Everful

Wholesale lined notebooks

Factory-direct selection, vetted for quality and ready to order.

Sign Up
Lined Notebooks

Find the perfect pieces: notebooks, sticky notes, planners and more

filterShow Filters
Best Seller
New Arrivals
Price Drop
Free Shipping
Vintage Material Paper For Scrapbooking Journaling DIY Background Craft Botanical Decorative Specialty Paper Textures
Vintage Material Paper For Scrapbooking Journaling DIY Background Craft Botanical Decorative Specialty Paper Textures
like
Find Similar
Vintage scrapbooking material paper set with aged textures and music notes designs - Writing Paper Series
Vintage style kraft paper set with 57 sheets of old book pages and musical notes - Kraft Paper Series
Monsoon Bluing vintage relief paper pack for DIY scrapbooking background decor - Monsoon Blue
Vintage style floral paper set in light green and cream for scrapbooking crafts - Spring Whisper
+34
Vintage Material Paper For Scrapbooking Journaling DIY Background Craft Botanical Decorative Specialty Paper Textures
$3.09-19.93
No MOQ
 · 
14 sold recently
Free Shipping
Vintage Victorian Children Stickers For Scrapbooking Journaling Phone Case Decoration Retro Floral Kids Pattern Decal DIY Art Supplies
Vintage Victorian Children Stickers For Scrapbooking Journaling Phone Case Decoration Retro Floral Kids Pattern Decal DIY Art Supplies
like
Find Similar
1 option
Vintage Victorian Children Stickers For Scrapbooking Journaling Phone Case Decoration Retro Floral Kids Pattern Decal DIY Art Supplies
$0.72
No MOQ
LED Christmas Ballpoint Pen Cartoon Santa Claus Snowman Reindeer Light Up Plastic Stationery Festive Gift Award Novelty
LED Christmas Ballpoint Pen Cartoon Santa Claus Snowman Reindeer Light Up Plastic Stationery Festive Gift Award Novelty
like
Find Similar
Three-piece Christmas ballpoint pen set with glowing Santa and tree in festive gift box - 3-Piece Gift Set (Santa/Tree/Reindeer)
LED Christmas Ballpoint Pen Cartoon Santa Claus Snowman Reindeer Light Up Plastic Stationery Festive Gift Award Novelty
$0.37
No MOQ
Lace Texture Material Book Vintage Floral Decorative Paper For DIY Scrapbooking Journal Nordic Style Material Paper
Lace Texture Material Book Vintage Floral Decorative Paper For DIY Scrapbooking Journal Nordic Style Material Paper
like
Find Similar
Purple floral lace scrapbooking paper kit with ten unique patterns for DIY journals - Romantic Purple Flowers
Blue lace flower theme scrapbooking paper set 30 sheets for DIY journal decoration - Elegant Blue Band
Vintage lace textured scrapbooking paper in Classic Memory style with 10 patterns - Vintage Memory
Pink Sweet Laces scrapbooking paper kit with 30 sheets of floral lace patterns - Sweet Pink Yarn
+2
Lace Texture Material Book Vintage Floral Decorative Paper For DIY Scrapbooking Journal Nordic Style Material Paper
-4%
$0.80
No MOQ
Vintage Scrapbooking Decorative Stickers Retro Plants Butterfly Astronomy Mushroom DIY Material Stickers For Journaling Planner Arts Crafts
Vintage Scrapbooking Decorative Stickers Retro Plants Butterfly Astronomy Mushroom DIY Material Stickers For Journaling Planner Arts Crafts
like
Find Similar
8 options
Vintage Scrapbooking Decorative Stickers Retro Plants Butterfly Astronomy Mushroom DIY Material Stickers For Journaling Planner Arts Crafts
-10%
$0.52
No MOQ
Vintage Botanical Floral PET Stickers Laser Hollow White Kraft Paper Butterfly Feather Scrapbooking Journal Decoration Material
Vintage Botanical Floral PET Stickers Laser Hollow White Kraft Paper Butterfly Feather Scrapbooking Journal Decoration Material
like
Find Similar
Vintage yellow floral PET sticker pack with 30 pieces of retro roses and lilies - Tracing Time
ZHIJI green bird laser-cut paper stickers for scrapbooking and DIY journals - Skyrealm Series Spring Swallows
Set of 30 laser-cut green butterfly stickers made of premium white kraft paper for scrapbooking - Skyrealm Series Emerald Butterflies
Pink laser-cut bird paper stickers, 30 pieces for scrapbooking and DIY decoration - Skyrealm Series Pink Birds
+3
Vintage Botanical Floral PET Stickers Laser Hollow White Kraft Paper Butterfly Feather Scrapbooking Journal Decoration Material
$0.86
No MOQ
 · 
16 views
Free Shipping
Summer Vacation PET Sticker Material Pack Fashion Illustration Scrapbooking Decorative Stickers For Journal Planner DIY Arts
Summer Vacation PET Sticker Material Pack Fashion Illustration Scrapbooking Decorative Stickers For Journal Planner DIY Arts
like
Find Similar
Incredible Summer Semi-sugar Ice Cream stickers, 20 piece set for journaling - Half Sugar Ice Cream
Bohemian Island themed sticker set with 20 pieces for summer scrapbook decoration - Bohemian Island
Summer Cycle vintage cardstock stickers featuring retro hand-drawn summer lifestyle designs - Summer Cycle
Peach Oath sticker pack featuring 20 pieces of summer scrapbooking decorative paper - Peach Oath
