Everful

Wholesale lined notebooks

Factory-direct selection, vetted for quality and ready to order.

Sign Up
Lined Notebooks

Find the perfect pieces: notebooks, sticky notes, planners and more

filterShow Filters
Best Seller
New Arrivals
Price Drop
Free Shipping
6 In 1 Multi Tool Pen With Ruler Level Stylus Screwdriver Metal Ballpoint Pen For Office School DIY Men Gift
6 In 1 Multi Tool Pen With Ruler Level Stylus Screwdriver Metal Ballpoint Pen For Office School DIY Men Gift
like
Find Similar
Professional blue 6-in-1 multi-functional metal tool pen with stylus, ruler and level - Style B / Dark Blue
Premium 6-in-1 silver metal multifunctional tool pen featuring ruler scales and stylus tip - Style B / Silver
Red 6-in-1 multi-functional metal tool pen with ruler and capacitive stylus tip - Style B / Red
Professional yellow 6-in-1 multi-functional tool pen with ruler and stylus tip - Style B / Bright Yellow
+16
6 In 1 Multi Tool Pen With Ruler Level Stylus Screwdriver Metal Ballpoint Pen For Office School DIY Men Gift
-5%
$1.05
Mix MOQ : 2
 · 
908 sold recently
Transparent PVC Loose Leaf Binder Pockets Zipper Bags Card Holders And Soft Rulers For Notebook
Transparent PVC Loose Leaf Binder Pockets Zipper Bags Card Holders And Soft Rulers For Notebook
like
Find Similar
A5 size clear PVC 6-hole binder pocket with a durable black plastic zipper closure - A6 Transparent Bag with Black Zipper
A6 size clear PVC 6-hole loose-leaf binder pouch with a red zipper for notebooks - A6 Transparent Bag with Red Zipper
Yellow PVC 6-hole binder zipper pouch for A6 A5 planners and loose leaf organizers - A6 Transparent Bag with Yellow Zipper
Blue 6-hole loose-leaf zipper binder pocket made of translucent PVC for A5/A6 planners - A6 Transparent Bag with Blue Zipper
+24
Transparent PVC Loose Leaf Binder Pockets Zipper Bags Card Holders And Soft Rulers For Notebook
$0.07-0.57
No MOQ
 · 
621 sold recently
Heart Shaped Paper Clips PET Coated Metal Colorful Bookmarks Decorative Document Clips For Office School Supplies
Heart Shaped Paper Clips PET Coated Metal Colorful Bookmarks Decorative Document Clips For Office School Supplies
like
Find Similar
Grass green heart shaped metal paperclip bookmark for creative stationery and office use - Fruit Green
Yellow double heart shaped metal paperclip and bookmark for creative stationery - Yellow
Blue heart-shaped metal paperclip shown in a minimalist center view on white background - Lake Blue
Creative orange heart-shaped paperclip made of premium colored metal wire - Orange
+11
Heart Shaped Paper Clips PET Coated Metal Colorful Bookmarks Decorative Document Clips For Office School Supplies
$0.03
Mix MOQ : 10
 · 
15K+ sold recently
Top 10% Best Sellers
in Desk Accessories
Vintage Retro Stationery Gift Scrapbooking Supplies Notebook Washi Tape PET Stickers Material Paper Artistic Journaling Decoration
Vintage Retro Stationery Gift Scrapbooking Supplies Notebook Washi Tape PET Stickers Material Paper Artistic Journaling Decoration
like
Find Similar
Vintage 'Art Guide' stationery gift set with stickers and tape in a brown gift box - Art Guide - 125 Pcs Set
Butterfly Garden vintage gift box set with deep blue stationery and butterfly patterns - Butterfly Garden - 125 Pcs Set
Vintage mushroom theme stationery gift set with washi tapes and memo pads - Mushroom Chronology - 125 Pcs Set
Green leaf vintage stationery gift box set with washi tapes and botanical stickers - Green Leaf - 125 Pcs Set
Vintage Retro Stationery Gift Scrapbooking Supplies Notebook Washi Tape PET Stickers Material Paper Artistic Journaling Decoration
-9%
$4.36
No MOQ
 · 
21 sold recently
Botanical Park Macaron Stationery Kit Including Mini Calculator Gel Pens Paperclips Binder Clips For Student Office Supplies Pink Green Purple Gift Decor
Botanical Park Macaron Stationery Kit Including Mini Calculator Gel Pens Paperclips Binder Clips For Student Office Supplies Pink Green Purple Gift Decor
like
Find Similar
Pink stationery set with mini calculator, pens, and paper clips in macaron colors - Sakura Pink
All-in-one purple stationery gift set including a mini calculator, pens, and clips - Lavender
Mint green Botanical Park stationery gift set with calculator, pens, and clips - Mint Green
Botanical Park Macaron Stationery Kit Including Mini Calculator Gel Pens Paperclips Binder Clips For Student Office Supplies Pink Green Purple Gift Decor
$4.18
Mix MOQ : 2
 · 
14 sold recently
Shaped Paper Clips Candy Color Plastic Coated Metal Wire Creative Bookmarks For Office School Students With Storage Bag
Shaped Paper Clips Candy Color Plastic Coated Metal Wire Creative Bookmarks For Office School Students With Storage Bag
like
Find Similar
Planet-shaped colorful metal paper clips in pastel colors with clear slide lock bag - Planet (10Pcs/Pack)
Set of ten colorful heart-shaped metal paperclips in a clear pouch for office stationery - Heart (10Pcs/Pack)
Star shaped macaron color paper clips in a transparent bag with white ring hook - Star (10Pcs/Pack)
Pony-shaped metal paper clips in macaron colors with a clear zipper storage bag - Horse (10Pcs/Pack)
+3
Shaped Paper Clips Candy Color Plastic Coated Metal Wire Creative Bookmarks For Office School Students With Storage Bag
-4%
$0.58
No MOQ
 · 
428 sold recently
Top 10% Best Sellers
in Office Binding Supplies
Portable Mini Coloring Books Cartoon Animal Theme Graffiti Paper Painting Notebooks For Kids Toddlers Educational Toys
Portable Mini Coloring Books Cartoon Animal Theme Graffiti Paper Painting Notebooks For Kids Toddlers Educational Toys
like
Find Similar
Mini animal theme coloring book for kids with squirrel cover and 25 cartoon doodle pages - Cute Animal
Mini 10x10cm ocean theme graffiti coloring book set with 25 unique mystery sea patterns - Mysterious Ocean
Mini children's coloring book with food theme and 25 unique snack illustrations - Life Food
Mini unicorn watercolor coloring book for kids with 25 romantic fairytale pages - Romantic Fairy Tales
Portable Mini Coloring Books Cartoon Animal Theme Graffiti Paper Painting Notebooks For Kids Toddlers Educational Toys
$0.55
No MOQ
 · 
916 sold recently
Top 3% Best Sellers
in School & Educational Supplies
Quilted PU Leather Pencil Case Large Capacity Zippered Pen Pouch With Handle Macaron Color Stationery Organizer
