook paper labels made of white kraft paper in 30 pieces set - Fragrant Bloom / 30 Sheets
+3
Vintage Specimen Theme Hollowed Out Decorative Paper For Journaling Scrapbooking White Kraft Paper Retro Memo Pad Labels
$0.84
No MOQ
 · 
60 sold recently
Vintage Camera Viewfinder Memo Pads Aesthetic Scenery Floral Background Paper For DIY Scrapbooking Decorative Stationery
Vintage Camera Viewfinder Memo Pads Aesthetic Scenery Floral Background Paper For DIY Scrapbooking Decorative Stationery
like
Find Similar
Artistic bridge scenery stationery cards made of writing paper 105mmx70mm 45pcs - City Bridge Landscape
Floral landscape sticky notes set with premium paper and 45 sheets in INS aesthetic style - Flowery Years
Sunset Theater INS scenery sticky notes for DIY journaling with camera viewfinder design - Sunset Theater Sea
Chungking Forest themed 45-sheet decorative stationery paper for journaling 105x70mm - Deep Forest Scenery
Vintage Camera Viewfinder Memo Pads Aesthetic Scenery Floral Background Paper For DIY Scrapbooking Decorative Stationery
-10%
$0.67
No MOQ
 · 
17 views
Plush Unicorn Diary With Heart Lock And Key Cute Gradient Colorful Journal For Girls Students Writing Secret Notebook
Plush Unicorn Diary With Heart Lock And Key Cute Gradient Colorful Journal For Girls Students Writing Secret Notebook
like
Find Similar
Pink plush unicorn A5 notebook with embroidery and silver metal lock for girls - Pink
Plush Unicorn Diary With Heart Lock And Key Cute Gradient Colorful Journal For Girls Students Writing Secret Notebook
-4%
$3.54
Mix MOQ : 2
Cute Cartoon Animal Paper Sticky Notes Kawaii Memo Pads For School Office Journaling Student Scrapbooking Supplies
Cute Cartoon Animal Paper Sticky Notes Kawaii Memo Pads For School Office Journaling Student Scrapbooking Supplies
like
Find Similar
Cute strawberry pattern memo pad with 50 sheets for student journaling and notes - 7# Strawberry Memo [50 Sheets]
Cartoon monkey boxing theme notepad with green cover 8x8cm size 80 sheets - 6# Boxing Monkey - Memo Pad
Cute yellow cartoon monkey memo pad in plastic wrap for school students 8x8cm - 3# Slacking Monkey - Memo Pad
Cartoon monkey memo pad, non-adhesive 80 sheets, 8x8cm cute stationery for students - 4# Open-minded Monkey - Memo Pad
+19
Cute Cartoon Animal Paper Sticky Notes Kawaii Memo Pads For School Office Journaling Student Scrapbooking Supplies
$0.16-0.49
No MOQ
 · 
875 sold recently
Top 10% Best Sellers
in Paper
Modern Era Series Vintage Specialty Paper Memo Pad Non Sticky Retro Architecture Floral Note Paper For Journaling Scrapbooking
Modern Era Series Vintage Specialty Paper Memo Pad Non Sticky Retro Architecture Floral Note Paper For Journaling Scrapbooking
like
Find Similar
5 options
Modern Era Series Vintage Specialty Paper Memo Pad Non Sticky Retro Architecture Floral Note Paper For Journaling Scrapbooking
$1.04
No MOQ
 · 
13 views
Vintage Scrapbooking Material Paper Aesthetic Retro Floral Botanical Ephemera Tearable Memo Pad For DIY Journaling Stationery
Vintage Scrapbooking Material Paper Aesthetic Retro Floral Botanical Ephemera Tearable Memo Pad For DIY Journaling Stationery
like
Find Similar
Vintage style purple melody series scrapbooking paper pad 30 sheets for journaling - Gentle Twilight (Purple)
Minimalist light blue sea wave melody scrapbooking memo pads 30 sheets for journal - Sound of Waves (Blue)
Nature Melody vintage floral notepad with 30 sheets of specialty tearable long paper - Natural Melody (Green)