Summer Vacation PET Sticker Material Pack Fashion Illustration Scrapbooking Decorative Stickers For Journal Planner DIY Arts
-9%
$0.78
No MOQ
Nature Scenery Decorative Stickers For Scrapbooking DIY Van Life Landscape Washi Paper Stickers For Envelope Sealing Journals Hand Account Material
Nature Scenery Decorative Stickers For Scrapbooking DIY Van Life Landscape Washi Paper Stickers For Envelope Sealing Journals Hand Account Material
like
Find Similar
Roll of 500 camping scenery stickers with 10 vintage van life nature landscape designs - Landscape Pattern / 500 Pieces/Pack
NewNature Scenery Decorative Stickers For Scrapbooking DIY Van Life Landscape Washi Paper Stickers For Envelope Sealing Journals Hand Account Material
$0.86
No MOQ
Vintage Manga Girl Stickers Retro Comic Style Waterproof Decals For Scrapbooking Laptop Phone Case DIY Decoration
Vintage Manga Girl Stickers Retro Comic Style Waterproof Decals For Scrapbooking Laptop Phone Case DIY Decoration
like
Find Similar
1 option
Vintage Manga Girl Stickers Retro Comic Style Waterproof Decals For Scrapbooking Laptop Phone Case DIY Decoration
-4%
$0.69
No MOQ
Galaxy Colorful Animal Illustration Stickers Oil Painting Art Decals For Suitcase Journal Phone Case Stationery Decor
Galaxy Colorful Animal Illustration Stickers Oil Painting Art Decals For Suitcase Journal Phone Case Stationery Decor
like
Find Similar
Collection of 60 colorful animal art stickers in impressionist oil painting style for decor - Animal Oil Painting Illustration Series (OPQ299)
Galaxy Colorful Animal Illustration Stickers Oil Painting Art Decals For Suitcase Journal Phone Case Stationery Decor
$1.27
No MOQ
 · 
11 views
Retro Story Washi Tape Set Flowing Clouds And Thoughts Series Decorative Adhesive Tape For Scrapbooking Journal DIY Craft
Retro Story Washi Tape Set Flowing Clouds And Thoughts Series Decorative Adhesive Tape For Scrapbooking Journal DIY Craft
like
Find Similar
Retro Cloud sequence washi tape set in yellow, purple and blue for journaling - Cloudy Mood
Set of 4 washi tapes with gold, silver, starry sky and green gradient designs - Cloud Thoughts
Retro Story 4-pack cloud series washi tape set in green and orange tones for journaling - Cloud Chase
Retro Story 4-roll washi tape set with metallic gold and silver patterns for journaling - Sending to Clouds
NewRetro Story Washi Tape Set Flowing Clouds And Thoughts Series Decorative Adhesive Tape For Scrapbooking Journal DIY Craft
$0.97
No MOQ
Isometric Miniature Scene Stickers PET Decorative Decals For Scrapbooking Journaling Furniture House Design Stationery Art Supplies
Isometric Miniature Scene Stickers PET Decorative Decals For Scrapbooking Journaling Furniture House Design Stationery Art Supplies
like
Find Similar
DIY Lemon Villa miniature scene sticker kit with PET stickers and backdrops - Lemon Villa
Isometric Miniature Scene Stickers PET Decorative Decals For Scrapbooking Journaling Furniture House Design Stationery Art Supplies
-10%
$1.06
No MOQ
Decorative PET Stickers Waterproof Watercolor Bubble Glazed Sugar Heart Series For Scrapbooking Journaling DIY Arts Crafts
Decorative PET Stickers Waterproof Watercolor Bubble Glazed Sugar Heart Series For Scrapbooking Journaling DIY Arts Crafts
like
Find Similar
Pink heart-themed PET decorative stickers with watercolor bubble designs, set of 4 sheets - Rose Pink Sugar
Pine Green PET stickers set featuring watercolor bubbles and dots for scrapbooking - Turquoise Green Wave
Set of 4 PET starlight amethyst decorative stickers with watercolor bubble designs - Starlight Amethyst
Artistic red and pink PET heart stickers in watercolor style for DIY scrapbooking - Flame Red
+2
Decorative PET Stickers Waterproof Watercolor Bubble Glazed Sugar Heart Series For Scrapbooking Journaling DIY Arts Crafts
-10%
$0.41
No MOQ
 · 
19 views
Vintage Realistic PET Butterfly Stickers Waterproof Transparent Decorative Decals For Scrapbooking Journaling DIY Art Crafts
Vintage Realistic PET Butterfly Stickers Waterproof Transparent Decorative Decals For Scrapbooking Journaling DIY Art Crafts
like
Find Similar
50 pieces of vintage realistic PET butterfly stickers for journaling and DIY decor - Assorted Butterfly Designs (T01041971)
Vintage Realistic PET Butterfly Stickers Waterproof Transparent Decorative Decals For Scrapbooking Journaling DIY Art Crafts
$1.59
Mix MOQ : 2
Boho Artistic Waterproof PVC Stickers For Luggage Helmet Water Cup Aesthetic Vintage Decals For Laptop Phone Decoration
Boho Artistic Waterproof PVC Stickers For Luggage Helmet Water Cup Aesthetic Vintage Decals For Laptop Phone Decoration
like
Find Similar
Close-up of waterproof PVC BOHO art stickers featuring rainbows, flowers and retro vans - Boho Style Hot (200 Sheets)
Detailed assortment of boho style waterproof PVC stickers featuring sun, moon and botanicals - Boho Style (GT049)
50 pieces of Bohemian style waterproof PVC stickers with dreamcatchers and owl designs - Boho Style (FE124)
