Everful

Wholesale lined notebooks

Factory-direct selection, vetted for quality and ready to order.

Sign Up
Lined Notebooks

Find the perfect pieces: notebooks, sticky notes, planners and more

filterShow Filters
Best Seller
New Arrivals
Price Drop
Free Shipping
LCD Writing Tablet Electronic Drawing Board Digital Doodle Pad Eye Protection Colorful Erase Button Lock Button Kids Gifts
LCD Writing Tablet Electronic Drawing Board Digital Doodle Pad Eye Protection Colorful Erase Button Lock Button Kids Gifts
like
Find Similar
Blue 8.5 inch LCD writing tablet with stylus and one-click clear button for drawing - 【Monochrome】Small 8.5 Inch Blue
Pink 8.5 inch LCD writing tablet for kids with stylus and eco-friendly retail packaging - 【Monochrome】Small 8.5 Inch Pink
16-inch black LCD writing tablet with stylus and environmental friendly packaging box - 【Monochrome】16 Inch Matte Black
16-inch LCD writing tablet for kids in light blue with matching stylus and eco-friendly box - 【Monochrome】16 Inch Ocean Blue
+26
LCD Writing Tablet Electronic Drawing Board Digital Doodle Pad Eye Protection Colorful Erase Button Lock Button Kids Gifts
-5%
$1.26-5.21
No MOQ
 · 
285 sold recently
HB Pencils With Cartoon Eraser Toppers Cute Animal Shape Wooden Writing Drawing School Stationery For Kids Students
HB Pencils With Cartoon Eraser Toppers Cute Animal Shape Wooden Writing Drawing School Stationery For Kids Students
like
Find Similar
Cute cartoon pencils with creative rubber erasers and Happy Day text for students - Striped Polka Dot - With Bag
Set of 10 colorful children pencils with cute cartoon animal erasers and patterned barrels - Cartoon Patterns - With Bag
Cartoon animal pencils with erasers featuring frog, lion, and bear toppers for kids - Striped Polka Dot - No Bag
Colorful wooden pencils with cute animal and fruit shaped erasers for school kids - Cartoon Patterns - No Bag
HB Pencils With Cartoon Eraser Toppers Cute Animal Shape Wooden Writing Drawing School Stationery For Kids Students
$0.05-0.07
Mix MOQ : 2
 · 
1K+ sold recently
Dual Head Watercolor Brush Pens Fine Tip Soft Brush Water Based Washable Markers For Drawing Calligraphy Coloring
Dual Head Watercolor Brush Pens Fine Tip Soft Brush Water Based Washable Markers For Drawing Calligraphy Coloring
like
Find Similar
Set of 24 dual-tip washable watercolor markers in transparent pouch with button closure - 24 Colors White Barrel
Dual tip watercolor markers in 12 vibrant colors with soft brush and fine liner tips - 12 Colors Black Barrel
Washable 24 colors dual tip watercolor pens with flexible brush and fineliner markers - 24 Colors Black Barrel
Set of 36 colors dual-tip markers with brush and fine tips in a portable PVC box - 36 Colors White Barrel
+29
Dual Head Watercolor Brush Pens Fine Tip Soft Brush Water Based Washable Markers For Drawing Calligraphy Coloring
$0.74-18.73
No MOQ
 · 
219 sold recently
Vintage Corduroy Pencil Case Solid Color Minimalist Stationery Bag Multi-functional Zippered Organizer For Students And Office
Vintage Corduroy Pencil Case Solid Color Minimalist Stationery Bag Multi-functional Zippered Organizer For Students And Office
like
Find Similar
Detail of off-white corduroy pencil case with soft texture and Sozakka woven label - Creamy White
Detailed texture of beige corduroy pencil case with woven label held by hand - Apricot
Close-up of light grey corduroy pencil case with green zipper and brand label on desk - Gray
Pink corduroy pencil case with a zipper closure and brand label shown in hand - Nude Pink
+7
Vintage Corduroy Pencil Case Solid Color Minimalist Stationery Bag Multi-functional Zippered Organizer For Students And Office
-11%
$1.50
No MOQ
 · 
21 views
Metal Ballpoint Pen With Large Crystal Diamond Top Elegant Writing Tool For Office School Students Stationery Gift
Metal Ballpoint Pen With Large Crystal Diamond Top Elegant Writing Tool For Office School Students Stationery Gift
like
Find Similar
Elegant rose gold metal ballpoint pen with a large multi-faceted crystal diamond top - Rose Gold
Golden metal ballpoint pen with a large crystal diamond top on a stylish desk background - Electroplated Gold
Silver metal ballpoint pen with a large diamond-shaped crystal on top for students - Electroplated Silver
Elegant wine red metal ballpoint pen featuring a large crystal diamond top and gold accents - Burgundy
+47
Metal Ballpoint Pen With Large Crystal Diamond Top Elegant Writing Tool For Office School Students Stationery Gift
-6%
$0.43
Mix MOQ : 2
 · 
560 sold recently
Top 10% Best Sellers
in Writing & Correction Supplies
DIY Beadable Ballpoint Pen Plastic Body Metal Rod Printed Leopard Floral Holiday Pattern Crafting Stationery
DIY Beadable Ballpoint Pen Plastic Body Metal Rod Printed Leopard Floral Holiday Pattern Crafting Stationery
like
Find Similar
DIY beadable pen featuring sunflower and leopard print patterns on a sleek white body - Sunflower Leopard Mix (128)
DIY plastic beaded pen with turquoise floral print and silver top metal rod - Brown Base Blue Pattern (129)
Customizable beaded ballpoint pen featuring a vibrant Mexican Day of the Dead skeleton pattern - Skull Theme No.1 (130)
Purple DIY beadable pen with Mexican Day of the Dead sugar skull and floral pattern - Skull Theme No.2 (131)
+134
DIY Beadable Ballpoint Pen Plastic Body Metal Rod Printed Leopard Floral Holiday Pattern Crafting Stationery
-3%
$0.26
Mix MOQ : 2
 · 
489 sold recently
Quilted Polyester Pencil Case Large Capacity Stationery Bag With Cute Floral Cherry Bow Patterns For School Girls
Quilted Polyester Pencil Case Large Capacity Stationery Bag With Cute Floral Cherry Bow Patterns For School Girls
like
Find Similar
Close-up of floral canvas pencil case with a zipper on a desk with stationery - Little Floral
Detailed view of floral quilted cotton pouch with diamond stitching and zipper closure - Stemmed Floral
Close-up of quilted pink stripe pencil case with purple bow pattern and metal zipper - Striped Bow
Close-up of quilted floral pencil case with pink bows and heart prints for students - Heart Pattern Bow