Pink tulip illustrated tearable notepad for scrapbooking with thirty specialty paper sheets - Tulip Love Letter (Pink)
+1
Vintage Scrapbooking Material Paper Aesthetic Retro Floral Botanical Ephemera Tearable Memo Pad For DIY Journaling Stationery
-10%
$0.93
No MOQ
 · 
62 views
Dreamy Lace Series Hollow Scrapbook Paper Retro Floral Round Decorative Material Paper For DIY Journal Craft Decoration
Dreamy Lace Series Hollow Scrapbook Paper Retro Floral Round Decorative Material Paper For DIY Journal Craft Decoration
like
Find Similar
Vintage floral lace paper scrapbooking stickers with 10 hollow designs in white kraft paper - Poet
Vintage floral lace paper set with 10 designs in white kraft for journal decoration - Flower Print
Dreamy Lace Series Hollow Scrapbook Paper Retro Floral Round Decorative Material Paper For DIY Journal Craft Decoration
$1.44
No MOQ
 · 
32 views
Free Shipping
Vintage Botanical Scrapbook Paper Collection Aesthetic Floral Material Paper For Journaling Diary DIY Craft Decoration
Vintage Botanical Scrapbook Paper Collection Aesthetic Floral Material Paper For Journaling Diary DIY Craft Decoration
like
Find Similar
100pcs Flower Diary vintage botanical craft paper set with warm floral patterns - Flower Diary
Vintage Botanical Scrapbook Paper Collection Aesthetic Floral Material Paper For Journaling Diary DIY Craft Decoration
$1.93
No MOQ
 · 
125 views
Cute Plush Notebook With Lock Tie Dye Rainbow Cartoon Secret Diary With Wings Heart Shaker For Girls Students
Cute Plush Notebook With Lock Tie Dye Rainbow Cartoon Secret Diary With Wings Heart Shaker For Girls Students
like
Find Similar
A5 gradient plush diary with cute eyes embroidery, laser wings and a metal padlock - Tie-dye Multicolor
Cute Plush Notebook With Lock Tie Dye Rainbow Cartoon Secret Diary With Wings Heart Shaker For Girls Students
$3.31
Mix MOQ : 2
Vintage Aesthetic Material Paper Non Sticky Memo Pad For Scrapbooking Journaling DIY Crafts Lightweight Paper Antique Style
Vintage Aesthetic Material Paper Non Sticky Memo Pad For Scrapbooking Journaling DIY Crafts Lightweight Paper Antique Style
like
Find Similar
Vintage Diary Series material paper set with 60 sheets of retro poster designs - Modern Poster
Vintage scrapbooking paper set with 60 sheets of retro nature and floral patterns - Perfect Holiday
Vintage memo pad stationery set with 60 sheets of retro paper material 80x50mm size - Vintage Letter Paper
Vintage butterfly scrapbook paper stickers pack with 60 sheets of retro biological motifs - Butterfly Travelogue
+4
Vintage Aesthetic Material Paper Non Sticky Memo Pad For Scrapbooking Journaling DIY Crafts Lightweight Paper Antique Style
-10%
$0.41
No MOQ
 · 
80 sold recently
Vintage Fairy Tale Illustration Aesthetic Decorative Cards Hand-Drawn Animal Forest Theme Journaling Wall Decor Greeting Card Collection
Vintage Fairy Tale Illustration Aesthetic Decorative Cards Hand-Drawn Animal Forest Theme Journaling Wall Decor Greeting Card Collection
like
Find Similar
Set of 36 vintage fairy tale illustration cards for wall decor and scrapbooking - Vintage Fairy Tale Illustration (RXHB0044) / 36 Sheets
Vintage Fairy Tale Illustration Aesthetic Decorative Cards Hand-Drawn Animal Forest Theme Journaling Wall Decor Greeting Card Collection
$1.44
Mix MOQ : 5
 · 
51 views
Cute Cartoon Animal Sticky Notes Self Adhesive Paper Memo Pads Kawaii School Office Stationery Desktop Memo Decals