Close-up of BOHO style waterproof PVC stickers with warm Morandi tones and artistic designs - Boho Style (GT138)
+7
Boho Artistic Waterproof PVC Stickers For Luggage Helmet Water Cup Aesthetic Vintage Decals For Laptop Phone Decoration
$0.86-3.43
No MOQ
 · 
16 views
Self Love Club Waterproof PVC Stickers For Laptop Phone Water Cup Inspirational Quotes Heart Flower Rainbow Vinyl Decals
Self Love Club Waterproof PVC Stickers For Laptop Phone Water Cup Inspirational Quotes Heart Flower Rainbow Vinyl Decals
like
Find Similar
50pcs Self Love Club motivational stickers set for laptops and bottles in pink and red - Self Love Club Collection
Self Love Club Waterproof PVC Stickers For Laptop Phone Water Cup Inspirational Quotes Heart Flower Rainbow Vinyl Decals
$0.95
No MOQ
 · 
12 sold recently
Cute Cartoon Girl Washi Paper Sticker Book Mini Decorative Scrapbooking Material DIY Planner Journal Stationery Accessory
Cute Cartoon Girl Washi Paper Sticker Book Mini Decorative Scrapbooking Material DIY Planner Journal Stationery Accessory
like
Find Similar
Green cartoon washi sticker set with 50 sheets of cute bear and girl illustrations - Orange Rain (Green)
50-piece set of cute cartoon washi stickers featuring pets and girls for journaling - Ice Tea Joy (Blue)
Pastel cartoon stickers set with magic girls and cute animals made of washi paper - Clear Moon (Purple)
Cute Cartoon Girl Washi Paper Sticker Book Mini Decorative Scrapbooking Material DIY Planner Journal Stationery Accessory
$0.63
Mix MOQ : 2
 · 
49 sold recently
DIY Scene Stickers PET Cardboard Scrapbooking Journaling Isometric Miniature House Architecture Hand Drawn Aesthetic
DIY Scene Stickers PET Cardboard Scrapbooking Journaling Isometric Miniature House Architecture Hand Drawn Aesthetic
like
Find Similar
DIY Cave Dweller scene stickers with PET sheets and folding cardboard for 2.5D decoration - Cave Dwellers
DIY rock pit scene sticker set with 2 PET sheets and 1 pop-up card for journaling - Rock Pit
DIY scene sticker set with Galaxy Traveler theme 3 PET sheets and 1 background card - Galaxy Traveler
Sunset Platform DIY scenery sticker set with PET material and retro room motifs - Sunset Platform
+56
DIY Scene Stickers PET Cardboard Scrapbooking Journaling Isometric Miniature House Architecture Hand Drawn Aesthetic
$0.63-1.70
No MOQ
 · 
22 views
Vintage Scrapbook Material Paper Set Vellum Lightweight Paper For Journaling DIY Botanical Butterfly Decorative Paper Supplies
Vintage Scrapbook Material Paper Set Vellum Lightweight Paper For Journaling DIY Botanical Butterfly Decorative Paper Supplies
like
Find Similar
Vintage Misty Island breeze scrapbook paper set with 48 sheets of plant and stamp designs - Mist Island Wind
Floral scrapbooking paper set with 48 sheets of vintage botanical patterns and illustrations - Garden Party
Starry Night scrapbook paper kit with vintage butterfly and moon patterns in purple - Night Star River
Vintage Scrapbook Material Paper Set Vellum Lightweight Paper For Journaling DIY Botanical Butterfly Decorative Paper Supplies
-5%
$1.20
No MOQ
Vintage Christmas Party Night Stickers Hot Stamping Coated Paper DIY Scrapbooking Decor Santa Reindeer Snowman Kids Stickers
Vintage Christmas Party Night Stickers Hot Stamping Coated Paper DIY Scrapbooking Decor Santa Reindeer Snowman Kids Stickers
like
Find Similar
Vintage Christmas party stickers set with 30 pieces of gold-stamped washi paper - Happy Kids / 30 Sheets
30-piece Christmas party washi stickers set featuring gingerbread man and gold foil bears - Christmas Pets / 30 Sheets
Vintage Christmas Party Night Stickers Hot Stamping Coated Paper DIY Scrapbooking Decor Santa Reindeer Snowman Kids Stickers
-4%
$0.82
No MOQ
 · 
31 sold recently
Watercolor House Scenery PET Stickers For Journal Scrapbooking Decorative Building Dog Car Illustrations Waterproof DIY Craft Gift
Watercolor House Scenery PET Stickers For Journal Scrapbooking Decorative Building Dog Car Illustrations Waterproof DIY Craft Gift
like
Find Similar
Winter PET stickers with watercolor snowman and snowy cottage, 15 pieces per pack - Winter Snow House
Winter-themed house PET stickers for journals featuring snowy European architecture - Blue Snow House
Twilight PET sticker set Warm Green House theme with 15 hand-painted garden elements - Spring Green House
Watercolor House Scenery PET Stickers For Journal Scrapbooking Decorative Building Dog Car Illustrations Waterproof DIY Craft Gift
-9%
$0.78
No MOQ
Free Shipping
Inspirational English Quotes Stickers Irregular Hand-Torn Vintage Style Paper Decals For Journaling Scrapbooking DIY Craft Decoration
Inspirational English Quotes Stickers Irregular Hand-Torn Vintage Style Paper Decals For Journaling Scrapbooking DIY Craft Decoration
like
Find Similar
Macro view of vintage style inspirational English quote stickers for DIY journaling - Inspirational Quotes (T01041410) / 50 Sheets