+3
Quilted Polyester Pencil Case Large Capacity Stationery Bag With Cute Floral Cherry Bow Patterns For School Girls
$1.12
No MOQ
 · 
62 views
Elegant Ballpoint Pen Metallic Artificial Pearl Finish Creative Heart Butterfly Star Flower Decorative Top Writing Gift For Office School
Elegant Ballpoint Pen Metallic Artificial Pearl Finish Creative Heart Butterfly Star Flower Decorative Top Writing Gift For Office School
like
Find Similar
Silver metal ballpoint pen featuring a decorative heart-shaped top for Valentine's gifts - Butterfly / Silver
Sparkly purple flower ballpoint pen with glitter finish for creative holiday gifts - Flower / Holographic Purple
Elegant red heart-shaped ballpoint pen with sleek metallic finish for wedding favors - Heart / Red
Elegant golden metal ballpoint pen with creative heart-shaped topper for Valentines gift - Heart / Orange
+44
Elegant Ballpoint Pen Metallic Artificial Pearl Finish Creative Heart Butterfly Star Flower Decorative Top Writing Gift For Office School
-6%
$0.14-0.15
Mix MOQ : 50
 · 
1K+ sold recently
Top 10% Best Sellers
in Writing & Correction Supplies
Beadable Ballpoint Pen DIY Metal Rhinestone Crystal Luxury Creative Writing Stationery For Office School Gift
Beadable Ballpoint Pen DIY Metal Rhinestone Crystal Luxury Creative Writing Stationery For Office School Gift
like
Find Similar
Silver DIY beadable pen with glittering crystal rhinestones and sleek metallic finish - White
Elegant silver metal beaded pen with luxury crystal diamond accents for office use - Silver
DIY gray beaded ballpoint pen with sparkling diamond accents and a sleek metal finish - Gray
Sparkling gold glitter beaded ballpoint pen with stylish silver accents and sleek metal tip - Gold
+4
Beadable Ballpoint Pen DIY Metal Rhinestone Crystal Luxury Creative Writing Stationery For Office School Gift
-26%
$0.30
Mix MOQ : 2
 · 
714 sold recently
Kids 3D Pencil Case EVA Hard Shell Large Capacity Cartoon Stationery Bag School Students Organizer Cute Embossed Design
Kids 3D Pencil Case EVA Hard Shell Large Capacity Cartoon Stationery Bag School Students Organizer Cute Embossed Design
like
Find Similar
Pink EVA hard shell pencil case featuring a 3D cartoon giraffe design with Smile text - Pink with Giraffe
3D EVA kids pencil case featuring navy blue space astronaut theme and space lettering - Space Boy
3D astronaut space theme EVA pencil case for kids in navy blue with red zipper details - Astronaut
3D navy blue EVA pencil case featuring a raised space rocket design and red zipper - Space Rocket
+4
Kids 3D Pencil Case EVA Hard Shell Large Capacity Cartoon Stationery Bag School Students Organizer Cute Embossed Design
-5%
$2.05
Mix MOQ : 2
 · 
101 sold recently
Creative Simulation Tool Shaped Gel Pen Set Plastic Wrench Screwdriver Shaped 0.5mm Black Ink Pens For Office School Student Gift Stationery
Creative Simulation Tool Shaped Gel Pen Set Plastic Wrench Screwdriver Shaped 0.5mm Black Ink Pens For Office School Student Gift Stationery
like
Find Similar
Creative wrench shaped gel pen in metallic gold finish for students and gifts - Wrench Style / Gold
Silver wrench shaped novelty gel pen with metallic finish on blue background - Wrench Style / Silver
Light blue creative wrench-shaped gel pen with realistic metallic texture on display - Wrench Style / Blue
Creative wrench-shaped ballpoint pen in metallic gold finish for students and office gifts - Screwdriver Shape / Gold
+2
Creative Simulation Tool Shaped Gel Pen Set Plastic Wrench Screwdriver Shaped 0.5mm Black Ink Pens For Office School Student Gift Stationery
$0.14
No MOQ
 · 
62 sold recently
Vintage Genuine Leather Pencil Case Double Zipper Crazy Horse Leather Stationery Pouch Retro Large Capacity Pen Storage Bag Unisex Office School
Vintage Genuine Leather Pencil Case Double Zipper Crazy Horse Leather Stationery Pouch Retro Large Capacity Pen Storage Bag Unisex Office School
like
Find Similar
Brown crazy horse leather pencil case with double zippers and retro metal chain - Brown
Black crazy horse leather pencil case with double zippers and retro metal handle chain - Black
Large capacity crazy horse leather pencil case in dark brown with double zippers - Coffee
Vintage dark red crazy horse leather pencil case with double zipper and chain handle - Red
+2
Vintage Genuine Leather Pencil Case Double Zipper Crazy Horse Leather Stationery Pouch Retro Large Capacity Pen Storage Bag Unisex Office School
$10.95
No MOQ
Free Shipping
Creative DIY Beaded Ballpoint Pen With Flower Daisy Sunflower Silicone Topper Colorful Plastic Metal Twist Writing Stationery
Creative DIY Beaded Ballpoint Pen With Flower Daisy Sunflower Silicone Topper Colorful Plastic Metal Twist Writing Stationery
like
Find Similar
Close-up of a red DIY beaded pen with a floral silicone charm and glitter finish - Red Flower
Detail of pink beaded pen with white daisy flower charm and sparkling spacer rings - White & Pink Daisy
Detail of yellow beaded pen featuring a white daisy flower topper and sparkling rhinestones - Yellow & White Daisy
Detail view of DIY beaded pen with white plastic body and green daisy silicone charm - White & Green Daisy
+15
Creative DIY Beaded Ballpoint Pen With Flower Daisy Sunflower Silicone Topper Colorful Plastic Metal Twist Writing Stationery
$1.01
Mix MOQ : 3
 · 
166 sold recently
Retractable Pencil Case Canvas Telescopic Standing Pen Holder Large Capacity Cute Cartoon Animal Student Stationery Bag
Retractable Pencil Case Canvas Telescopic Standing Pen Holder Large Capacity Cute Cartoon Animal Student Stationery Bag
like
Find Similar
Yellow canvas boba tea telescopic pencil case showing extended and collapsed positions - Mango Milk Tea
Blue canvas telescopic pencil case with bubble tea design and cute cartoon face - Blue Velvet Milk Tea
Cute milk tea canvas pencil case in khaki featuring a creative telescopic sliding design - Coffee Milk Tea
Green matcha bubble tea telescopic pencil case in durable canvas material - Matcha Green Milk Tea
+55