Quilted PU Leather Pencil Case Large Capacity Zippered Pen Pouch With Handle Macaron Color Stationery Organizer
like
Find Similar
Detail of vertical quilted texture and leather patch on cream large capacity pencil case - Off White
Detail of mint green quilted pencil case with side handle and Good Fortune leather patch - Matcha Green
Detail of pink faux leather pencil case featuring vertical stitching and side handle strap - Sakura Pink
Detail of light blue quilted pencil case with fabric handle and leather label - Sky Blue
Quilted PU Leather Pencil Case Large Capacity Zippered Pen Pouch With Handle Macaron Color Stationery Organizer
$1.87
Mix MOQ : 2
 · 
12 sold recently
Outline Markers Metallic Silver Color Pens Water Based Ink For DIY Scrapbooking Greeting Cards Drawing Painting
Outline Markers Metallic Silver Color Pens Water Based Ink For DIY Scrapbooking Greeting Cards Drawing Painting
like
Find Similar
Set of 12 vibrant double line outline markers for creative DIY drawing and journaling - Shield 12 Colors Set
Set of 8 colorful outline markers in a transparent storage case for DIY greeting cards - White Barrel 8 Colors Set
Set of 12 colors double line outline markers for DIY greeting cards and drawing - White Barrel 12 Colors Set
24-color glitter double line outline markers set with 1-2mm tip for DIY drawing - White Barrel 1109-24
+5
Outline Markers Metallic Silver Color Pens Water Based Ink For DIY Scrapbooking Greeting Cards Drawing Painting
$1.66-11.48
No MOQ
 · 
57 sold recently
Top 10% Best Sellers
in Writing & Correction Supplies
Stationery Combination Binder Clips Paper Clips Push Pins With Transparent Round Divided Box Metal Office School Supplies
Stationery Combination Binder Clips Paper Clips Push Pins With Transparent Round Divided Box Metal Office School Supplies
like
Find Similar
Pink office stationery set with paper clips and binder clips in 100mm storage box - Pink
Purple macaron stationery set with binder clips and push pins in a round organizer - Purple
Mint green multifunctional stationery set with paper clips and push pins in a round box - Green
Rose gold office set with binder clips and paper clips in a round organizer box - Rose Gold
+4
Stationery Combination Binder Clips Paper Clips Push Pins With Transparent Round Divided Box Metal Office School Supplies
-5%
$0.90-1.10
Mix MOQ : 2
 · 
80 sold recently
Silicone Pencil Case DIY Hole Design Portable Stationery Storage Bag Cute Decorative Charms For Students
Silicone Pencil Case DIY Hole Design Portable Stationery Storage Bag Cute Decorative Charms For Students
like
Find Similar
Set of 4 colorful PVC dinosaur shoe charms in a transparent protective bag - DIY Shoe Charms - Dinosaur Series
DIY silicone pencil case with unicorn and star cartoon charms in a clear pouch - DIY Shoe Charms - Unicorn Series
DIY silicone pencil case charm set with 4 cartoon ocean creatures in a clear polybag - DIY Shoe Charms - Ocean Series
Pink and purple gradient silicone pencil case with perforated design and zipper - Small / Rainbow Purple
+19
Silicone Pencil Case DIY Hole Design Portable Stationery Storage Bag Cute Decorative Charms For Students
-4%
$0.22-2.18
No MOQ
 · 
1K+ sold recently
Cartoon Milk Box Pencil Case PU Leather Stationery Bag For Students Cute Portable Storage Organizer Strawberry Banana
Cartoon Milk Box Pencil Case PU Leather Stationery Bag For Students Cute Portable Storage Organizer Strawberry Banana
like
Find Similar
3 options
Cartoon Milk Box Pencil Case PU Leather Stationery Bag For Students Cute Portable Storage Organizer Strawberry Banana
-3%
$0.52
Mix MOQ : 2
 · 
268 sold recently
Mesh Pencil Bag Transparent Nylon Zipper Pouch Large Capacity Minimalist Stationery Organizer For Student School Exam Office
Mesh Pencil Bag Transparent Nylon Zipper Pouch Large Capacity Minimalist Stationery Organizer For Student School Exam Office
like
Find Similar
Minimalist white mesh zipper pencil case with high capacity and portable design - White / A6 (20.5x11.5cm)
Detail view of the 205x110mm grey mesh pencil case with zip closure and rope puller - Gray / A6 (20.5x11.5cm)
Minimalist black mesh pencil case with zip closure for large capacity storage - Black / A6 (20.5x11.5cm)
+2
Mesh Pencil Bag Transparent Nylon Zipper Pouch Large Capacity Minimalist Stationery Organizer For Student School Exam Office
$0.27-0.43
Mix MOQ : 10
 · 
7K+ sold recently
Top 10% Best Sellers
in Desktop Storage & Pencil Cases
Van Gogh Impressionist Art Style Clipboard MDF Wood Writing Board With Metal Clip For Office School Students
Van Gogh Impressionist Art Style Clipboard MDF Wood Writing Board With Metal Clip For Office School Students
like
Find Similar
A4 wooden clipboard with Van Gogh oil painting print and silver metal spring clip - Positano Night View
A4 wooden clipboard featuring Van Gogh oil painting print with silver metal clip - Houses at Auvers
A4 wooden clipboard with Van Gogh style oil painting design and white reverse side - Double-sided White and Green Wheat Field
Artistic A4 clipboard with Van Gogh oil painting and strong silver metal clip for office - Path Through The Ravine
+5
Van Gogh Impressionist Art Style Clipboard MDF Wood Writing Board With Metal Clip For Office School Students
-4%
$0.71
No MOQ
 · 
22 sold recently
Easy Coloring Book Simple Bold Lines Patterns Stress Relief Relaxing Drawing For Kids Teens Adults Offset Paper
Easy Coloring Book Simple Bold Lines Patterns Stress Relief Relaxing Drawing For Kids Teens Adults Offset Paper
like
Find Similar
Fashion Vibes coloring book with 52 pages of stylish illustrations for adults and teens - Fashion Vibes (TH02)
Detailed view of the Stress Relief coloring book cover featuring cute cartoon illustrations - Stress Relief (TH03)
Cozy & Cute coloring book with 52 simple illustrations for adults and teens - Cozy & Cute (TH04)
Detailed cover of Food Drink & Sweets easy coloring book with cute cartoon dessert icons - Food Drink & Sweets (TH05)
+4
Easy Coloring Book Simple Bold Lines Patterns Stress Relief Relaxing Drawing For Kids Teens Adults Offset Paper
$2.31
Mix MOQ : 2
 · 
83 sold recently
Acrylic Binder Clips Colorful Funny Cartoon Expression Paper Clamps For School Office Cute Stationery Decor