Inspirational English Quotes Stickers Irregular Hand-Torn Vintage Style Paper Decals For Journaling Scrapbooking DIY Craft Decoration
$0.86
Mix MOQ : 5
 · 
33 sold recently
Gold Stamping Stickers PVC Self Adhesive Decorative Labels For Journaling Scrapbooking Vintage Space Travel Designs
Gold Stamping Stickers PVC Self Adhesive Decorative Labels For Journaling Scrapbooking Vintage Space Travel Designs
like
Find Similar
Travel-themed gold foil PVC stickers with Eiffel Tower and Statue of Liberty icons - Travel
Zodiac gold stamping stickers in black PVC with sun and moon patterns for journals - Zodiac
Gold foil leaf stickers for scrapbooking in 100x230mm PVC sheet for journaling - Leaf
Space themed gold foil stickers made of eco-friendly PVC for journals and scrapbooks - Space
+4
Gold Stamping Stickers PVC Self Adhesive Decorative Labels For Journaling Scrapbooking Vintage Space Travel Designs
-8%
$0.22
No MOQ
 · 
16 views
Cute Cartoon Duck Stickers Waterproof PVC Graffiti Decals For Laptop Scrapbook Diary Stationery Decoration DIY Decorative Sticker Set
Cute Cartoon Duck Stickers Waterproof PVC Graffiti Decals For Laptop Scrapbook Diary Stationery Decoration DIY Decorative Sticker Set
like
Find Similar
100pcs cute duck stickers for water bottles and laptop waterproof cartoon duckling decals - Fat Duck Series
Cute Cartoon Duck Stickers Waterproof PVC Graffiti Decals For Laptop Scrapbook Diary Stationery Decoration DIY Decorative Sticker Set
$0.98
No MOQ
Vintage American Floral Stamp Stickers For DIY Scrapbooking Journal Laptop Phone Case Waterproof PVC Decorative Decals
Vintage American Floral Stamp Stickers For DIY Scrapbooking Journal Laptop Phone Case Waterproof PVC Decorative Decals
like
Find Similar
50 pieces of vintage floral stamp stickers for scrapbooking and DIY journal decoration - Vintage American Floral Style
Vintage American Floral Stamp Stickers For DIY Scrapbooking Journal Laptop Phone Case Waterproof PVC Decorative Decals
$0.96
No MOQ
Pink Cute Aesthetic Waterproof Stickers For Laptop Phone Luggage Skateboard DIY Decorative Girly Graffiti Art Decals
Pink Cute Aesthetic Waterproof Stickers For Laptop Phone Luggage Skateboard DIY Decorative Girly Graffiti Art Decals
like
Find Similar
50 pieces pink aesthetic vinyl stickers for luggage laptops with cute girl doodle motifs - Pink Girl Theme
Pink Cute Aesthetic Waterproof Stickers For Laptop Phone Luggage Skateboard DIY Decorative Girly Graffiti Art Decals
$0.96
No MOQ
Unicorn Multi Color Ballpoint Pen Retractable Writing Tool Cute Office School Supplies Stationery Novelty Gift For Kids
Unicorn Multi Color Ballpoint Pen Retractable Writing Tool Cute Office School Supplies Stationery Novelty Gift For Kids
like
Find Similar
Cartoon unicorn 10-color ballpoint pen with pink mane and transparent body design - Pink
Blue unicorn 10-color ballpoint pen with clear barrel for creative stationery - Blue
Multi-color unicorn ballpoint pen with pink 3D topper and transparent barrel - Purple
Unicorn-themed 10-color retractable ballpoint pen with transparent barrel and cute topper - Yellow
Unicorn Multi Color Ballpoint Pen Retractable Writing Tool Cute Office School Supplies Stationery Novelty Gift For Kids
$0.34
No MOQ
Healing Life Scenes PET Waterproof Stickers Cartoon Hand-drawn Scrapbooking Decals For Notebook Phone Case Laptop DIY Decoration
Healing Life Scenes PET Waterproof Stickers Cartoon Hand-drawn Scrapbooking Decals For Notebook Phone Case Laptop DIY Decoration
like
Find Similar
50 pieces of waterproof transparent PET stickers with nostalgic hand-drawn street scenes - Small Lane Neighbors PET Sticker Pack
Healing Life Scenes PET Waterproof Stickers Cartoon Hand-drawn Scrapbooking Decals For Notebook Phone Case Laptop DIY Decoration
$0.93
No MOQ
 · 
20 views
Free Shipping
Cute Cartoon Girl Guka Stickers Sweet Cool Series Laser Holographic DIY Journal Decorative Stickers
Cute Cartoon Girl Guka Stickers Sweet Cool Series Laser Holographic DIY Journal Decorative Stickers
like
Find Similar
Cute girl DIY stickers in pink-purple and red-black styles for scrapbooking decor - Tea Break
Cute sweet-cool girl themed decorative stickers for DIY scrapbooks 17x9cm set of 2 - Heart Strike
Cute cartoon girl stickers 17x9cm set of 2 in sweet blue and pink gradient colors - Flower & Qiqi
Cute girl DIY stickers for journaling, set of two 17x9cm sheets in blue and purple styles - In the Name of Love
Cute Cartoon Girl Guka Stickers Sweet Cool Series Laser Holographic DIY Journal Decorative Stickers
-9%
$0.47
No MOQ
 · 
16 sold recently
Washi Paper Animal Print Decorative Tape Assorted Patterns Leopard Zebra Tiger Cow Giraffe Texture Scrapbooking DIY Stickers
Washi Paper Animal Print Decorative Tape Assorted Patterns Leopard Zebra Tiger Cow Giraffe Texture Scrapbooking DIY Stickers
like
Find Similar
6 rolls of animal print washi tape featuring peacock feathers and geometric patterns - 6 Rolls Set / New Animal Print