Retractable Pencil Case Canvas Telescopic Standing Pen Holder Large Capacity Cute Cartoon Animal Student Stationery Bag
$3.46-5.76
No MOQ
 · 
12 sold recently
Free Shipping
Plush Pencil Case Cute Heart Pattern Large Capacity Makeup Pouch Portable Travel Stationery Organizer Bag For Girls
Plush Pencil Case Cute Heart Pattern Large Capacity Makeup Pouch Portable Travel Stationery Organizer Bag For Girls
like
Find Similar
Close-up of pink plush makeup bag featuring red heart patterns and metal zipper detail - Pink Heart
Detail of soft white plush cosmetic bag featuring purple heart patterns and zip closure - Purple Heart
Detailed view of plush pouch with green heart patterns and soft texture - Green Heart
Close-up of soft plush pouch with heart pattern and fluffy faux fur texture detail - Black Heart
+1
Plush Pencil Case Cute Heart Pattern Large Capacity Makeup Pouch Portable Travel Stationery Organizer Bag For Girls
$1.53
No MOQ
 · 
14 sold recently
Cute Cat Paw Shape Pencil Case Soft Plush Large Capacity Stationery Storage Bag For Students Kawaii Embroidery Organizer
Cute Cat Paw Shape Pencil Case Soft Plush Large Capacity Stationery Storage Bag For Students Kawaii Embroidery Organizer
like
Find Similar
Beige plush cat paw pencil case with pink heart embroidery and YEAH text detail - YEAH Embroidery / Beige
Pink plush cat paw pencil case with soft faux fur and embroidered paw pads - Pink
Cute gray plush cat paw pencil case with pink heart-shaped pads and YEAH embroidery - YEAH Embroidery / Gray
Brown plush cat paw pencil case with pink paw pad design and white CAT embroidery - CAT Embroidery / Brown
Cute Cat Paw Shape Pencil Case Soft Plush Large Capacity Stationery Storage Bag For Students Kawaii Embroidery Organizer
-4%
$1.37
Mix MOQ : 2
 · 
14 sold recently
Desktop Calculator Mechanical Keyboard Style Round Buttons Macaron Colors Silent Large LCD Screen Office Home Stationery
Desktop Calculator Mechanical Keyboard Style Round Buttons Macaron Colors Silent Large LCD Screen Office Home Stationery
like
Find Similar
Mechanical style calculator with pink purple gradient keys and 12-digit LCD screen - Pink Voice Model 817TK / Pink
Mechanical style calculator in cream color with orange and grey round buttons - 863 White [2025 New Model] / White
Mechanical style calculator in vibrant orange and white with 12-digit LCD display - 863 Orange [2025 New Model] / Orange
Purple mechanical calculator with 12-digit LCD and colorful round macaron buttons - 863 Purple [2025 New Model] / Purple
+69
Desktop Calculator Mechanical Keyboard Style Round Buttons Macaron Colors Silent Large LCD Screen Office Home Stationery
-10%
$2.01-4.32
No MOQ
 · 
147 sold recently
Top 5% Best Sellers
in Desk Accessories
Plush Pencil Case Soft Faux Fur Large Capacity Stationery Bag Minimalist Student Pen Organizer Cosmetic Pouch
Plush Pencil Case Soft Faux Fur Large Capacity Stationery Bag Minimalist Student Pen Organizer Cosmetic Pouch
like
Find Similar
Close-up of a soft pink plush pencil case with zipper on a minimalist white desk - Pink
Detail of white plush pencil case with zipper and soft faux fur texture for students - White
Detailed macro view of soft light blue plush pencil case with metallic zipper closure - Blue
Close-up of a plush khaki storage bag on a desk with stationery items and keyboard - Khaki
+1
Plush Pencil Case Soft Faux Fur Large Capacity Stationery Bag Minimalist Student Pen Organizer Cosmetic Pouch
$1.53
Mix MOQ : 2
 · 
33 views
Cute Cartoon Canvas Pencil Case Large Capacity Double Layer Stationery Bag With Handle For Students Aesthetic
Cute Cartoon Canvas Pencil Case Large Capacity Double Layer Stationery Bag With Handle For Students Aesthetic
like
Find Similar
Cute purple double-layer canvas pencil case with bear print and side handle - Purple
Pink double-layer canvas pencil case with cute rabbit and HAPPY printed design - Pink
Blue canvas pencil case with cute cartoon dog pattern and double layer zipper storage - Blue
Cute yellow canvas pencil case with cartoon bear pattern and a durable zipper strap - Milk Yellow
Cute Cartoon Canvas Pencil Case Large Capacity Double Layer Stationery Bag With Handle For Students Aesthetic
$1.10
No MOQ
 · 
36 sold recently
Telescopic Pencil Case Canvas Pen Holder Desk Organizer Standing Stationery Pouch Cute Multi-function Bag
Telescopic Pencil Case Canvas Pen Holder Desk Organizer Standing Stationery Pouch Cute Multi-function Bag
like
Find Similar
Vertical pink canvas stationery pouch with yellow zipper and cute cartoon patch detail - Pink
Top view of large capacity yellow stationery pouch with pink zipper and cute cartoon patch - Yellow
Detailed view of pale green polka dot pencil case with vertical storage and yellow zipper - Green
Detailed view of large capacity canvas pencil case with cute cloud patch and yellow zipper - Purple
+1
Telescopic Pencil Case Canvas Pen Holder Desk Organizer Standing Stationery Pouch Cute Multi-function Bag
$2.28
Mix MOQ : 2
 · 
36 views
Mermaid Flip Sequin Pencil Case Reversible Glitter Makeup Bag Stationery Pouch For Students Girls Travel Organizer
Mermaid Flip Sequin Pencil Case Reversible Glitter Makeup Bag Stationery Pouch For Students Girls Travel Organizer
like
Find Similar
Detail of multi-color gradient mermaid sequins on pencil case with black zipper and lanyard - Rainbow
Macro detail of reversible pink and white sequins on a rectangular pencil case - Pink
Detail of multi-color mermaid sequin pencil case with heart-shaped zipper and black strap - Iridescent
Detail of reversible purple and green sequins on a rectangular pencil case with zipper - Holographic Multicolor
+3
Mermaid Flip Sequin Pencil Case Reversible Glitter Makeup Bag Stationery Pouch For Students Girls Travel Organizer
-4%
$0.77
No MOQ
 · 
19 sold recently
Striped Pencil Bag Terry Cloth Plush Material Large Capacity Stationery Organizer Portable Zipper Pouch Korean Style
Striped Pencil Bag Terry Cloth Plush Material Large Capacity Stationery Organizer Portable Zipper Pouch Korean Style
like
Find Similar
Close-up of green and white striped terry cloth pencil case with May Rabbit woven label - Green and White Striped