Acrylic Binder Clips Colorful Funny Cartoon Expression Paper Clamps For School Office Cute Stationery Decor
like
Find Similar
Close-up of red acrylic binder clip with a funny cartoon expression on notebook paper - Double Clip / Red
Close-up of yellow acrylic binder clip with funny face emoji on notebook paper - Double Clip / Yellow
Close-up of light green acrylic paper clip with sad emoji on a lined paper background - Double Clip / Blue
Close-up of green acrylic paper clip with sad emoji face on a dotted notebook - Double Clip / Green
+8
Acrylic Binder Clips Colorful Funny Cartoon Expression Paper Clamps For School Office Cute Stationery Decor
$0.11-0.17
No MOQ
 · 
1K+ sold recently
Fineliner Color Pens Fine Tip Assorted Colors Non Toxic For Drawing Sketching Adult Coloring Journaling
Fineliner Color Pens Fine Tip Assorted Colors Non Toxic For Drawing Sketching Adult Coloring Journaling
like
Find Similar
Set of 48 color 0.4mm fineliner pens in black barrels for detailed drawing - 48 Colors Set
12 colors 0.4mm fineliner color pen set in PVC bag for drawing and sketching - 12-Color Set
24-color 0.4mm fine tip watercolor fineliners set in a clear PVC pouch on a wooden desk - 24 Colors Set
36 color fineliner pen set with 0.4mm tips displayed on desk with a notebook - 36 Colors Set
+4
Fineliner Color Pens Fine Tip Assorted Colors Non Toxic For Drawing Sketching Adult Coloring Journaling
$1.04-8.65
No MOQ
 · 
54 sold recently
Top 5% Best Sellers
in Art Supplies
Retractable Gel Pen Macaron Candy Color Matte Plastic Quick Dry Smooth Writing School Office Supplies Student Stationery
Retractable Gel Pen Macaron Candy Color Matte Plastic Quick Dry Smooth Writing School Office Supplies Student Stationery
like
Find Similar
Vibrant orange retractable ballpoint pen in plastic with Gentleman logo on white background - 1.0mm/Ballpoint Core / Orange
Matte magenta retractable gel pen with clip for office and student stationery - 1.0mm/Ballpoint Core / Rose Red
Elegant black macaron retractable gel pen with clip shown on white background - 1.0mm/Ballpoint Core / Black
Green retractable macaron gel pen with minimalist clip on a clean white background - 1.0mm/Ballpoint Core / Green
+54
Retractable Gel Pen Macaron Candy Color Matte Plastic Quick Dry Smooth Writing School Office Supplies Student Stationery
$0.09-0.86
Mix MOQ : 2
 · 
5K+ sold recently
Top 3% Best Sellers
in Writing & Correction Supplies
Cute Cartoon Quicksand Gel Pen With Sequins Liquid Flowing Plastic Black Ink Sign Pen For School Office Stationery
Cute Cartoon Quicksand Gel Pen With Sequins Liquid Flowing Plastic Black Ink Sign Pen For School Office Stationery
like
Find Similar
Sparkly light blue liquid quicksand pen with butterfly topper and glitter sequins - Butterfly Blue
Pink sequin liquid glitter gel pen with a crescent moon topper and 100% Girly print - Moon Pink
Blue glitter liquid sand pen with star and moon sequins and a moon topper - Moon Blue
Yellow liquid sand gel pen with blue star sequins and moon decoration on white desk - Moon Yellow
+13
Cute Cartoon Quicksand Gel Pen With Sequins Liquid Flowing Plastic Black Ink Sign Pen For School Office Stationery
-4%
$0.21
Mix MOQ : 2
 · 
2K+ sold recently
DIY Beaded Ballpoint Pen With Rhinestones Metal Twist Pen For Office School Stationery Supplies Creative Rhinestone Gift Pen
DIY Beaded Ballpoint Pen With Rhinestones Metal Twist Pen For Office School Stationery Supplies Creative Rhinestone Gift Pen
like
Find Similar
DIY beadable pens set in assorted metallic glitter colors with sparkling rhinestone finish - Full Rhinestone Beaded Style (0087) / Purple
Five sparkling red rhinestone beaded pens on a minimalist white marble background - Full Rhinestone Beaded Style (0087) / Red
Detailed view of yellow glitter beaded pens with silver metal finish on marble background - Full Rhinestone Beaded Style (0087) / Yellow
Pink DIY rhinestone pens in a set of five with shiny metal barrels on a desk - Full Rhinestone Beaded Style (0087) / Pink
+8
DIY Beaded Ballpoint Pen With Rhinestones Metal Twist Pen For Office School Stationery Supplies Creative Rhinestone Gift Pen
$0.81
Mix MOQ : 10
 · 
1K+ sold recently
Top 3% Best Sellers
in Writing & Correction Supplies
Large Capacity Transparent PVC Pencil Case Waterproof Stationery Storage Bag With Metal Snap Buttons For Students Office
Large Capacity Transparent PVC Pencil Case Waterproof Stationery Storage Bag With Metal Snap Buttons For Students Office
like
Find Similar
Clear PVC stationery bag with pink reinforced edges and silver snap buttons - Water Pink
Clear PVC stationery bag with light blue woven edges and silver metal snaps - Blue
Clear large capacity waterproof pencil case with off-white canvas trim and snap closure - Beige
Clear waterproof pencil pouch with mint green trim and metal snap buttons - Mint Green
Large Capacity Transparent PVC Pencil Case Waterproof Stationery Storage Bag With Metal Snap Buttons For Students Office
-4%
$0.69
Mix MOQ : 2
 · 
19 sold recently
Coloring Book Bold And Easy Food Fruit Animals Cartoon Drawings For Kids And Adults Stress Relief Relaxation
Coloring Book Bold And Easy Food Fruit Animals Cartoon Drawings For Kids And Adults Stress Relief Relaxation
like
Find Similar
Winter Paradise coloring book for kids with bold and easy hand-drawn cartoon illustrations - Winter Paradise (TS04-Winter Paradise)
Pair of Wonderful Insects coloring books with bold and easy cartoon insect illustrations - Insect (TS04-Insect)
Cute Little Den Bold and Easy food and cartoon coloring book for kids with 40 pages - Cute Little Den (TS04-Cute Little Den)
Cozy Corner Bold & Easy coloring book with warm cartoon room scenes on a white desk - Cozy Corner (TS04-Cozy Corner)
+40
Coloring Book Bold And Easy Food Fruit Animals Cartoon Drawings For Kids And Adults Stress Relief Relaxation
$2.05
No MOQ
 · 
127 sold recently
Creative Realistic Feather Shaped Gel Pen Metallic Luster Plastic Writing Tool For Office School Stationery Gift
Creative Realistic Feather Shaped Gel Pen Metallic Luster Plastic Writing Tool For Office School Stationery Gift
like
Find Similar
Elegant gold metal feather shape rollerball pen resting on a light blue gift box - 0.5mm / Gold