Set of 6 animal print washi tapes featuring zebra, leopard and tiger patterns - 6 Rolls Set / Animal Print
Washi Paper Animal Print Decorative Tape Assorted Patterns Leopard Zebra Tiger Cow Giraffe Texture Scrapbooking DIY Stickers
-5%
$1.64
No MOQ
 · 
35 views
Vintage Book Reading Theme Stickers Waterproof PVC Vinyl Literary Aesthetic Decals For Laptop Scrapbooking School Reward
Vintage Book Reading Theme Stickers Waterproof PVC Vinyl Literary Aesthetic Decals For Laptop Scrapbooking School Reward
like
Find Similar
50pcs library themed waterproof stickers for books, computers and student stationery decor - Reading Graffiti (T01040383-1) / 50 Sheets
Vintage Book Reading Theme Stickers Waterproof PVC Vinyl Literary Aesthetic Decals For Laptop Scrapbooking School Reward
$0.95
Mix MOQ : 2
Cartoon Emoticon Stickers Set Multicolored Self Adhesive Decorative Label For Hand Account DIY Scrapbook Diary Journal Decor
Cartoon Emoticon Stickers Set Multicolored Self Adhesive Decorative Label For Hand Account DIY Scrapbook Diary Journal Decor
like
Find Similar
Three sheets of creative iOS style Emoji stickers with diverse fun cartoon facial expressions - Emoticon Stickers Three Sheets Set
Cartoon Emoticon Stickers Set Multicolored Self Adhesive Decorative Label For Hand Account DIY Scrapbook Diary Journal Decor
$0.23
Mix MOQ : 2
 · 
12 views
Vinyl Record Style Waterproof PVC Stickers Cartoon Music Player UI Decorative Decals For Phone Case Laptop Guitar
Vinyl Record Style Waterproof PVC Stickers Cartoon Music Player UI Decorative Decals For Phone Case Laptop Guitar
like
Find Similar
50pcs vinyl record aesthetic stickers featuring music UI and dreamy girls for decoration - Vinyl Record Shape (SJS286)
Vinyl Record Style Waterproof PVC Stickers Cartoon Music Player UI Decorative Decals For Phone Case Laptop Guitar
$0.96
No MOQ
 · 
10 sold recently
Butterfly Stickers PET Holographic Laser Gold Stamping Vintage Scrapbooking DIY Journaling Decoration
Butterfly Stickers PET Holographic Laser Gold Stamping Vintage Scrapbooking DIY Journaling Decoration
like
Find Similar
Starry fantasy butterfly theme stickers in blue and gold PVC material 20 sheets - Star Sea Fantasy (Blue)
20pcs butterfly PVC stickers set in iridescent pink and gold for vintage scrapbooking - Love Wishes (Pink)
Pack of 20 pieces translucent green PVC butterfly stickers with gold foil outline details - Forest Sonata (Green)
Vintage gold-foiled butterfly PVC stickers set in purple hues, 20 pieces included - Gentle Poetry (Purple)
Butterfly Stickers PET Holographic Laser Gold Stamping Vintage Scrapbooking DIY Journaling Decoration
$1.64
Mix MOQ : 2
 · 
32 sold recently
Free Shipping
Cartoon Cute Girl Washi Tape For Journaling DIY Decorative Stickers Scrapbooking Arts Crafts Supplies Coated Paper Tape
Cartoon Cute Girl Washi Tape For Journaling DIY Decorative Stickers Scrapbooking Arts Crafts Supplies Coated Paper Tape
like
Find Similar
6 options
Cartoon Cute Girl Washi Tape For Journaling DIY Decorative Stickers Scrapbooking Arts Crafts Supplies Coated Paper Tape
-10%
$1.61
No MOQ
 · 
12 views
White Kraft Paper Roll For Art Crafts Gift Wrapping DIY Drawing Painting Paper Eco Friendly Packing Decor Roll
White Kraft Paper Roll For Art Crafts Gift Wrapping DIY Drawing Painting Paper Eco Friendly Packing Decor Roll
like
Find Similar
3 options
White Kraft Paper Roll For Art Crafts Gift Wrapping DIY Drawing Painting Paper Eco Friendly Packing Decor Roll
$2.45-8.65
No MOQ
 · 
47 views
Vintage PET Garden Landscape Stickers Fence Wall Series Scrapbook Decoration Material Floral Botanical Illustration Decals
Vintage PET Garden Landscape Stickers Fence Wall Series Scrapbook Decoration Material Floral Botanical Illustration Decals
like
Find Similar
Waterproof PET stickers with rose flower garden patterns for scrapbooking decoration - Rose Flower Wall
Purple vine flower PET stickers for garden landscaping junk journals 10 pieces pack - Purple Flower Vine
Garden fence PET sticker set with 10 floral landscape designs for scrapbooking - Fence Mesh
Watercolor fence garden PET stickers set with 10 floral designs for scrapbooking - Fence Railing
Vintage PET Garden Landscape Stickers Fence Wall Series Scrapbook Decoration Material Floral Botanical Illustration Decals
$0.84
No MOQ
Korean Ins Style Cartoon Photocard Album PVC Storage Folder For Three Inch Photos Cute Portable Collect Book For Students
Korean Ins Style Cartoon Photocard Album PVC Storage Folder For Three Inch Photos Cute Portable Collect Book For Students
like
Find Similar
Mini photo album for polaroid cards featuring a cute white rabbit and strawberry design - Pink Rabbit
Korean Ins Style Cartoon Photocard Album PVC Storage Folder For Three Inch Photos Cute Portable Collect Book For Students
$1.87
No MOQ
Vintage French Style Scrapbook Material Paper Non-Repeating DIY Journaling Decorative Background Craft Paper Collage