Cute Cartoon Animal Sticky Notes Self Adhesive Paper Memo Pads Kawaii School Office Stationery Desktop Memo Decals
like
Find Similar
Cute penguin cartoon sticky notes set in blue and grey variants, 3 pads of 15 sheets - Penguin Styles
Cute bear shaped sticky memo set in brown, grey and white colors, 45 sheets total - Bear Styles
Three-pack set of cute cartoon cat sticky notes with gray and beige animal designs - Cat Styles
Cute animal cartoon sticky note set including polar bear and cat styles for students - Mixed (6 Patterns)
+3
Cute Cartoon Animal Sticky Notes Self Adhesive Paper Memo Pads Kawaii School Office Stationery Desktop Memo Decals
$0.32
Mix MOQ : 10
 · 
1K+ sold recently
Top 10% Best Sellers
in Notebooks & Writing Pads
Vintage Scrapbooking Material Paper A Paper Poem Series Retro Literary Specialty Paper For DIY Journal Planner Crafting
Vintage Scrapbooking Material Paper A Paper Poem Series Retro Literary Specialty Paper For DIY Journal Planner Crafting
like
Find Similar
Vintage floral collage paper set in sage green with botanical sketches for journaling - Grateful To You / 30 Sheets
Vintage plant poem scrapbook paper set with 30 floral decorative sheets for journaling - Botanical Poetry / 30 Sheets
Purple Emotional Notes vintage decorative scrapbook paper with 30 pieces of floral designs - Mood Notes / 30 Sheets
Vintage blue stationery set with ten retro letter paper designs for DIY scrapbooking - Blue Stationery / 30 Sheets
+2
Vintage Scrapbooking Material Paper A Paper Poem Series Retro Literary Specialty Paper For DIY Journal Planner Crafting
-4%
$0.88
No MOQ
 · 
81 sold recently
Vintage Scrapbook Material Paper Pack For DIY Collage Crafting Retro Handwriting Floral Vellum Paper Art Supplies
Vintage Scrapbook Material Paper Pack For DIY Collage Crafting Retro Handwriting Floral Vellum Paper Art Supplies
like
Find Similar
Spring Mail series vintage scrapbooking paper set in green tones with 30 sheets - Spring Post
Vintage Scrapbook Material Paper Pack For DIY Collage Crafting Retro Handwriting Floral Vellum Paper Art Supplies
-10%
$0.80
No MOQ
 · 
51 views
Cute Cartoon Bear Memo Pad Korean Ins Style Tearable Note Paper For Student Office Check List Grid Pattern Non Sticky
Cute Cartoon Bear Memo Pad Korean Ins Style Tearable Note Paper For Student Office Check List Grid Pattern Non Sticky
like
Find Similar
Pink grid memo pad featuring cartoon bears and fish waffle patterns for daily notes - Biscuit Bear
Brown cookie bear vertical check list notepad with pink cartoon illustrations - Bed Bear
Cute khaki cookie bear checklist notepad with lines and adorable cartoon patterns - Scarf Bear
Pink grid memo pad with cute brown bear eating pizza illustration on white background - Dining Table Bear
+1
Cute Cartoon Bear Memo Pad Korean Ins Style Tearable Note Paper For Student Office Check List Grid Pattern Non Sticky
$0.52
Mix MOQ : 3
 · 
413 sold recently
Vintage Specialty Paper Memo Pad Flower Story Series Retro Perforated Border Material Paper For DIY Scrapbooking Journal
Vintage Specialty Paper Memo Pad Flower Story Series Retro Perforated Border Material Paper For DIY Scrapbooking Journal
like
Find Similar
Vintage floral sticky notes with tulip design and linen texture binding stripe - Flower Scent Evening Breeze
Vintage floral sticky notes with ornate green borders and autumn leaf illustrations - Forest Narrative
Vintage floral memo pad with intricate decorative frames in retro ocher and moss green tones - Gentle Bloom