Creative realistic matte silver feather shaped gel pen on light blue gift box background - 0.5mm / Silver
Creative blue metal feather gel pen with fine texture on elegant gift box background - 0.5mm / Blue
Creative pink metallic feather pen displayed on a blue base for student gift - 0.5mm / Red
+2
Creative Realistic Feather Shaped Gel Pen Metallic Luster Plastic Writing Tool For Office School Stationery Gift
$0.22
No MOQ
 · 
5K+ sold recently
Top 5% Best Sellers
in Writing & Correction Supplies
Pencil Case Quilted Checkered Cotton Fabric Bow Print Large Capacity Stationery Organizer Pouch For Students Cute Ins Style
Pencil Case Quilted Checkered Cotton Fabric Bow Print Large Capacity Stationery Organizer Pouch For Students Cute Ins Style
like
Find Similar
Detail of yellow checkered quilted pencil case with pink bow embroidery and zipper - Yellow
Detailed view of blue checkered quilted pencil case with pink bows and brand label - Blue
Detailed view of red plaid quilted pencil case with blue bow pattern and zip closure - Rose Red
Detail of quilted plaid pencil case with pink bow prints and brand label on a desk - Purple
Pencil Case Quilted Checkered Cotton Fabric Bow Print Large Capacity Stationery Organizer Pouch For Students Cute Ins Style
$1.59
Mix MOQ : 3
 · 
70 sold recently
Retractable Correction Tape And Refill Plastic PET Film Press Type Replaceable Core Portable Smooth For Students Office Macaron
Retractable Correction Tape And Refill Plastic PET Film Press Type Replaceable Core Portable Smooth For Students Office Macaron
like
Find Similar
Press-type correction tape refill 5mm x 6m PET film for student school office stationery - Refill / White
Purple retractable correction tape pen with 6m length and 5mm width for students - Cream Tape Core / Purple
Pink retractable correction tape dispenser 5mm x 6m with PET film and internal mechanism - Cream Tape Core / Pink
Retractable correction tape pen in white and gray plastic casing with 6m PET tape refill - Cream Tape Core / Gray
+6
Retractable Correction Tape And Refill Plastic PET Film Press Type Replaceable Core Portable Smooth For Students Office Macaron
-6%
$0.31-0.67
No MOQ
 · 
159 sold recently
Stereo Cartoon Animal Bookmarks Cute Acrylic Cat Dog Shark Shape Creative Page Markers For Students Office Reading
Stereo Cartoon Animal Bookmarks Cute Acrylic Cat Dog Shark Shape Creative Page Markers For Students Office Reading
like
Find Similar
3D cartoon cat bookmark with big eyes and sharp teeth in black minimalist animal style - Cat Bookmark / Black
Creative black octopus shaped multi-hook wall hanger, size 8cm high by 9.2cm wide - Octopus Bookmark / Black
3D cartoon whale silhouette bookmark in black finish with dimensions 9cm by 8.4cm - Shark Bookmark / Black
Dimensions of cute black fishbone cat bookmark showing 11cm height and 4.8cm width - Fishbone Bookmark / Black
+3
Stereo Cartoon Animal Bookmarks Cute Acrylic Cat Dog Shark Shape Creative Page Markers For Students Office Reading
-7%
$0.12-0.14
Mix MOQ : 5
 · 
738 sold recently
Top 10% Best Sellers
in Labels, Indexes & Stamps
Resin Thumb Page Holder Bookmark Portable Reading Support Accessory For One Handed Reading Marble Texture Design
Resin Thumb Page Holder Bookmark Portable Reading Support Accessory For One Handed Reading Marble Texture Design
like
Find Similar
Pink resin thumb book holder for reading assistance with smooth marble texture finish - Medium Purple
Creative thumb book holder in dark green marble resin for comfortable reading support - Emerald Green
Macro view of brown resin thumb page holder with amber texture on white stone stand - Coffee
Macro shot of grey marble resin thumb page holder on a white platform with soft lighting - Olive Green
+2
Resin Thumb Page Holder Bookmark Portable Reading Support Accessory For One Handed Reading Marble Texture Design
-5%
$1.31
No MOQ
 · 
708 sold recently
Top 3% Best Sellers
in Labels, Indexes & Stamps
Free Shipping
Portable Retractable Ballpoint Pen Aluminum Alloy Carabiner Clip Metal Pull Cord Easy Reach Stationery For Nurses Students
Portable Retractable Ballpoint Pen Aluminum Alloy Carabiner Clip Metal Pull Cord Easy Reach Stationery For Nurses Students
like
Find Similar
Retractable badge reel set with 8 vibrant colors and metal clip on wooden background - Retractable Badge Reel / Blue
Multicolor aluminum D-ring carabiners in a sequence of eight vibrant metallic finishes - Aluminum Alloy Carabiner / Red
Retractable green ballpoint pen with metal carabiner and soft grip for outdoor use - Retractable Ballpoint Pen / Green
Blue retractable ballpoint pen with carabiner and soft grip for outdoor or office use - Retractable Ballpoint Pen / Blue
+14
Portable Retractable Ballpoint Pen Aluminum Alloy Carabiner Clip Metal Pull Cord Easy Reach Stationery For Nurses Students
$0.05-0.39
No MOQ
 · 
718 sold recently
Gradient Color Resin Correction Tape Minimalist Creative School Stationery Tape Smooth Silent Tape For Student Office Use
Gradient Color Resin Correction Tape Minimalist Creative School Stationery Tape Smooth Silent Tape For Student Office Use
like
Find Similar
Detailed view of 6 gradient pink correction tapes on an acrylic stand with stationery background - Set of 6 / Gradient Pink
Gradient blue correction tape set of 6 items on a desk display stand for office use - Set of 6 / Gradient Blue
Set of 6 gradient green correction tapes with good luck text for school and office - Set of 6 / Gradient Green
7-piece set of gradient purple correction tapes with sleek 3D textured casing - Set of 6 / Gradient Purple
Gradient Color Resin Correction Tape Minimalist Creative School Stationery Tape Smooth Silent Tape For Student Office Use
$1.38
Mix MOQ : 2
 · 
715 sold recently
Top 3% Best Sellers
in Writing & Correction Supplies
Plaid Canvas Pencil Case Large Capacity Zipper Stationery Pouch Minimalist Korean Style School Desk Organizer Students
Plaid Canvas Pencil Case Large Capacity Zipper Stationery Pouch Minimalist Korean Style School Desk Organizer Students
like
Find Similar
Close-up of blue plaid canvas pencil case with zipper on pink background with roses - Blue & White Plaid
Detail of blue and yellow plaid canvas pencil case with zipper on a pink background - Blue and Yellow Scottish Plaid