Detail of pink striped towel fabric pencil case with May Rabbit woven label on a desk - Pink & Orange Stripes
Detail of blue and white striped terry cloth pencil case with soft texture and zipper - Navy Stripe
Close-up of blue and green striped towel cloth pencil case with May Rabbit woven label - Royal Blue & Green Striped
Striped Pencil Bag Terry Cloth Plush Material Large Capacity Stationery Organizer Portable Zipper Pouch Korean Style
$2.56
No MOQ
Retractable Ballpoint Pen Plastic Multi-color Macaron Style Pens With Gold Clip 1.0mm Bullet Tip Office School Stationery Supplies
Retractable Ballpoint Pen Plastic Multi-color Macaron Style Pens With Gold Clip 1.0mm Bullet Tip Office School Stationery Supplies
like
Find Similar
1.0mm Bullet Tip / Black
1.0mm Bullet Tip / White
1.0mm Bullet Tip / Purple
1.0mm Bullet Tip / Green
+7
Retractable Ballpoint Pen Plastic Multi-color Macaron Style Pens With Gold Clip 1.0mm Bullet Tip Office School Stationery Supplies
$0.19
No MOQ
 · 
719 sold recently
Cartoon Animal Pencil Case Oxford Cloth Large Capacity Portable Handle School Stationery Organizer Cute Student Pouch
Cartoon Animal Pencil Case Oxford Cloth Large Capacity Portable Handle School Stationery Organizer Cute Student Pouch
like
Find Similar
Light blue canvas pencil case featuring a green cartoon crocodile and dual zipper design - Blue Crocodile
Navy blue high-capacity canvas pencil case featuring 3 layers and a cute fox print - Navy Fox
Pink large capacity canvas pencil case with cute blue elephant print and handle - Pink Elephant
Cute yellow canvas pencil case with bunny print and double zipper storage - Yellow Rabbit
+6
Cartoon Animal Pencil Case Oxford Cloth Large Capacity Portable Handle School Stationery Organizer Cute Student Pouch
$1.07
No MOQ
 · 
39 sold recently
Gel Pen Set Glitter Neon Metallic Pastel 1.0mm Bullet Tip For Drawing Journaling Art Coloring Stationery
Gel Pen Set Glitter Neon Metallic Pastel 1.0mm Bullet Tip For Drawing Journaling Art Coloring Stationery
like
Find Similar
Set of 60 colorful glitter and metallic gel pens in a portable PVC storage pouch - Mixed Colors / 60 Pcs/Set
Set of 12 glitter gel pens with 1.0mm bullet tips in transparent plastic packaging - Glitter Pen / 12 Pieces
Set of 18 vibrant colors glitter gel pens with 1.0mm tips in clear plastic case - Glitter Pen / 18 Pcs/Set
24-color glitter and fluorescent gel pen set with a transparent storage case - Glitter Pen / 24 Pcs/Set
+6
Gel Pen Set Glitter Neon Metallic Pastel 1.0mm Bullet Tip For Drawing Journaling Art Coloring Stationery
-5%
$0.90-4.36
No MOQ
 · 
164 sold recently
Quilted Puffy Pencil Case Large Capacity Portable Cosmetic Bag Ribbon Bow Contrast Color Trendy Stationery Organizer For Girls
Quilted Puffy Pencil Case Large Capacity Portable Cosmetic Bag Ribbon Bow Contrast Color Trendy Stationery Organizer For Girls
like
Find Similar
Quilted pastel pouch with purple handle and pink ribbon on a laptop desk setup - Beige
Macro detail of macaron puffy pencil case with ribbon bow and soft handle - Light Pink
Detail of mint green and pink contrast makeup bag with elegant ribbon bow and handle - Fresh Green
Quilted Puffy Pencil Case Large Capacity Portable Cosmetic Bag Ribbon Bow Contrast Color Trendy Stationery Organizer For Girls
-4%
$3.26
No MOQ
Vintage Specialty Paper Journaling Material Kit Retro Decorative Bookmarks With Burnt Edge Effect For DIY Scrapbooking Art Craft Gift
Vintage Specialty Paper Journaling Material Kit Retro Decorative Bookmarks With Burnt Edge Effect For DIY Scrapbooking Art Craft Gift
like
Find Similar
Vintage floral bookmark set with 20 pieces of elegant specialty paper for DIY planners - 20 Sheets / Love Letter Story
Retro Manuscript Diary bookmarks with vintage plant, butterfly and mushroom illustrations - 20 Sheets / Manuscript Diary
Retro Quiet Snow Night bookmarks set with 20 vintage European street scene cards - 20 Sheets / Quiet Snow Night
Pink Christmas vintage bookmarks set with specialty paper and retro burnt edge finish - 20 Sheets / Pink Christmas
+1
Vintage Specialty Paper Journaling Material Kit Retro Decorative Bookmarks With Burnt Edge Effect For DIY Scrapbooking Art Craft Gift
-4%
$0.82
No MOQ
 · 
18 sold recently
Leopard Print Ballpoint Pen Metal Large Crystal Diamond Top Luxury Twist Action Stationery Writing Office School Gift
Leopard Print Ballpoint Pen Metal Large Crystal Diamond Top Luxury Twist Action Stationery Writing Office School Gift
like
Find Similar
Pink leopard print metal ballpoint pen with a large crystal diamond top on wood base - Pink Leopard
Leopard print metal ballpoint pen with a large clear diamond top in golden finish - White Leopard Print
Chic red and black leopard print metal ballpoint pen with a large diamond top ornament - Red Leopard
Luxury purple leopard print metal ballpoint pen with a large diamond-cut crystal top - Purple Leopard
+3
Leopard Print Ballpoint Pen Metal Large Crystal Diamond Top Luxury Twist Action Stationery Writing Office School Gift
$0.66
Mix MOQ : 2
 · 
266 sold recently
Morandi Color Highlighter Pens Square Barrel Chisel Tip Soft Eye Protection Markers Office School Stationery
Morandi Color Highlighter Pens Square Barrel Chisel Tip Soft Eye Protection Markers Office School Stationery
like
Find Similar
6-pack macaron soft tip highlighters in protective transparent plastic packaging - Sweet Colors
Set of 6 Morandi macaron soft tip highlighters in transparent pouch for eye protection - Salt Colors
Morandi Color Highlighter Pens Square Barrel Chisel Tip Soft Eye Protection Markers Office School Stationery
$0.40
Mix MOQ : 2
 · 
471 sold recently
Portable Watercolor Coloring Book Tri Fold Painting Paper With Solid Paint Card And Water Brush Pen Art Supplies For Adults
Portable Watercolor Coloring Book Tri Fold Painting Paper With Solid Paint Card And Water Brush Pen Art Supplies For Adults
like
Find Similar
Portable animal theme watercolor painting set with 12 colors, brush and 16 paper sheets - Colorful Animals