Vintage Specialty Paper Memo Pad Flower Story Series Retro Perforated Border Material Paper For DIY Scrapbooking Journal
-10%
$0.70
No MOQ
Iridescent Seashell PET Stickers Ocean Theme Transparent Waterproof Pearl Shell Decals For Journaling Scrapbooking DIY Decoration
Iridescent Seashell PET Stickers Ocean Theme Transparent Waterproof Pearl Shell Decals For Journaling Scrapbooking DIY Decoration
like
Find Similar
Variety of iridescent PET seashell and pearl stickers with dreamlike laser finish - Dreamy Seashell PET Sticker Pack
Iridescent Seashell PET Stickers Ocean Theme Transparent Waterproof Pearl Shell Decals For Journaling Scrapbooking DIY Decoration
$0.93
No MOQ
 · 
27 views
Fantasy Forest Series Vintage Fairytale Theme Decorative Paper Notes Gold Foil Stamping Journaling DIY Materials For Student Office
Fantasy Forest Series Vintage Fairytale Theme Decorative Paper Notes Gold Foil Stamping Journaling DIY Materials For Student Office
like
Find Similar
Iris Fairy fantasy themed decorative paper stickers with gold foil for DIY journaling - Iris Fairy (4933247528986)
Little Red Riding Hood fairy tale stickers with gold foil details on pink paper - Little Red Riding Hood (4933247528987)
Snow White vintage forest scrapbooking stickers with gold foil details 30 pieces - Snow White (4933247528988)
Vintage fairytale forest stickers with gold foil rabbits and butterflies patterns - Wonderland (4933247528989)
+2
Fantasy Forest Series Vintage Fairytale Theme Decorative Paper Notes Gold Foil Stamping Journaling DIY Materials For Student Office
-10%
$0.96
No MOQ
 · 
24 sold recently
Arch Shaped Translucent Sulfuric Acid Paper Memo Pads Artistic Retro Botanical Journal Decor Scrapbooking Material Stationery
Arch Shaped Translucent Sulfuric Acid Paper Memo Pads Artistic Retro Botanical Journal Decor Scrapbooking Material Stationery
like
Find Similar
Artistic arch-shaped translucent blue floral decorative stickers for journaling - Wilderness Beyond
Artistic translucent arched paper with botanical floral shadows in light blue and grey - Vanishing Light and Shadow
Arch-shaped floral vellum paper cards for scrapbooking and artistic decoration - Twilight Soliloquy
Translucent arch-shaped decorative paper tags with tree shadow patterns in forest style - Mottled Tree Shadows
+1
Arch Shaped Translucent Sulfuric Acid Paper Memo Pads Artistic Retro Botanical Journal Decor Scrapbooking Material Stationery
$0.98
No MOQ
 · 
25 views
Vintage Material Paper Memo Pads Fingertip Temperature Series Retro Journal DIY Collage Decoration Scrapbooking Stationery
Vintage Material Paper Memo Pads Fingertip Temperature Series Retro Journal DIY Collage Decoration Scrapbooking Stationery
like
Find Similar
Vintage world map scrapbooking paper collection 100 sheets for DIY journal collages - World Tour
Vintage Material Paper Memo Pads Fingertip Temperature Series Retro Journal DIY Collage Decoration Scrapbooking Stationery
$1.10
No MOQ
 · 
51 views
100 Envelope Challenge Savings Binder A5 PVC Budget Planner Money Organizer Folder Floral Design Metal Ring Binder
100 Envelope Challenge Savings Binder A5 PVC Budget Planner Money Organizer Folder Floral Design Metal Ring Binder
like
Find Similar
Purple 100 day envelope money saving challenge binder with floral cherry blossom cover - Transparent A5 Case-Purple Clip+Purple Card+25 Sleeves