Macro detail of plaid canvas pencil case showing the zipper and green checkered pattern - Green White and Blue Plaid
Detailed top view of a pink and blue checkered canvas pouch with white zipper closure - Pink Blue Plaid
+4
Plaid Canvas Pencil Case Large Capacity Zipper Stationery Pouch Minimalist Korean Style School Desk Organizer Students
-5%
$0.52
Mix MOQ : 5
 · 
33 sold recently
Cute Panda Bamboo Pattern Correction Tape Smooth Gradient Color Large Capacity Correction Tool For Student Stationery Office Supply
Cute Panda Bamboo Pattern Correction Tape Smooth Gradient Color Large Capacity Correction Tool For Student Stationery Office Supply
like
Find Similar
6-pack matcha green gradient correction tape set in storage pouch - 6 Pcs/Set / Matcha Green
Large capacity blue gradient correction tape set 6-pack for school and office use - 6 Pcs/Set / Ocean Blue
Set of 6 premium gradient rose pink correction tapes in a clear PVC storage pouch - 6 Pcs/Set / Rose Pink
Gradient purple correction tape 6-pack in clear pouch, total 36m length for students - 6 Pcs/Set / Dreamy Purple
+8
Cute Panda Bamboo Pattern Correction Tape Smooth Gradient Color Large Capacity Correction Tool For Student Stationery Office Supply
$0.04-1.12
No MOQ
 · 
429 sold recently
Cute Canvas Pencil Case Pink Bow Embroidery Zippered Pouch School Office Supplies Makeup Storage Bag Sweet Aesthetic
Cute Canvas Pencil Case Pink Bow Embroidery Zippered Pouch School Office Supplies Makeup Storage Bag Sweet Aesthetic
like
Find Similar
Black canvas pencil case with pink bow embroidery and a decorative bow charm - Black With Bowknot Embroidery
Cute Canvas Pencil Case Pink Bow Embroidery Zippered Pouch School Office Supplies Makeup Storage Bag Sweet Aesthetic
$1.15
No MOQ
 · 
37 sold recently
Reversible Sequin Pencil Case Mermaid Glitter Storage Bag Zipper Closure Stationery Organizer For Students School Supplies
Reversible Sequin Pencil Case Mermaid Glitter Storage Bag Zipper Closure Stationery Organizer For Students School Supplies
like
Find Similar
Rainbow mermaid sequin pencil case with DIY flip sequins and zipper closure pouch - Rainbow
Pink and white mermaid sequin pencil case with holographic finish for student stationery - Pink
Mermaid flip sequin pencil case with heart zipper and rainbow glitter pattern - Iridescent
Rectangular mermaid pencil case featuring reversible purple and green sequins and black zip - Holographic Multicolor
+3
Reversible Sequin Pencil Case Mermaid Glitter Storage Bag Zipper Closure Stationery Organizer For Students School Supplies
$0.81
No MOQ
 · 
284 sold recently
Top 5% Best Sellers
in Desktop Storage & Pencil Cases
Laser Holographic PVC Pencil Case Glitter Transparent Stationery Bag Snap Button Waterproof Foldable Organizer For School
Laser Holographic PVC Pencil Case Glitter Transparent Stationery Bag Snap Button Waterproof Foldable Organizer For School
like
Find Similar
Detail of laser transparent PVC pencil case with glitter effect and snap closures - Glittery White
Macro detail of pink glitter PVC stationery pouch with a functional snap button closure - Glitter Pink
Macro view of pink glitter laser pencil case with snap button closure and PVC material - Glitter Purple
Detail of teal glitter stationery pouch with snap closure and iridescent translucent finish - Glittery Blue
+3
Laser Holographic PVC Pencil Case Glitter Transparent Stationery Bag Snap Button Waterproof Foldable Organizer For School
-4%
$0.77
Mix MOQ : 2
 · 
549 sold recently
Plush Pencil Case Checkerboard Faux Fur Stationery Bag Large Capacity Zippered Makeup Storage Organizer For Students
Plush Pencil Case Checkerboard Faux Fur Stationery Bag Large Capacity Zippered Makeup Storage Organizer For Students
like
Find Similar
Close-up of pink plush pencil case with mesh texture and premium metal zipper detail - Pink
Macro shot of dark grey plush pencil case with textured square pattern and metal zipper - Gray
Creamy beige plush checkerboard pencil case with large capacity and soft texture - Beige
Close-up of brown plaid plush pencil case showing soft faux fur texture and metal zipper - Khaki
+1
Plush Pencil Case Checkerboard Faux Fur Stationery Bag Large Capacity Zippered Makeup Storage Organizer For Students
$1.96
No MOQ
 · 
131 sold recently
Cute Cat Plush Pencil Case Large Capacity Zippered Gradient Tie Dye Student Stationery Organizer For Girls
Cute Cat Plush Pencil Case Large Capacity Zippered Gradient Tie Dye Student Stationery Organizer For Girls
like
Find Similar
Pink plush cat pencil case with 3D ears and embroidery, cute cartoon stationery pouch - Pure Pink
Gradient purple and blue plush cat pencil case with embroidered face and 3D ears - Purple Multi
Plush cat pencil case with macaron gradient fur and sequined ears on display stand - Pink Multi
Pink plush cat pencil case with blue embroidered eyes and fuzzy ears for students - Rose Gold Rainbow
Cute Cat Plush Pencil Case Large Capacity Zippered Gradient Tie Dye Student Stationery Organizer For Girls
-5%
$1.23
Mix MOQ : 3
 · 
58 sold recently
Aesthetic Morandi Colors Gel Pens Plastic 0.5mm Black Ink Writing Drawing Stationery School Office Supplies Students Gift
Aesthetic Morandi Colors Gel Pens Plastic 0.5mm Black Ink Writing Drawing Stationery School Office Supplies Students Gift
like
Find Similar
Morandi gel pen set with 6 pens in pastel pink, white and purple tones - Purple Series (R694A) / 0.5mm
Set of 6 Morandi gradient pink pens with cute cartoon animals in a transparent gift box - Pink Series (R694A) / 0.5mm
Morandi color gel pen set with 6 pens in macaron gradient tones for office and school - Green Series (R694A) / 0.5mm
Set of 6 Morandi color neutral pens in warm yellow and orange tones with transparent case - Orange Series (R694A) / 0.5mm
+6
Aesthetic Morandi Colors Gel Pens Plastic 0.5mm Black Ink Writing Drawing Stationery School Office Supplies Students Gift
$0.56
No MOQ
 · 
666 sold recently
Top 10% Best Sellers
in Writing & Correction Supplies
Retractable Gel Pens 0.5mm Black Ink Bullet Tip Quick Drying Macaron Morandi Colors Soft Rubber Grip Office Stationery
Retractable Gel Pens 0.5mm Black Ink Bullet Tip Quick Drying Macaron Morandi Colors Soft Rubber Grip Office Stationery
like
Find Similar