Vintage French Style Scrapbook Material Paper Non-Repeating DIY Journaling Decorative Background Craft Paper Collage
like
Find Similar
Vintage European style decorative scrapbook paper with Victorian motifs on wooden surface - Non-repeating Scrapbook Material Paper / 16 Sheets Pack
Vintage French Style Scrapbook Material Paper Non-Repeating DIY Journaling Decorative Background Craft Paper Collage
-5%
$1.42
No MOQ
Vintage Christmas Washi Stickers Journaling Scrapbooking DIY Decorative Decals Santa Snowman Festival Nostalgic Stationery
Vintage Christmas Washi Stickers Journaling Scrapbooking DIY Decorative Decals Santa Snowman Festival Nostalgic Stationery
like
Find Similar
Set of 30 vintage Christmas stickers featuring Santa and winter pets on dark green background - Christmas Wishes
Christmas washi sticker set with 15 holiday patterns including Santa and Reindeer, 30 sheets - Happy Christmas
Forest Christmas washi sticker set with 30 sheets of vintage hand-drawn holiday patterns - Forest Christmas
Vintage Christmas washi sticker set with Santa Claus illustrations 30 sheets pack - Warm Christmas
+1
Vintage Christmas Washi Stickers Journaling Scrapbooking DIY Decorative Decals Santa Snowman Festival Nostalgic Stationery
-4%
$0.96
Mix MOQ : 10
 · 
15 views
8 Sheets Cartoon Party Girl Outfit DIY Stickers Waterproof PVC Decorative Decals For Journal Phone Laptop Scrapbook
8 Sheets Cartoon Party Girl Outfit DIY Stickers Waterproof PVC Decorative Decals For Journal Phone Laptop Scrapbook
like
Find Similar
Detail of 8-sheet cartoon girl stickers set with various themes and pastel colors - Girl Outfit Series (8 Sheets)
8 Sheets Cartoon Party Girl Outfit DIY Stickers Waterproof PVC Decorative Decals For Journal Phone Laptop Scrapbook
-9%
$0.86
No MOQ
Vintage Scrapbooking Material Pack Bronzing Washi PET Stickers For DIY Journal Art Decoration Whale Starry Sky Art Supplies
Vintage Scrapbooking Material Pack Bronzing Washi PET Stickers For DIY Journal Art Decoration Whale Starry Sky Art Supplies
like
Find Similar
Magic Journals vintage stationery set with gold stamping and celestial tarot stickers - Magic Diary
Secret Garden vintage journal stickers pack featuring floral designs and gold foiling - Secret Garden
Space-themed vintage journaling set with golden whale star sky stickers and PET papers - Whale Fall Space
Retro Impression style scrapbook kit with vintage stickers, lace paper and PET decals - Vintage Impression
Vintage Scrapbooking Material Pack Bronzing Washi PET Stickers For DIY Journal Art Decoration Whale Starry Sky Art Supplies
-10%
$1.40
No MOQ
Vintage Christmas Theme Material Paper Background Paper For DIY Scrapbooking Junk Journal Craft Winter Reindeer Floral
Vintage Christmas Theme Material Paper Background Paper For DIY Scrapbooking Junk Journal Craft Winter Reindeer Floral
like
Find Similar
1 option
Vintage Christmas Theme Material Paper Background Paper For DIY Scrapbooking Junk Journal Craft Winter Reindeer Floral
$1.21
No MOQ
 · 
14 views
Vintage Grocery Label Stickers Set Boxed Food Patterns Printed Paper Decals For Scrapbooking Journaling DIY Arts Crafts Decor
Vintage Grocery Label Stickers Set Boxed Food Patterns Printed Paper Decals For Scrapbooking Journaling DIY Arts Crafts Decor
like
Find Similar
45pcs Vintage food and grocery stickers set in craft box for scrapbooking decor - Grocery Labels
Vintage Grocery Label Stickers Set Boxed Food Patterns Printed Paper Decals For Scrapbooking Journaling DIY Arts Crafts Decor
-11%
$0.54
No MOQ
 · 
10 views
Travel Watercolor Graffiti Stickers Waterproof PVC Cartoon Decals For Laptop Luggage Guitar DIY Journal Decoration
Travel Watercolor Graffiti Stickers Waterproof PVC Cartoon Decals For Laptop Luggage Guitar DIY Journal Decoration
like
Find Similar
50 pieces of waterproof watercolor travel stickers for luggage and guitar decoration - Travel Watercolor Stickers
Travel Watercolor Graffiti Stickers Waterproof PVC Cartoon Decals For Laptop Luggage Guitar DIY Journal Decoration
$0.98
No MOQ
Miss Time Floral Reverie PET Stickers Pack Aesthetic Flower Bouquet Holographic Decals For Scrapbooking DIY Journaling Decoration
Miss Time Floral Reverie PET Stickers Pack Aesthetic Flower Bouquet Holographic Decals For Scrapbooking DIY Journaling Decoration
like
Find Similar
Purple floral PET sticker pack for DIY scrapbooking with 30 pieces of flower designs - Purple Flower Story
Floral PET sticker pack Sunlight Blossom theme for DIY journaling 30 pieces set - Sunlight Blossom
Misty Rose PET floral stickers 30pcs set for DIY journaling and scrapbooking deco - The Misty Rose
Floral Reverie pink and purple rose sticker set with 30 pieces for DIY scrapbooking - Freud Rose
+2
Miss Time Floral Reverie PET Stickers Pack Aesthetic Flower Bouquet Holographic Decals For Scrapbooking DIY Journaling Decoration
-9%
$0.78
No MOQ
 · 
13 views
Free Shipping