100 Envelope Challenge Savings Binder A5 PVC Budget Planner Money Organizer Folder Floral Design Metal Ring Binder
$2.45
No MOQ
 · 
102 views
Vintage Floral Material Paper Scrapbooking Journaling DIY Botanical Retro Decorative Background Paper For Crafting Decoration
Vintage Floral Material Paper Scrapbooking Journaling DIY Botanical Retro Decorative Background Paper For Crafting Decoration
like
Find Similar
Vintage forest theme decorative paper book with 40 double-sided sheets for DIY scrapbooking - Green Field Forest
Floral aesthetic scrapbooking paper pack with vintage flower patterns for DIY journals - In The Name Of Flowers
Vintage Flora Collect double-sided scrapbook paper with 40 sheets of floral designs - Floating Life With You
Vintage style floral scrapbooking paper pack with dancing girl and classical art motifs - Dancing Girl
+2
Vintage Floral Material Paper Scrapbooking Journaling DIY Botanical Retro Decorative Background Paper For Crafting Decoration
$1.15
No MOQ
 · 
59 views
Vintage Scrapbooking Material Pack Retro Artistic Journaling Paper DIY Map Floral Decor Journaling Supplies For Student Adult
Vintage Scrapbooking Material Pack Retro Artistic Journaling Paper DIY Map Floral Decor Journaling Supplies For Student Adult
like
Find Similar
1 option
Vintage Scrapbooking Material Pack Retro Artistic Journaling Paper DIY Map Floral Decor Journaling Supplies For Student Adult
$1.01
No MOQ
 · 
34 views
Vintage Decorative Specialty Paper Pack For Scrapbooking DIY Journaling Material Retro Floral Butterfly Pattern Paper Stationery
Vintage Decorative Specialty Paper Pack For Scrapbooking DIY Journaling Material Retro Floral Butterfly Pattern Paper Stationery
like
Find Similar
Vintage floral illustration sticky notes set with 45 sheets in blue artistic tones - Lunar Repose
Pink vintage floral sticky notes set with lace and rose motifs, 45 sheets total - Love Songs
Twilight Shadow vintage floral paper pads with lace and butterfly designs for scrapbooking - Twilight Shadow (Muying)
Vintage aesthetic 45-piece deco paper set with floral and lace motifs for journaling - In The Woods
Vintage Decorative Specialty Paper Pack For Scrapbooking DIY Journaling Material Retro Floral Butterfly Pattern Paper Stationery
-4%
$0.88
No MOQ
 · 
40 views
Free Shipping
Cartoon Character Time Manager Sticky Notes Creative Daily Weekly Plan Task List Memo Pad Office School Stationery
Cartoon Character Time Manager Sticky Notes Creative Daily Weekly Plan Task List Memo Pad Office School Stationery
like
Find Similar
4 options
Cartoon Character Time Manager Sticky Notes Creative Daily Weekly Plan Task List Memo Pad Office School Stationery
-10%
$0.35
No MOQ
 · 
24 sold recently
Vintage Scrapbooking Material Paper Retro DIY Journal Background Paper For Crafting Scrapbooking Memo Pads Artistic Deco
Vintage Scrapbooking Material Paper Retro DIY Journal Background Paper For Crafting Scrapbooking Memo Pads Artistic Deco
like
Find Similar
Vintage scrapbooking paper set with 100 sheets of retro handwritten letter designs - Handwritten Letter
Eden Garden vintage floral paper collection for scrapbooking with 100 sheets of retro art - Eden Garden
Vintage art collage paper set with 100 sheets featuring 50 unique retro designs - Art Collage
Vintage astronomy scrapbook paper set with 100 pieces for DIY craft journal decoration - Milky Way World
+2
Vintage Scrapbooking Material Paper Retro DIY Journal Background Paper For Crafting Scrapbooking Memo Pads Artistic Deco