Macaron mint green retractable ballpoint pen with comfortable white plastic barrel - 0.5mm / Mint Green
Retractable ballpoint pen with ergonomic cream yellow grip and clean white barrel - 0.5mm / Creamy Yellow
Retractable Macaron series gel pen with pink soft rubber grip and white barrel - 0.5mm / Sakura Pink
Morandi white and grey retractable ballpoint pen with anti-slip grip for stationery - 0.5mm / Athens Grey
+1
Retractable Gel Pens 0.5mm Black Ink Bullet Tip Quick Drying Macaron Morandi Colors Soft Rubber Grip Office Stationery
$0.16-0.79
No MOQ
 · 
310 sold recently
Top 10% Best Sellers
in Writing & Correction Supplies
Large Capacity Pencil Case Nylon Macaron Contrast Zipper Stationery Pouch Portable Desktop Organizer For Students
Large Capacity Pencil Case Nylon Macaron Contrast Zipper Stationery Pouch Portable Desktop Organizer For Students
like
Find Similar
Detail of yellow macaron stationery bag with pink zipper and woven label on a desk - Lemon Yellow
Close-up of lavender nylon stationery bag with yellow zipper and brand patch detail - Light Purple
Detailed close-up of mint green macaron stationery pouch with simple woven label - Mint Green
Pink fabric pencil case with blue zipper and white woven label in a desk lifestyle setting - Pink
+3
Large Capacity Pencil Case Nylon Macaron Contrast Zipper Stationery Pouch Portable Desktop Organizer For Students
-5%
$1.89
No MOQ
 · 
26 views
Creative Simulation Flower Gel Pens Silicone Stem Fabric Rose Sunflower Head Rollerball Pens Black Ink Office School Gift
Creative Simulation Flower Gel Pens Silicone Stem Fabric Rose Sunflower Head Rollerball Pens Black Ink Office School Gift
like
Find Similar
Creative 0.5mm daisy flower silicone ballpoint pens in a colorful 32pcs display box - Lotus Chrysanthemum-Black Ink
Detailed view of 0.5mm creative silicone pens with colorful fabric flower tops - Tea Bag Flower-Black Ink
Creative rose-shaped silicone gel pen with 0.5mm black ink and soft pink floral design - Wheat Autumn Chrysanthemum-Black Ink
Close-up of creative plush flower pens in a pink cat paw holder with premium gift box - Small Peony-Black Ink
+30
Creative Simulation Flower Gel Pens Silicone Stem Fabric Rose Sunflower Head Rollerball Pens Black Ink Office School Gift
$0.52
Mix MOQ : 2
 · 
1K+ sold recently
Top 10% Best Sellers
in Writing & Correction Supplies
Stationery Organizer Box With Macaron Paper Clips Binder Clips And Push Pins For Desktop Office School Supplies Gold Metal
Stationery Organizer Box With Macaron Paper Clips Binder Clips And Push Pins For Desktop Office School Supplies Gold Metal
like
Find Similar
Pastel macaron stationery set including gold binder clips and pins in a divided storage box - 7749 Set (28mm Clips+Push Pins+50mm Clips+Round Clips) / Mint Green
Pastel pink, mint, and purple stationery sets with gold binder clips and paperclips - 7748 Set (28mm/50mm Paper Clips + 19mm/25mm Binder Clips) / Sakura Pink
Morandi macaron stationery set with gold binder clips and paperclips in clear box - 7750 Set (Paper Clips + Thumbtacks + 25mm/19mm Binder Clips) / Sakura Pink
Pastel macaron stationery set with gold clips and pins in pink, blue, and purple cases - 7751 Set (28mm Clips + Push Pins + 25mm/19mm Binder Clips) / Sakura Pink
+11
Stationery Organizer Box With Macaron Paper Clips Binder Clips And Push Pins For Desktop Office School Supplies Gold Metal
-5%
$2.52-2.85
No MOQ
 · 
65 sold recently
Large Capacity Plush Pencil Case Heart Quilted Soft Furry Stationary Bag For Students School Office Korean Style
Large Capacity Plush Pencil Case Heart Quilted Soft Furry Stationary Bag For Students School Office Korean Style
like
Find Similar
Detail of cream plush quilted pencil case showing soft heart pattern and smooth zipper - White
Blue plush pencil case with cloud quilting and pink zipper on a cozy desk setup - Blue
Close-up of pink plush pencil case with cloud patterns on a minimalist white desk - Pink
Large Capacity Plush Pencil Case Heart Quilted Soft Furry Stationary Bag For Students School Office Korean Style
-4%
$1.15
Mix MOQ : 2
 · 
47 views
HB Pencils Macaron Color Triangular Barrel Wooden Graphite Writing Drawing Eraser Top School Office Stationary
HB Pencils Macaron Color Triangular Barrel Wooden Graphite Writing Drawing Eraser Top School Office Stationary
like
Find Similar
Pastel purple HB pencils with pink erasers, 8-pack set in a minimalist stationery layout - Purple / HB
Set of 7 yellow macaron HB pencils with matching erasers on a minimalist background - Yellow / HB
Set of 8 sky blue HB pencils with ergonomic triangular grip and light blue erasers - Blue / HB
Set of 10 pink HB triangular pencils with pink erasers on minimalist stationery background - Pink / HB
+2
HB Pencils Macaron Color Triangular Barrel Wooden Graphite Writing Drawing Eraser Top School Office Stationary
$0.07
No MOQ
 · 
7K+ sold recently
Top 5% Best Sellers
in Writing & Correction Supplies
Quilted Pencil Case Polyester Gingham Cherry Print Stationery Storage Bag Cute Zippered Pouch For Students
Quilted Pencil Case Polyester Gingham Cherry Print Stationery Storage Bag Cute Zippered Pouch For Students
like
Find Similar
Detail of red cherry print on gingham fabric pencil case with Colorful logo tag - Red
Detail of pink plaid quilted fabric case with cherry prints and zip closure - Pink
Detail of quilted cherry pattern pencil case with red zipper and black plaid fabric - Black
Detail shot of blue gingham quilted pencil case with cherry print and Colorful woven label - Sky Blue
+1
Quilted Pencil Case Polyester Gingham Cherry Print Stationery Storage Bag Cute Zippered Pouch For Students
$1.38
No MOQ
 · 
13 sold recently
Retro French PU Leather Pencil Case Minimalist S-Shape Makeup Brush Storage Bag Portable Multi-Color Travel Pen Organizer
Retro French PU Leather Pencil Case Minimalist S-Shape Makeup Brush Storage Bag Portable Multi-Color Travel Pen Organizer
like
Find Similar
Detail view of pink leather stationery pouch with gold zipper and carrying strap - Pink
Close-up of black PU leather stationery pouch with a curved gold zipper and carry strap - Black
Detail view of grey litchi grain PU leather pen case with gold zipper and hand strap - Gray