Starry sky themed watercolor painting set with paper, brush and 12-color palette - Starry Dream
Portable watercolor painting book set with 12-color palette and 8 bird outline sheets - Birds and Flowers
Quiet Time watercolor painting book set with 12 colors, brush, and 16 coloring pages - Quiet Time
+3
Portable Watercolor Coloring Book Tri Fold Painting Paper With Solid Paint Card And Water Brush Pen Art Supplies For Adults
$3.75
No MOQ
 · 
33 sold recently
Crystal Heart Gel Pens With Gold Plated Frame Glitter Decor Stationery Office School Supplies Creative Cute
Crystal Heart Gel Pens With Gold Plated Frame Glitter Decor Stationery Office School Supplies Creative Cute
like
Find Similar
Yellow crystal heart gel pen with translucent green barrel and gold top ornament - Yellow
Pink crystal heart gel pen with gold metallic finish and glitter detail in a pencil holder - Pink
Creative crystal heart pen with a golden frame and sparkling blue sequins decor - Blue
Pink glitter heart neutral pen with gold plating decoration and transparent barrel - Purple
Crystal Heart Gel Pens With Gold Plated Frame Glitter Decor Stationery Office School Supplies Creative Cute
$0.16
No MOQ
 · 
198 sold recently
Nordic Style Printed Paper Stickers With UI Dialog Box Text Patterns For Scrapbook DIY Decorative Journaling Material
Nordic Style Printed Paper Stickers With UI Dialog Box Text Patterns For Scrapbook DIY Decorative Journaling Material
like
Find Similar
Information Age theme DIY sticker pack with 20 pieces of minimalist black and white labels - Black and White
Pink and purple long strip deco stickers with chat bubbles for scrapbooking - Corner Begonia
Information Age theme DIY sticker pack with retro computer UI designs in 20 count pack - Romantic Deep Sea
Information Age theme long stickers set with sunset orange UI and bubble design - Sunset Balloon Flower
Nordic Style Printed Paper Stickers With UI Dialog Box Text Patterns For Scrapbook DIY Decorative Journaling Material
-9%
$0.83
No MOQ
 · 
13 sold recently
Kawaii Pen Holder Desktop Storage Box Plastic Mini Fridge Shape Large Capacity Stationery Organizer For Kids Students
Kawaii Pen Holder Desktop Storage Box Plastic Mini Fridge Shape Large Capacity Stationery Organizer For Kids Students
like
Find Similar
Pink and orange cartoon pig pen holder with large capacity and transparent door - No Gifts / Orange
Purple and beige piggy desk organizer with mini fridge design and top pen holder - No Gifts / Purple
Blue mini fridge-style pen holder for children with 3D cartoon bear stickers - With Stickers & 3D Charms / Blue
Cute pink pig-shaped desk organizer with transparent door and spacious compartments - No Gifts / Pink
+6
Kawaii Pen Holder Desktop Storage Box Plastic Mini Fridge Shape Large Capacity Stationery Organizer For Kids Students
$1.01-1.59
Mix MOQ : 2
 · 
127 sold recently
Butterfly Pendant Gel Pen Plastic Glitter Hanging Charm Writing Signature Pen For Students Girls School Office
Butterfly Pendant Gel Pen Plastic Glitter Hanging Charm Writing Signature Pen For Students Girls School Office
like
Find Similar
Purple gel pen with butterfly pendant and bow detail on a pink display stand - Purple
Pink and white butterfly pendant gel pen featuring glitter accents on a pastel stand - Pink
Cute butterfly pendant gel pen in transparent casing with blue sequins and glitter charms - Blue
White butterfly pendant gel pen with holographic sequins on a soft pink background - White
Butterfly Pendant Gel Pen Plastic Glitter Hanging Charm Writing Signature Pen For Students Girls School Office
-4%
$0.22
Mix MOQ : 10
 · 
2K+ sold recently
Top 10% Best Sellers
in Writing & Correction Supplies
Solid Color Butterfly Embossed Pencil Case Large Capacity Stationery Storage Bag Korean Style Quilted Organizer For Students
Solid Color Butterfly Embossed Pencil Case Large Capacity Stationery Storage Bag Korean Style Quilted Organizer For Students
like
Find Similar
Close-up of pink puffy pencil case with quilted 3D bows and isocute fabric label - Pink
Macro detail of cream quilted pencil case with butterfly pattern and gold logo label - White
Close-up of silver quilted stationery pouch with butterfly embroidery and zipper - Silver Gray
Solid Color Butterfly Embossed Pencil Case Large Capacity Stationery Storage Bag Korean Style Quilted Organizer For Students
$1.73
No MOQ
Photocard Binder Album Laser Star PVC Zipper Binder Ring Card Holder For Kpop Photos Storage Book Cartoon Cute Stationery
Photocard Binder Album Laser Star PVC Zipper Binder Ring Card Holder For Kpop Photos Storage Book Cartoon Cute Stationery
like
Find Similar
Pink Puppy Cover (Excluding Inner Pages)
Detail of A5 photo album with laser star pattern and secure zipper closure for cards - Black Puppy Cover (Excluding Inner Pages)
Detail of A5 binder with laser star pattern, zipper closure and cute cartoon inner pages - Blue Puppy Cover (Excluding Inner Pages)
Detail of A5 laser star binder bag with mint green zipper and cute cartoon insert - Green Puppy Cover (Excluding Inner Pages)
+14
Photocard Binder Album Laser Star PVC Zipper Binder Ring Card Holder For Kpop Photos Storage Book Cartoon Cute Stationery
$0.23-3.89
No MOQ
 · 
22 sold recently
Ballpoint Pen Natural Crystal Raw Stone Crushed Gravel Silver Metal Office Stationery Creative Gift Writing Instrument
Ballpoint Pen Natural Crystal Raw Stone Crushed Gravel Silver Metal Office Stationery Creative Gift Writing Instrument
like
Find Similar
Silver metal ballpoint pen with transparent barrel filled with natural white crystal - White Crystal
Silver metal ballpoint pen featuring pink rose quartz crystals and gemstone top - Rose Quartz
Silver metal ballpoint pen with citrine crystal raw stones and transparent barrel - Citrine
Creative silver metal ballpoint pen featuring natural purple amethyst crystals - Amethyst
+4
Ballpoint Pen Natural Crystal Raw Stone Crushed Gravel Silver Metal Office Stationery Creative Gift Writing Instrument
-5%
$1.86
No MOQ
 · 
216 sold recently
Top 5% Best Sellers
in Writing & Correction Supplies