Autumn Maple Leaf Bulletin Board Borders Thanksgiving Classroom Decor Stickers Coated Paper Adhesive Waterproof Wall Decals
Autumn Maple Leaf Bulletin Board Borders Thanksgiving Classroom Decor Stickers Coated Paper Adhesive Waterproof Wall Decals
like
Find Similar
Detail of autumn maple leaf bulletin board border with red plaid and orange foliage textures - 2.8inch(ZB72)
Autumn Maple Leaf Bulletin Board Borders Thanksgiving Classroom Decor Stickers Coated Paper Adhesive Waterproof Wall Decals
-4%
$0.82
No MOQ
Bohemian Mental Health Matters Waterproof PVC Stickers Inspirational Quotes Aesthetic Boho Stickers For Laptop Guitar Water Bottle Decor
Bohemian Mental Health Matters Waterproof PVC Stickers Inspirational Quotes Aesthetic Boho Stickers For Laptop Guitar Water Bottle Decor
like
Find Similar
Boho mental health stickers set for guitar and laptop featuring inspirational quotes - Mental Health Theme
Bohemian Mental Health Matters Waterproof PVC Stickers Inspirational Quotes Aesthetic Boho Stickers For Laptop Guitar Water Bottle Decor
$0.98
No MOQ
 · 
10 views
Cartoon Marine Life Ocean In A Bottle Waterproof PVC Stickers For Laptop Suitcase Guitar Scrapbooking DIY Decorative Labels
Cartoon Marine Life Ocean In A Bottle Waterproof PVC Stickers For Laptop Suitcase Guitar Scrapbooking DIY Decorative Labels
like
Find Similar
50 pieces of colorful ocean world in a bottle stickers for laptop and guitar decoration - 50 Sheets Ocean Bottle World (980912241446)
Cartoon Marine Life Ocean In A Bottle Waterproof PVC Stickers For Laptop Suitcase Guitar Scrapbooking DIY Decorative Labels
$0.98
No MOQ
 · 
16 views
Aesthetic Butterfly Stickers Waterproof PVC Decals For Hand Account Scrapbooking DIY Laptop Phone Case Korean Style Decorative Sticker Pack
Aesthetic Butterfly Stickers Waterproof PVC Decals For Hand Account Scrapbooking DIY Laptop Phone Case Korean Style Decorative Sticker Pack
like
Find Similar
Flat lay variety of aesthetic waterproof butterfly stickers for scrapbooking and crafts - White Butterfly (UU287)
Macro view of assorted pink Y2K butterfly stickers with waterproof PVC texture - Pink Butterfly (UU295)
Close-up of assorted waterproof butterfly stickers in vibrant yellow and orange tones - Yellow Butterfly (UU296)
Close-up of green butterfly stickers in various artistic styles with white die-cut edges - Green Butterfly (UU300)
Aesthetic Butterfly Stickers Waterproof PVC Decals For Hand Account Scrapbooking DIY Laptop Phone Case Korean Style Decorative Sticker Pack
$0.86
No MOQ
 · 
11 views
Waterproof PET Scrapbook Stickers Retro Illustration Aesthetic Die-Cut Decals For DIY Journaling Planner Decoration
Waterproof PET Scrapbook Stickers Retro Illustration Aesthetic Die-Cut Decals For DIY Journaling Planner Decoration
like
Find Similar
Twilight Notes waterproof PET stickers with girls and pets themes for journaling - Twilight Notes
Waterproof PET stickers set featuring vintage girls and pets in warm retro tones - Country Holiday
Forest style waterproof PET sticker set featuring cartoon girls and floral themes - Spring Retreat
Winter Starry Home waterproof PET sticker set with cute girls and animals, 4 sheets - Winter Pastoral
+2
Waterproof PET Scrapbook Stickers Retro Illustration Aesthetic Die-Cut Decals For DIY Journaling Planner Decoration
-9%
$0.39
No MOQ
 · 
22 views
Cartoon Animal Reading Stickers Waterproof PVC Decals For Phone Tablet Laptop Scrapbooking Journal Stationery Decoration
Cartoon Animal Reading Stickers Waterproof PVC Decals For Phone Tablet Laptop Scrapbooking Journal Stationery Decoration
like
Find Similar
50 PCS cartoon animal reading stickers for laptop decor, waterproof vinyl decals set - Animal Reading Series / Colorful
Cartoon Animal Reading Stickers Waterproof PVC Decals For Phone Tablet Laptop Scrapbooking Journal Stationery Decoration
$0.95
No MOQ
Vintage Hollow Out Decorative Cards Thick Cardboard Paper For DIY Scrapbooking Journaling Aesthetic Floral Butterfly Retro Material Paper
Vintage Hollow Out Decorative Cards Thick Cardboard Paper For DIY Scrapbooking Journaling Aesthetic Floral Butterfly Retro Material Paper
like
Find Similar
Sunshine Garden retro window arch decorative paper stickers set for journaling - Sunny Garden
Vintage floral frame stickers set with 10 unique designs for DIY journal decoration - Garden Time
Orchid style vintage hollow decorative paper stickers for journaling DIY crafts - Windowside Orchid
Forest Illusion decorative hollow card set with 10 vintage frames for DIY journaling - Forest Illusion
+1
Vintage Hollow Out Decorative Cards Thick Cardboard Paper For DIY Scrapbooking Journaling Aesthetic Floral Butterfly Retro Material Paper
$0.95
No MOQ
 · 
10 views
Free Shipping
Halloween Scrapbook Paper Pumpkin Ghost Bat Skeleton DIY Collage Journaling Material Paper Decorative For Holiday
Halloween Scrapbook Paper Pumpkin Ghost Bat Skeleton DIY Collage Journaling Material Paper Decorative For Holiday
like
Find Similar