Detail of mint green lychee textured faux leather pencil case with golden zipper - Green
+1
Retro French PU Leather Pencil Case Minimalist S-Shape Makeup Brush Storage Bag Portable Multi-Color Travel Pen Organizer
$1.41
Mix MOQ : 2
 · 
14 sold recently
Retractable Gel Pens Macaron Morandi Aesthetic Colors Black Ink Sign Pens Minimalist Plastic Stationery Office School
Retractable Gel Pens Macaron Morandi Aesthetic Colors Black Ink Sign Pens Minimalist Plastic Stationery Office School
like
Find Similar
Set of two matte pink retractable gel pens in a minimalist design for school or office - Light Pink
Pair of Morandi yellow retractable gel pens on an open book for school or office - Light Yellow
Set of two minimalist green retractable gel pens for office and student exams - Light Green
Set of two light blue Morandi retractable gel pens on a desk with vintage stationery - Light Blue
+16
Retractable Gel Pens Macaron Morandi Aesthetic Colors Black Ink Sign Pens Minimalist Plastic Stationery Office School
$0.07
Mix MOQ : 2
 · 
4K+ sold recently
Top 10% Best Sellers
in Writing & Correction Supplies
Mini Highlighters Plastic Creative Cartoon Shape Fluorescent Markers Portable School Office Stationery Student Gift
Mini Highlighters Plastic Creative Cartoon Shape Fluorescent Markers Portable School Office Stationery Student Gift
like
Find Similar
Set of 6 mini pill-shaped highlighters in pastel colors with cute smiley face clips - Smiley Face
6-piece lollipop shaped highlighters set in a clear zipper bag for student gifts - Lollipop
Mini pill-shaped 6-color highlighter set with space astronaut theme and blue zipper pouch - Wine Bottle
Set of 6 mini pill highlighters in colorful shades with cartoon emoji faces in a PVC bag - Emoji Face
+30
Mini Highlighters Plastic Creative Cartoon Shape Fluorescent Markers Portable School Office Stationery Student Gift
$0.52-1.67
No MOQ
 · 
1K+ sold recently
Top 3% Best Sellers
in Writing & Correction Supplies
Minimalist Retractable Gel Pen 0.5mm ST Needle Point Quick Dry Ink Morandi Color School Office Writing Stationery
Minimalist Retractable Gel Pen 0.5mm ST Needle Point Quick Dry Ink Morandi Color School Office Writing Stationery
like
Find Similar
Modern light purple retractable gel pens with soft rubber grip and minimalist barrel - 1 Piece / Purple
Minimalist Morandi style retractable gel pen in soft matte pink with comfortable grip - 1 Piece / Light Pink
Minimalist sage green 0.5mm retractable gel pen set with soft rubber grip - 1 Piece / Green
Set of two light blue retractable gel pens with a matte finish and minimalist design - 1 Piece / Light Blue
+10
Minimalist Retractable Gel Pen 0.5mm ST Needle Point Quick Dry Ink Morandi Color School Office Writing Stationery
$0.05-0.33
No MOQ
 · 
555 sold recently
Cute Cartoon Gel Pens With Silicone Toppers 0.5mm Black Ink Refillable Plastic Writing Pens For Students School Office
Cute Cartoon Gel Pens With Silicone Toppers 0.5mm Black Ink Refillable Plastic Writing Pens For Students School Office
like
Find Similar
Cute red gel pen with 3D watermelon topper for school students and creative stationery - Watermelon Gel Pen
Pink creative gel pens set of 2 featuring cute 3D winged heart topper and sleek body - Pink Angel Wings
Pink heart-topped white gel pen set for school stationery on a light wooden background - White Angel Wings
Sky blue cartoon gel pen featuring a pink-haired doll topper on a wooden desk - Blue Cute Princess
+42
Cute Cartoon Gel Pens With Silicone Toppers 0.5mm Black Ink Refillable Plastic Writing Pens For Students School Office
-8%
$0.11
Mix MOQ : 2
 · 
2K+ sold recently
Top 5% Best Sellers
in Writing & Correction Supplies
Waffle Texture Polyester Pencil Case Portable Makeup Bag Zipper Organizer Kawaii Korean Style Desktop Storage For Students
Waffle Texture Polyester Pencil Case Portable Makeup Bag Zipper Organizer Kawaii Korean Style Desktop Storage For Students
like
Find Similar
Pink corduroy makeup bag with bubble pattern shown in a stylish desktop setting - Pink
Close-up of white plush cosmetic bag with waffle texture and meyou fairy woven label - White
Detail view of brown waffle fabric cosmetic bag with meyou fairy label on magazines - Beige
Close-up of deep purple waffle textured cosmetic bag with woven label on a desk - Purple
+1
Waffle Texture Polyester Pencil Case Portable Makeup Bag Zipper Organizer Kawaii Korean Style Desktop Storage For Students
$1.67
Mix MOQ : 2
 · 
26 sold recently
Pastel Gel Pens High Gloss Colorful Plastic Shell For DIY Journaling Scrapbooking Office Stationery Writing Fine Point
Pastel Gel Pens High Gloss Colorful Plastic Shell For DIY Journaling Scrapbooking Office Stationery Writing Fine Point
like
Find Similar
9 options
Pastel Gel Pens High Gloss Colorful Plastic Shell For DIY Journaling Scrapbooking Office Stationery Writing Fine Point
$0.11
No MOQ
 · 
1K+ sold recently
Cartoon Stationery Blind Box Mystery Lucky Box For Students Kids School Supplies Gift Set With Notebook Ruler Eraser Pens
Cartoon Stationery Blind Box Mystery Lucky Box For Students Kids School Supplies Gift Set With Notebook Ruler Eraser Pens
like
Find Similar
Starry sky themed stationery blind box featuring a cartoon astronaut on blue packaging - Blue Blind Box (With Stationery) / Blue
Pink stationery mystery gift box with cute cartoon illustration for school children - Pink Blind Box (With Stationery) / Pink
Lucky mystery stationery gift box set with cute astronaut and cartoon illustration themes - Mixed Blind Box (With Stationery) / Mixed Colors
Cartoon Stationery Blind Box Mystery Lucky Box For Students Kids School Supplies Gift Set With Notebook Ruler Eraser Pens
$1.50
No MOQ
 · 
20 sold recently
Colored Pencils Natural Wood Body Portable Kraft Paper Tube Container For Student Drawing Professional Artist Painting
Colored Pencils Natural Wood Body Portable Kraft Paper Tube Container For Student Drawing Professional Artist Painting
like
Find Similar
2 options
Colored Pencils Natural Wood Body Portable Kraft Paper Tube Container For Student Drawing Professional Artist Painting
$0.49-0.81
No MOQ
 · 
3K+ sold recently
Top 3% Best Sellers
in Art Supplies
Colorful Gel Pens Plastic Shell Fine Tip Office School Stationery Korean Design Patterned Heart Polka Dots Stripes