Retro Crazy Horse Genuine Leather Multi-functional Zippered Pen Case Stationery Organizer Business Travel Pouch
Retro Crazy Horse Genuine Leather Multi-functional Zippered Pen Case Stationery Organizer Business Travel Pouch
like
Find Similar
Retro brown crazy horse leather zipper pen case and multi-functional stationery bag - Brown
Handcrafted crazy horse leather pencil case in black with yellow contrast stitching detail - Black
Dark brown crazy horse leather pen case with zipper closure and vintage stitching - Coffee
Dark red crazy horse leather pencil case with zipper and vintage textured finish - Red
+2
Retro Crazy Horse Genuine Leather Multi-functional Zippered Pen Case Stationery Organizer Business Travel Pouch
-5%
$14.06
No MOQ
 · 
12 views
Free Shipping
Cartoon Flamingo Digital Print Oxford Cosmetic Bag Travel Stationery Pouch Portable Rectangular Makeup Bag For Women School Office
Cartoon Flamingo Digital Print Oxford Cosmetic Bag Travel Stationery Pouch Portable Rectangular Makeup Bag For Women School Office
like
Find Similar
Close-up of Oxford fabric pencil case with pink flamingo print and Scooter Lover text - Pink Flamingo (Bd819)
Cartoon Flamingo Digital Print Oxford Cosmetic Bag Travel Stationery Pouch Portable Rectangular Makeup Bag For Women School Office
-5%
$1.64
No MOQ
Cute Space Astronaut Cartoon Pencil Case Frosted PP Plastic Stationery Storage Bag With Ring Pull Zipper Portable Organizer
Cute Space Astronaut Cartoon Pencil Case Frosted PP Plastic Stationery Storage Bag With Ring Pull Zipper Portable Organizer
like
Find Similar
Cartoon space astronaut translucent pencil case with ring zipper and star print - Baby Dinosaur
Cute cartoon astronaut bear stationery bag with frosted finish and white ring zipper - Cute Space Bear
Space themed frosted pencil pouch with blue astronaut graphics and a ring zipper pull - Interstellar Astronaut
Cute frosted cartoon bunny pencil case with blue zipper ring for stationery storage - Energetic Rabbit
+3
Cute Space Astronaut Cartoon Pencil Case Frosted PP Plastic Stationery Storage Bag With Ring Pull Zipper Portable Organizer
$0.12
Mix MOQ : 2
 · 
899 sold recently
Retro Memories Series White Kraft Paper Vintage Stickers For Scrapbooking Journaling DIY Art Craft Decorative Labels
Retro Memories Series White Kraft Paper Vintage Stickers For Scrapbooking Journaling DIY Art Craft Decorative Labels
like
Find Similar
30pcs Retro Memories vintage stamp stickers made of white kraft paper for scrapbooking - Vintage Stamp
Vintage film theme aesthetic stickers set made of white kraft paper for journaling - Memory Film
Vintage insect stickers white kraft paper set for DIY scrapbooking 30 pieces - Insect
Retro scrapbook frame stickers set made of white kraft paper with vintage stamp designs - Collage Border
+2
Retro Memories Series White Kraft Paper Vintage Stickers For Scrapbooking Journaling DIY Art Craft Decorative Labels
-4%
$0.98
No MOQ
 · 
45 sold recently
Free Shipping
Creative Black Cat Silhouette Bookmark Acrylic Funny Cartoon Hanging Book Marker For Reading Enthusiasts Students
Creative Black Cat Silhouette Bookmark Acrylic Funny Cartoon Hanging Book Marker For Reading Enthusiasts Students
like
Find Similar
1 option
Creative Black Cat Silhouette Bookmark Acrylic Funny Cartoon Hanging Book Marker For Reading Enthusiasts Students
-4%
$0.22
No MOQ
 · 
189 sold recently
Top 10% Best Sellers
in Labels, Indexes & Stamps
Multi Color Ballpoint Pen Retractable Macaron Cute Aesthetic Journaling School Office Stationery For Students Girls
Multi Color Ballpoint Pen Retractable Macaron Cute Aesthetic Journaling School Office Stationery For Students Girls
like
Find Similar
6 options
Multi Color Ballpoint Pen Retractable Macaron Cute Aesthetic Journaling School Office Stationery For Students Girls
$0.16
No MOQ
 · 
581 sold recently
Quilted Cotton Pencil Bag Cute Cartoon Rabbit Stationery Pouch Heart Pattern Student Pen Case For School Office Storage
Quilted Cotton Pencil Bag Cute Cartoon Rabbit Stationery Pouch Heart Pattern Student Pen Case For School Office Storage
like
Find Similar
Detailed close-up of pink quilted fabric pencil case with cute rabbit and cherry patterns - Pink
Close-up of quilted pencil case featuring cartoon rabbit and blue zipper closure - Blue
Quilted white pencil case with heart pattern, cute bunny print and purple zipper detail - Purple
Quilted Cotton Pencil Bag Cute Cartoon Rabbit Stationery Pouch Heart Pattern Student Pen Case For School Office Storage
$1.38
Mix MOQ : 2
 · 
15 sold recently
Transparent PVC Pencil Case Large Capacity Waterproof Stationery Pouch Desktop Storage Makeup Bag For Students INS Style
Transparent PVC Pencil Case Large Capacity Waterproof Stationery Pouch Desktop Storage Makeup Bag For Students INS Style
like
Find Similar
Transparent yellow PVC storage bag with zipper and handle, size 22 x 10.5 x 6.5 cm - Yellow
Blue transparent PVC makeup and stationery bag with zipper, size 22x10.5x6.5cm - Blue
Minimalist transparent PVC storage bag with white trim and circular ring zipper 22x10.5cm - White
Transparent green zipper storage bag for stationery and makeup 22x10.5x6.5cm - Green
+1
Transparent PVC Pencil Case Large Capacity Waterproof Stationery Pouch Desktop Storage Makeup Bag For Students INS Style
-5%
$0.67
Mix MOQ : 2
 · 
181 sold recently
Quilted Plaid Fabric Pencil Case Bowknot Print Large Capacity Stationery Storage Bag Portable Makeup Organizer For Students
Quilted Plaid Fabric Pencil Case Bowknot Print Large Capacity Stationery Storage Bag Portable Makeup Organizer For Students
like
Find Similar
Close-up of pink checkered quilted pencil case with red bow patterns and brand label - Pink Plaid
Detailed view of blue checkered pencil case with embroidered pink bow and top zipper - Blue Plaid
Detail of pink plaid pencil case featuring blue bow patterns and hisocute label - Rose Red Checkerboard
Close-up of yellow checkered quilted pencil case with pink bow prints and zipper - Yellow Check
+2
Quilted Plaid Fabric Pencil Case Bowknot Print Large Capacity Stationery Storage Bag Portable Makeup Organizer For Students