-4%
$1.15
No MOQ
 · 
49 views
PaperMore Creative Illustration Sticky Memo Pad INS Style Decorative Paper Notes For Journaling DIY Planner Stationery
PaperMore Creative Illustration Sticky Memo Pad INS Style Decorative Paper Notes For Journaling DIY Planner Stationery
like
Find Similar
Minimalist vintage style sticky notes with jigger illustration and numbered lists - Drunken Diary
Floral lily theme sticky notes with 30 sheets of writing paper in 80x120mm size - A Lily
Minimalist 'Crispy Chips' sticky note pad with weekly planner and 30 writing sheets - Crispy Chips
Green ice drink monthly planner sticky notes 80x120mm writing paper 30 sheets - A Refreshing Drink
PaperMore Creative Illustration Sticky Memo Pad INS Style Decorative Paper Notes For Journaling DIY Planner Stationery
-9%
$0.45
No MOQ
 · 
69 views
Vintage Scrapbooking Material Paper Pack Floral Newspaper Junk Journal Supplies DIY Decorative Craft Paper For Journaling Stationery
Vintage Scrapbooking Material Paper Pack Floral Newspaper Junk Journal Supplies DIY Decorative Craft Paper For Journaling Stationery
like
Find Similar
Flower Shadow In The Mirror vintage floral sticker pack with 100 pieces for DIY scrapbooking - Mirror Shadow / Pack of 100
Retro newspaper DIY scrapbooking material paper set with 100 sheets in various sizes - Morning Newspaper / Pack of 100
Vintage scrapbooking material kit with 100 sheets of retro paper stickers in multiple sizes - Receipt List / Pack of 100
Rose Manor vintage floral stickers set with 100pcs retro botanical and butterfly designs - Rose Manor / Pack of 100
Vintage Scrapbooking Material Paper Pack Floral Newspaper Junk Journal Supplies DIY Decorative Craft Paper For Journaling Stationery
-5%
$1.01
No MOQ
 · 
120 sold recently
Black Sticky Notes Square Adhesive Matte Paper Memo Pads For High Contrast Writing Minimalist Office School Supplies
Black Sticky Notes Square Adhesive Matte Paper Memo Pads For High Contrast Writing Minimalist Office School Supplies
like
Find Similar
Handheld fan-shaped spread of black square sticky notes with a matte paper texture - Black
Black Sticky Notes Square Adhesive Matte Paper Memo Pads For High Contrast Writing Minimalist Office School Supplies
$0.14
No MOQ
 · 
269 sold recently
Top 10% Reordered
in Notebooks & Writing Pads
Cute Animal Toast Shaped Sticky Notes Nordic Style DIY Journal Decorative Paper Memo Pad For Students Office Stationery Supplies
Cute Animal Toast Shaped Sticky Notes Nordic Style DIY Journal Decorative Paper Memo Pad For Students Office Stationery Supplies
like
Find Similar
Cute bear paw toast shaped sticky notes, 30 sheets of creative stationery for journaling - Bear Food
Cute paw print toast shaped sticky notes with 30 sheets for DIY scrapbooking journal - Dog Toast
Cute Capybara toast sticky notes with cat paw pattern for DIY journal 30 sheets - Capybara Toast
Cute Animal Toast Shaped Sticky Notes Nordic Style DIY Journal Decorative Paper Memo Pad For Students Office Stationery Supplies
$0.49
No MOQ
 · 
34 views
Vintage Material Paper 100 Sheets Retro Scrapbooking Supplies For DIY Crafts Journaling Decoupage Floral Portrait Decorative Paper
Vintage Material Paper 100 Sheets Retro Scrapbooking Supplies For DIY Crafts Journaling Decoupage Floral Portrait Decorative Paper
like
Find Similar
Vintage Art Collage scrapbook paper kit with dark green cover and nostalgic motifs - Art Collage