Colorful Gel Pens Plastic Shell Fine Tip Office School Stationery Korean Design Patterned Heart Polka Dots Stripes
like
Find Similar
1 option
Colorful Gel Pens Plastic Shell Fine Tip Office School Stationery Korean Design Patterned Heart Polka Dots Stripes
-5%
$1.09
No MOQ
 · 
135 sold recently
Top 10% Reordered
in Writing & Correction Supplies
Vintage Museum Series PET Writable Paper Stickers Scrapbooking DIY Retro Journaling Material Assorted Decorative Aesthetic Botanical Butterfly Astronomy Stickers
Vintage Museum Series PET Writable Paper Stickers Scrapbooking DIY Retro Journaling Material Assorted Decorative Aesthetic Botanical Butterfly Astronomy Stickers
like
Find Similar
Vintage scrapbooking PET sticker set with clock, key and retro map designs - Adventure Journey
Vintage plant and flower PET stickers set with 100 pieces for journaling decor - Botanical Encyclopedia
Vintage PET sticker set with butterfly and floral motifs in retro brownish yellow tones - Butterfly Specimen
Vintage PET stickers set with retro clock and astronomical patterns for scrapbooking - Astronomical Wonders
+2
Vintage Museum Series PET Writable Paper Stickers Scrapbooking DIY Retro Journaling Material Assorted Decorative Aesthetic Botanical Butterfly Astronomy Stickers
-4%
$1.92
No MOQ
 · 
27 sold recently
Mesh Pencil Case Nylon Transparent Zippered Large Capacity Stationery Storage Bag For Students School Office
Mesh Pencil Case Nylon Transparent Zippered Large Capacity Stationery Storage Bag For Students School Office
like
Find Similar
White semi-transparent mesh pencil case with zipper and portable handle strap - White
Transparent mesh pencil case in fluorescent green color for student stationery storage - Green
Pink mesh pencil case with large capacity, zipper closure and portable carrying handle - Pink
Minimalist blue mesh pencil case with zipper and portable nylon strap for stationery - Blue
+1
Mesh Pencil Case Nylon Transparent Zippered Large Capacity Stationery Storage Bag For Students School Office
-4%
$0.88
No MOQ
 · 
28 sold recently
Ergonomic Fountain Pen Matte Finish Plastic Stationery Visible Ink Window Morandi Retro Style For Students Office
Ergonomic Fountain Pen Matte Finish Plastic Stationery Visible Ink Window Morandi Retro Style For Students Office
like
Find Similar
Morandi blue fountain pen with ergonomic grip and EF nib detail in minimalist style - EF Nib 0.38mm / Morandi Blue
Morandi green fountain pen with EF nib featuring ergonomic grip and matte finish - EF Nib 0.38mm / Morandi Green
Pink Morandi fountain pen with ergonomic grip and EF nib in a single pack - EF Nib 0.38mm / Morandi Pink
Navy blue fountain pen with EF nib and ink window from the vintage series collection - EF Nib 0.38mm / Retro Blue
+30
Ergonomic Fountain Pen Matte Finish Plastic Stationery Visible Ink Window Morandi Retro Style For Students Office
$0.24-1.90
No MOQ
 · 
1K+ sold recently
Top 10% Best Sellers
in Writing & Correction Supplies
Morandi Gradient Highlighter Pens Soft Ink Marker Eye Friendly Chisel Tip Plastic For Student Office Journaling Aesthetic
Morandi Gradient Highlighter Pens Soft Ink Marker Eye Friendly Chisel Tip Plastic For Student Office Journaling Aesthetic
like
Find Similar
Set of four gradient highlighter pens in pink and purple colors with soft chisel tip - Peach Cream / 4 Pcs/Bag
Set of 4 gradient soft-tip highlighters in purple and blue colors for students - Taro Puff / 4 Pcs/Bag
Set of four gradient soft marker pens in assorted green and blue tones for students - Mung Bean Smoothie / 4 Pcs/Bag
Set of 6 macaron gradient fluorescent pens for eye protection and aesthetic journaling - 6-Piece Set / 6 Pcs/Box
+4
Morandi Gradient Highlighter Pens Soft Ink Marker Eye Friendly Chisel Tip Plastic For Student Office Journaling Aesthetic
-5%
$0.31-1.04
No MOQ
 · 
894 sold recently
Top 10% Best Sellers
in Writing & Correction Supplies
7 Piece Math Geometry Tool Set With Compass Ruler Protractor Eraser Metal Tin Box Student Stationery Drawing Kit For School Students Reward Gift
7 Piece Math Geometry Tool Set With Compass Ruler Protractor Eraser Metal Tin Box Student Stationery Drawing Kit For School Students Reward Gift
like
Find Similar
7-piece student geometry set in mint green case including compass, rulers, and eraser - Iron Box No Window Green Set
Green 7-piece geometry set with compass and rulers in a durable metal storage case - Iron Box With Window Green Set
7-piece purple stationery set with compass, rulers, and protractor in a metal storage box - Iron Box With Window Purple Set
7-piece purple math geometry set with compass and ruler in a metal storage box - Iron Box No Window Purple Set
+5
7 Piece Math Geometry Tool Set With Compass Ruler Protractor Eraser Metal Tin Box Student Stationery Drawing Kit For School Students Reward Gift
-5%
$0.88-1.15
No MOQ
 · 
631 sold recently
Retractable Gel Pens Floral Words Of Flowers Series Black Ink 0.5mm Minimalist Writing Tools For Students Office School Stationery
Retractable Gel Pens Floral Words Of Flowers Series Black Ink 0.5mm Minimalist Writing Tools For Students Office School Stationery
like
Find Similar
Set of 4 aesthetic 0.5mm black ink retractable gel pens in floral pattern box - 4Pcs Set / Bluebell
Floral series 0.5mm black ink retractable gel pens with cute bear patterns, 4-piece set - 4Pcs Set / Light Green
Floral series 0.5mm retractable black gel pen set in 4-piece aesthetic box packaging - 4Pcs Set / Light Pink
Set of 4 floral-patterned 0.5mm black ink retractable gel pens with beige packaging - 4Pcs Set / Light Blue Zircon
+2
Retractable Gel Pens Floral Words Of Flowers Series Black Ink 0.5mm Minimalist Writing Tools For Students Office School Stationery
$0.42
No MOQ
 · 
968 sold recently
Top 10% Best Sellers
in Writing & Correction Supplies
Go to

More in office & school supplies

Explore more in lined notebooks

covergirlskidsmetalstyledesignthreadsquarecardsmall
studentsbanddailymagneticholidaylockholderpartypersonaldouble

Ready to source like an insider

Get a direct line to the factory floor — no minimums, no middlemen, no guesswork.
iconReal factory pricing, no markup in betweeniconEvery order hand-inspected before it shipsicon5,000+ new products added daily
Get Inside Access