$1.59
No MOQ
Cartoon Mini Stapler Keychain Portable Pocket Size Desktop Binding Tool For School Students Includes Staples
Cartoon Mini Stapler Keychain Portable Pocket Size Desktop Binding Tool For School Students Includes Staples
like
Find Similar
Light blue mini stapler keychain with metal ring, portable cartoon stationery tool - Mint Green
Miniature color-coded 10# staples set in pink, purple, and cyan boxes for mini staplers - 10# Staples (400 Pcs)
Portable pink mini stapler keychain for students with weather baby design and metal ring - Sakura Pink
Mini purple stapler keychain for students featuring a cute weather-themed cartoon design - Lavender
+12
Cartoon Mini Stapler Keychain Portable Pocket Size Desktop Binding Tool For School Students Includes Staples
$0.16-0.36
No MOQ
 · 
633 sold recently
Christmas Stationery Cartoon Santa Reindeer Pencil Ruler Eraser Sharpener Student Gift Holiday Reward For Kids
Christmas Stationery Cartoon Santa Reindeer Pencil Ruler Eraser Sharpener Student Gift Holiday Reward For Kids
like
Find Similar
5-piece Christmas stationery set with pencils, ruler, eraser, and sharpener in red Santa theme - Red
5-piece Christmas stationery set with pencils, ruler, and eraser in festive red and green - Yellow/Beige
5-piece Christmas stationery set with pencils, ruler, sharpener and eraser in green theme - Green
5-piece Christmas stationery set with pencils, ruler, eraser and sharpener in red-blue theme - Blue
Christmas Stationery Cartoon Santa Reindeer Pencil Ruler Eraser Sharpener Student Gift Holiday Reward For Kids
$0.22
No MOQ
 · 
312 sold recently
Cartoon Sandwich Erasers PVC Soft Rubber Jelly Pattern Bear Rabbit Astronaut Fruit Cute School Stationery For Kids Students
Cartoon Sandwich Erasers PVC Soft Rubber Jelly Pattern Bear Rabbit Astronaut Fruit Cute School Stationery For Kids Students
like
Find Similar
Cute yellow duck cartoon eraser with sandwich pattern design for school student stationery - Yellow Duck
Cute cartoon dinosaur sandwich eraser for kids with mint green checkered sleeve 40x16x13mm - Small Dinosaur
Cartoon sandwich eraser with red rocket pattern and astronaut outer space sleeve - Rocket
Cute purple sandwich eraser with cartoon girl pattern and Cocoa Daily brand design - Little Girl
+17
Cartoon Sandwich Erasers PVC Soft Rubber Jelly Pattern Bear Rabbit Astronaut Fruit Cute School Stationery For Kids Students
$0.08-3.11
No MOQ
 · 
2K+ sold recently
Top 5% Best Sellers
in Writing & Correction Supplies
Cartoon Shaped Metal Paper Clips Multicolor Fruit Christmas Bookmarks For Office School Students Journaling Organization
Cartoon Shaped Metal Paper Clips Multicolor Fruit Christmas Bookmarks For Office School Students Journaling Organization
like
Find Similar
Creative avocado shaped paper clips in light green finish with transparent box - Avocado (10 Pieces/Pack)
Ice cream shaped paper clips in pink and yellow with a transparent storage box - Ice Cream (10 Pieces/Pack)
Creative carrot shaped paper clips in orange and green finish with clear storage box - Carrot (10 Pieces/Pack)
Red cherry shaped paper clips with green stems in a transparent storage box - Cherry (10 Pieces/Pack)
+24
Cartoon Shaped Metal Paper Clips Multicolor Fruit Christmas Bookmarks For Office School Students Journaling Organization
-9%
$1.29-2.57
Mix MOQ : 2
 · 
71 sold recently
Creative Feather Ballpoint Pen Elegant Metal Barrel Ostrich Quill Pens For Wedding Office Writing Graduation Party Gift
Creative Feather Ballpoint Pen Elegant Metal Barrel Ostrich Quill Pens For Wedding Office Writing Graduation Party Gift
like
Find Similar
Elegant white feather ballpoint pen with a slim rose gold metal barrel on a magazine - Rose Gold (White Feather)
Creative white feather ballpoint pen with sleek silver metal barrel on a stylish magazine - Silver (White Feather)
Dreamcatcher pen with soft pink feathers and rose gold metal barrel for party gifts - Rose Gold (Pink Feather)
Dreamcatcher feather ballpoint pen in light blue with elegant rose gold metal stem - Rose Gold (Light Blue Feather)
+9
Creative Feather Ballpoint Pen Elegant Metal Barrel Ostrich Quill Pens For Wedding Office Writing Graduation Party Gift
-5%
$0.74
Mix MOQ : 2
 · 
395 sold recently
Cat Embroidery Pencil Case Cotton Linen Large Capacity Stationery Pouch Makeup Bag Japanese Style Student Office Organizer
Cat Embroidery Pencil Case Cotton Linen Large Capacity Stationery Pouch Makeup Bag Japanese Style Student Office Organizer
like
Find Similar
Detail of embroidered cat pattern and woven brand label on a black canvas pencil case - Black
Japanese style beige canvas pencil case with cute embroidered cats and large capacity - Off-white
Detail of embroidered cats on a grey linen pencil case with black merciparis brand tag - Gray
Cat Embroidery Pencil Case Cotton Linen Large Capacity Stationery Pouch Makeup Bag Japanese Style Student Office Organizer
-4%
$2.44
No MOQ
 · 
26 views
Luxury Ballpoint Pen With Large Diamond Top And Sparkly Rhinestones Full Crystal Metal Writing Gift For Office Women
Luxury Ballpoint Pen With Large Diamond Top And Sparkly Rhinestones Full Crystal Metal Writing Gift For Office Women
like
Find Similar
Close-up of sparkling sky blue rhinestone ballpoint pen with a large crystal diamond top - Lake Blue
Detail shot of a silver ballpoint pen with large light blue crystal and full rhinestone body - White
Black rhinestone pen with large pink crystal topper and purple metallic trim accents - Black
Elegant purple metal ballpoint pen with sparkling red rhinestones and pink diamond top - Red
+11
Luxury Ballpoint Pen With Large Diamond Top And Sparkly Rhinestones Full Crystal Metal Writing Gift For Office Women
$2.02
No MOQ
 · 
97 sold recently
Free Shipping
Pencil Cup Pen Holder Desktop Organizer Plastic Dual Compartment For Stationery Makeup Brush Nordic Style Cute 3D Patch
Pencil Cup Pen Holder Desktop Organizer Plastic Dual Compartment For Stationery Makeup Brush Nordic Style Cute 3D Patch
like
Find Similar