Vintage astronomy theme decorative scrapbooking paper set with planets and star charts - Milky Way World
Vintage scrapbooking paper set with owl and celestial patterns for DIY crafts - Magic Notes
Vintage Material Paper 100 Sheets Retro Scrapbooking Supplies For DIY Crafts Journaling Decoupage Floral Portrait Decorative Paper
$1.21
No MOQ
 · 
76 views
Vintage Moon Phase Scrapbooking Material Kit Specialty Paper Vellum PET Stickers For DIY Journaling Artistic Decoration
Vintage Moon Phase Scrapbooking Material Kit Specialty Paper Vellum PET Stickers For DIY Journaling Artistic Decoration
like
Find Similar
Scrapbook stickers set featuring moon phase themes on vintage vellum paper in blue - Misty Moonlight
Vintage Moon Phase Scrapbooking Material Kit Specialty Paper Vellum PET Stickers For DIY Journaling Artistic Decoration
-9%
$1.69
No MOQ
 · 
28 views
Mini Plush Unicorn Notebook Keychain Cute Cartoon Animal Pocket Diary Stationery For Kids
Mini Plush Unicorn Notebook Keychain Cute Cartoon Animal Pocket Diary Stationery For Kids
like
Find Similar
Detail of plush unicorn mini notebook with rainbow embroidery and metal keychain clip - Tie-dye Multicolor
Mini Plush Unicorn Notebook Keychain Cute Cartoon Animal Pocket Diary Stationery For Kids
-5%
$1.42
Mix MOQ : 2
Kids Cartoon Coloring Book Bold Easy Thick Lines Drawing Pad For Toddlers Preschool Early Learning Educational Paper Activity
Kids Cartoon Coloring Book Bold Easy Thick Lines Drawing Pad For Toddlers Preschool Early Learning Educational Paper Activity
like
Find Similar
Space and planets bold and easy coloring book for kids with astronauts and rockets - Planet Theme (Space)
Two purple Bold & Easy Happy Birthday coloring books with cute bear and cake illustrations - Happy Birthday Theme
Bold & Easy Summer Style Coloring Book for kids with 40 pages of tropical patterns - Summer Style Theme
Two Merry Christmas coloring books with bold and easy cartoon Santa and snowman patterns - Christmas Theme
Kids Cartoon Coloring Book Bold Easy Thick Lines Drawing Pad For Toddlers Preschool Early Learning Educational Paper Activity
$2.28
Mix MOQ : 2
Baby Memory Book Hardcover Growth Journal For Pregnancy To Five Years Milestone Record With Stickers And Slipcase Floral
Baby Memory Book Hardcover Growth Journal For Pregnancy To Five Years Milestone Record With Stickers And Slipcase Floral
like
Find Similar
White baby memory book with floral patterns and photo windows titled The Story of You - Floral Pattern (MJ017)
White baby memory book the story of you with newborn photo window and footprint illustration - Leaf Pattern (MJ017)
Baby Memory Book Hardcover Growth Journal For Pregnancy To Five Years Milestone Record With Stickers And Slipcase Floral
$9.22
Mix MOQ : 2
 · 
11 views
Vintage Tearable Memo Pad Life Recorder Series Retro Paper Material For Scrapbooking DIY Decoration Journaling Stationery
Vintage Tearable Memo Pad Life Recorder Series Retro Paper Material For Scrapbooking DIY Decoration Journaling Stationery
like
Find Similar
Vintage Life Recorder memo pad with 30 sheets of decorative frames in retro brown print - Old Diary
Vintage Years Post Office memo pads with 30 stamp-style decorative sticker sheets - Years Post Office
Echoes Of The Past vintage notepad for journaling with 30 dark green frame sheets - Echoes Of The Past
Life Recorder Series vintage blue European border decorative memo pad stickers for journaling - Romantic European
+2