12 sheets of 6x6 inch Halloween scrapbook paper with pumpkin and ghost hand-drawn patterns - Black and White Hand-drawn Style (Style B)
6x6 inch Halloween scrapbook paper set featuring 12 watercolor pumpkin and castle designs - Retro Watercolor Style (Style A)
Halloween Scrapbook Paper Pumpkin Ghost Bat Skeleton DIY Collage Journaling Material Paper Decorative For Holiday
$0.84
Mix MOQ : 2
Jane Austen Literary Theme Graffiti Stickers Retro Waterproof PVC Decals For Laptop Suitcase Phone Case Journal Decoration
Jane Austen Literary Theme Graffiti Stickers Retro Waterproof PVC Decals For Laptop Suitcase Phone Case Journal Decoration
like
Find Similar
Set of 50 vintage Jane Austen literary stickers for laptops and journals - Jane Austen Literary Theme
Jane Austen Literary Theme Graffiti Stickers Retro Waterproof PVC Decals For Laptop Suitcase Phone Case Journal Decoration
$0.96
No MOQ
 · 
21 views
Floral Botanical Stickers Waterproof PET Vintage Flower Decals For Scrapbooking DIY Journaling Craft Decoration
Floral Botanical Stickers Waterproof PET Vintage Flower Decals For Scrapbooking DIY Journaling Craft Decoration
like
Find Similar
Lin Yunsui Chapter botanical PET stickers set with 40 pieces of forest and tree designs - Forest Rhyme
Floral PET waterproof stickers set with 40 transparent botanical designs for scrapbooking - Fragrant Grass Dream
Set of 40 waterproof floral PET stickers featuring 20 unique vintage bouquet designs - Flower Rhyme Poetry
Autumn-themed floral PET stickers featuring amber tones for DIY journaling, 40 pieces set - Autumn Flora
+1
Floral Botanical Stickers Waterproof PET Vintage Flower Decals For Scrapbooking DIY Journaling Craft Decoration
-10%
$0.62
No MOQ
 · 
11 views
Vintage Round Scrapbooking Stickers Botanical Butterfly Celestial Mushroom Coffee Designs For Journaling DIY Decoration
Vintage Round Scrapbooking Stickers Botanical Butterfly Celestial Mushroom Coffee Designs For Journaling DIY Decoration
like
Find Similar
Plant Traces theme round white kraft paper stickers for journaling 24 pieces set - Plant Traces
Retro mushroom themed circular frame stickers made of white kraft paper, 24 pieces set - Mushroom Notes
Vintage Round Scrapbooking Stickers Botanical Butterfly Celestial Mushroom Coffee Designs For Journaling DIY Decoration
$0.86
No MOQ
Vintage Retro Flash Sand PET Decorative Tape Set For Scrapbooking Journaling DIY Crafts Lace Floral Pattern Stationery
Vintage Retro Flash Sand PET Decorative Tape Set For Scrapbooking Journaling DIY Crafts Lace Floral Pattern Stationery
like
Find Similar
Lace PET decorative tape set with glitter dots and bow patterns for DIY journaling - Lace Trim
Strawberry Manor shimmering PET tape set with floral and lace patterns for DIY crafts - Strawberry Manor
Flash sand PET lace tape set with blue checkered and white floral patterns - Light Blue Coarse Cloth
Linen embroidery style PET tape set featuring red lace and floral patterns for DIY - Linen Embroidery
+2
Vintage Retro Flash Sand PET Decorative Tape Set For Scrapbooking Journaling DIY Crafts Lace Floral Pattern Stationery
$0.88
No MOQ
Vintage Floral PET Tape With Holographic Silver Hot Stamping Decorative Washi Tape For Scrapbooking DIY Journaling Collage
Vintage Floral PET Tape With Holographic Silver Hot Stamping Decorative Washi Tape For Scrapbooking DIY Journaling Collage
like
Find Similar
Floral PET tape with black and white floral line drawings and holographic silver accents - Clear Wild Fields
Floral PET tape with silver foil stamping and 54mm x 3m laser silver flower pattern - Verdant Flower Shadows
Daisy pattern PET tape in silver finish for DIY scrapbooking, 54mm width decoration - Daisy Courtyard
PET tape with black and white floral patterns, white ink and laser silver finish - Fallen Petal Whispers
+4
Vintage Floral PET Tape With Holographic Silver Hot Stamping Decorative Washi Tape For Scrapbooking DIY Journaling Collage
-9%
$1.30
No MOQ
Watercolor Bird Stickers Transparent PET Nature Parrot Sparrow Flower Decorative Decals For Journaling Scrapbooking DIY Decor
Watercolor Bird Stickers Transparent PET Nature Parrot Sparrow Flower Decorative Decals For Journaling Scrapbooking DIY Decor
like
Find Similar
Watercolor bird transparent PET stickers set featuring parrots and owls on a wooden disc - Watercolor Bird Style(T01043045)
Watercolor Bird Stickers Transparent PET Nature Parrot Sparrow Flower Decorative Decals For Journaling Scrapbooking DIY Decor
$1.59
Mix MOQ : 2
Go to

More in office & school supplies

Explore more in lined notebooks

covergirlskidsmetalstyledesignthreadsquarecardsmall
studentsbanddailymagneticholidaylockholderpartypersonaldouble

Ready to source like an insider

Get a direct line to the factory floor — no minimums, no middlemen, no guesswork.
iconReal factory pricing, no markup in betweeniconEvery order hand-inspected before it shipsicon5,000+ new products added daily
Get Inside Access