White desk organizer with orange fruit decor, Nordic style pen holder for cute storage - Orange
Nordic white desk organizer with cute pink pig design and grey dual compartments - Pig
White cartoon pen holder with gray double compartment lid for desk organization - Small Wings
Dark blue Nordic desk organizer with rainbow motif for pens and makeup brushes - Blue Rainbow
+8
Pencil Cup Pen Holder Desktop Organizer Plastic Dual Compartment For Stationery Makeup Brush Nordic Style Cute 3D Patch
$0.46
No MOQ
 · 
246 sold recently
Dual Tip Brush Pens Watercolor Markers Art Supply For Coloring Drawing Sketching Calligraphy Water Based Non Toxic
Dual Tip Brush Pens Watercolor Markers Art Supply For Coloring Drawing Sketching Calligraphy Water Based Non Toxic
like
Find Similar
Set of 12 colors dual tip markers with brush and fineliner tips in a white barrel - 12 Colors Set (White Barrel)
36-color dual tip watercolor pens with brush and 0.4mm fineliner in a clear plastic case - 36 Colors Set (White Barrel)
72-color dual-tip watercolor markers set with 1-2mm brush and 0.4mm fine tips in carrying case - 72 Colors Set (White Barrel)
60 pieces black dual brush pens carrying case made of durable nylon with zipper closure - 60 Colors CD Case Set (White Barrel)
+3
Dual Tip Brush Pens Watercolor Markers Art Supply For Coloring Drawing Sketching Calligraphy Water Based Non Toxic
$1.57-15.33
No MOQ
 · 
63 sold recently
Quicksand Glitter Gel Pens Cartoon Unicorn Magic Wand Topper Glowing LED Stationery Office School Writing Supplies
Quicksand Glitter Gel Pens Cartoon Unicorn Magic Wand Topper Glowing LED Stationery Office School Writing Supplies
like
Find Similar
Pink unicorn quicksand gel pen with rainbow gradient and glitter for students - LED Unicorn Quicksand Pen Pink
Creative unicorn liquid glitter pen with pink cap and rainbow mane on white grid background - LED Unicorn Quicksand Pen Purple
Pink unicorn gel pen featuring colorful liquid quicksand and glitter for school - LED Unicorn Quicksand Pen Green
Quicksand unicorn gel pen with pink grip and sparkling liquid glitter inside the barrel - LED Unicorn Quicksand Pen Blue
+50
Quicksand Glitter Gel Pens Cartoon Unicorn Magic Wand Topper Glowing LED Stationery Office School Writing Supplies
$0.14-0.32
No MOQ
 · 
380 sold recently
Top 5% Reordered
in Writing & Correction Supplies
Pink Cat Pattern Pencil Case Glitter Transparent PVC Stationery Storage Zipper Pouch
Pink Cat Pattern Pencil Case Glitter Transparent PVC Stationery Storage Zipper Pouch
like
Find Similar
Pink translucent pencil case with white polka dots and 'SOMETHING GOOD' text - Pink Polka Dot - Something Good
Pink translucent cat pencil case with glitter finish and Feeling Good slogan print - Pink Glitter Cat - Feeling Good
Cute transparent pink glitter pencil case with white polka dots and Meow cat design - Pink Polka Dot Cat - Meow
Pink translucent glitter cat pencil case with Meow print and pink zipper detail - Pink Full Glitter Cat - Meow
Pink Cat Pattern Pencil Case Glitter Transparent PVC Stationery Storage Zipper Pouch
-4%
$0.77
Mix MOQ : 2
 · 
68 sold recently
Ins Style Plush Leopard Print Pencil Case Large Capacity Stationery Bag Faux Fur Makeup Organizer For Students Office
Ins Style Plush Leopard Print Pencil Case Large Capacity Stationery Bag Faux Fur Makeup Organizer For Students Office
like
Find Similar
Detailed view of pink leopard plush pencil case with zipper on a minimalist white desk - Pink
Close-up of soft purple leopard print plush pencil case with zipper and metal puller - Purple
Detailed view of pink leopard print plush makeup bag on desk with stationery items - Rose Red
Detailed view of light blue leopard print plush pencil case with soft faux fur texture - Blue
+1
Ins Style Plush Leopard Print Pencil Case Large Capacity Stationery Bag Faux Fur Makeup Organizer For Students Office
$1.12
No MOQ
Halloween Beaded Ballpoint Pen DIY Silicone Bead Plastic Writing Tool Cartoon Pumpkin Bat Ghost Design Party Favors Novelty Stationery
Halloween Beaded Ballpoint Pen DIY Silicone Bead Plastic Writing Tool Cartoon Pumpkin Bat Ghost Design Party Favors Novelty Stationery
like
Find Similar
Detail of DIY beadable pen with orange boo focal bead and Halloween silicone beads - BOO Style
Detail of Halloween beaded pen with orange pumpkin topper and Boo text on white base - BOO Pumpkin
Detail of beaded ballpoint pen featuring orange silicone pumpkin and glittery red barrel - Yellow Pumpkin
Detail of DIY beadable pen featuring a black cartoon bat topper and silicone beads - Black Bat
+12
Halloween Beaded Ballpoint Pen DIY Silicone Bead Plastic Writing Tool Cartoon Pumpkin Bat Ghost Design Party Favors Novelty Stationery
$1.12
Mix MOQ : 3
 · 
52 sold recently
Free Shipping
Acrylic Marker Pens Waterproof Fast Drying DIY Painting Drawing Art Multicolor Fiber Tip Portable Storage Box Stationery
Acrylic Marker Pens Waterproof Fast Drying DIY Painting Drawing Art Multicolor Fiber Tip Portable Storage Box Stationery
like
Find Similar
Two packs of 12-color acrylic markers in portable transparent boxes with handles - 12 Colors Acrylic Markers
18 vibrant colors acrylic marker set in portable clear case for DIY art and drawing - 18 Colors Acrylic Markers
Two sets of 24-color acrylic paint markers in portable transparent cases for DIY art - 24 Colors Acrylic Markers
Close-up of 36-color acrylic marker set in a portable transparent storage case - 36 Colors Acrylic Markers
+2
Acrylic Marker Pens Waterproof Fast Drying DIY Painting Drawing Art Multicolor Fiber Tip Portable Storage Box Stationery
-4%
$1.17-5.97
Mix MOQ : 3
 · 
131 sold recently
Go to

More in office & school supplies

Explore more in lined notebooks

covergirlskidsmetalstyledesignthreadsquarecardsmall
studentsbanddailymagneticholidaylockholderpartypersonaldouble

Ready to source like an insider

Get a direct line to the factory floor — no minimums, no middlemen, no guesswork.
iconReal factory pricing, no markup in betweeniconEvery order hand-inspected before it shipsicon5,000+ new products added daily
Get Inside Access