Vintage Tearable Memo Pad Life Recorder Series Retro Paper Material For Scrapbooking DIY Decoration Journaling Stationery
-10%
$0.75
No MOQ
Vintage Material Paper Non Adhesive Scrapbooking Supplies For DIY Journaling Collage Retro Floral Art Decorative Paper
Vintage Material Paper Non Adhesive Scrapbooking Supplies For DIY Journaling Collage Retro Floral Art Decorative Paper
like
Find Similar
Vintage scrapbooking paper set with 100 sheets of retro handwritten letter designs - Handwritten Letter
Eden Garden vintage floral paper collection for scrapbooking with 100 sheets of retro art - Eden Garden
Vintage art collage paper set with 100 sheets featuring 50 unique retro designs - Art Collage
Vintage astronomy scrapbook paper set with 100 pieces for DIY craft journal decoration - Milky Way World
+4
Vintage Material Paper Non Adhesive Scrapbooking Supplies For DIY Journaling Collage Retro Floral Art Decorative Paper
-4%
$1.15
No MOQ
 · 
100 sold recently
Kawaii Animal Shaped Vertical Sticky Notes Removable Self Adhesive Memo Pads Cute Cat Dog Bird Rabbit Desktop Stationery
Kawaii Animal Shaped Vertical Sticky Notes Removable Self Adhesive Memo Pads Cute Cat Dog Bird Rabbit Desktop Stationery
like
Find Similar
Cute cartoon cat shaped sticky notes in grey and white design with 30 sheets per pad - Cat
Vertical bird-shaped sticky notes in white and brown with 30 sheets for journaling - Bird
Vertical white rabbit shaped sticky note with cute cartoon design and 30 sheets per pad - Rabbit
Vertical sticky notes featuring a cute cartoon dog shape on a light pink background - Dog
Kawaii Animal Shaped Vertical Sticky Notes Removable Self Adhesive Memo Pads Cute Cat Dog Bird Rabbit Desktop Stationery
-5%
$0.19
No MOQ
 · 
418 sold recently
Wild West Vintage Cowboy Scrapbook Washi Tape Stickers Notebook Envelopes Paper Clips For DIY Journaling Art Craft
Wild West Vintage Cowboy Scrapbook Washi Tape Stickers Notebook Envelopes Paper Clips For DIY Journaling Art Craft
like
Find Similar
Wild West retro junk journal kit with 157 pieces of vintage stickers and washi tapes - Western Aztec
Wild West Vintage Cowboy Scrapbook Washi Tape Stickers Notebook Envelopes Paper Clips For DIY Journaling Art Craft
-10%
$4.97
No MOQ
Cartoon Animal Sticky Notes Self Adhesive Memo Pads Paper Colorful For School Office Students Gift Cute Shaped
Cartoon Animal Sticky Notes Self Adhesive Memo Pads Paper Colorful For School Office Students Gift Cute Shaped
like
Find Similar
Cute light blue elephant sticky notes with to-do list lines and yellow bird motif - Elephant
Cute panda shaped sticky notes, animal cartoon memo pad for students, 8x5.4cm size - Panda
Pink cartoon pig animal shaped sticky notes with apple detail and polka dot card - Pig
Cute green turtle animal sticky notes for students, 8cmx5.4cm creative office supplies - Turtle
+4
Cartoon Animal Sticky Notes Self Adhesive Memo Pads Paper Colorful For School Office Students Gift Cute Shaped
$0.07
No MOQ
 · 
4K+ sold recently
Top 10% Best Sellers
in Labels, Indexes & Stamps
Go to

More in office & school supplies

Explore more in lined notebooks

covergirlskidsmetalstyledesignthreadsquarecardsmall
studentsbanddailymagneticholidaylockholderpartypersonaldouble

Ready to source like an insider

Get a direct line to the factory floor — no minimums, no middlemen, no guesswork.
iconReal factory pricing, no markup in betweeniconEvery order hand-inspected before it shipsicon5,000+ new products added daily
Get Inside Access