Everful

Wholesale favor boxes

Factory-direct selection, vetted for quality and ready to order.

Sign Up
Favor Boxes

Find the perfect pieces: party gift bags, party favors, gift wrapping supplies and more

filterShow Filters
Best Seller
New Arrivals
Price Drop
Free Shipping
Wedding Candy Favor Boxes Tuxedo And Dress Shape Paper Gift Packaging Marriage Party European Style Groom And Bride
Wedding Candy Favor Boxes Tuxedo And Dress Shape Paper Gift Packaging Marriage Party European Style Groom And Bride
like
Find Similar
European wedding candy gift box set with black tuxedo and pink floral wedding dress designs - Bride / Pink
Wedding Candy Favor Boxes Tuxedo And Dress Shape Paper Gift Packaging Marriage Party European Style Groom And Bride
$0.07
Mix MOQ : 100
 · 
11 views
Laser Cut Candy Boxes Pearlescent Paper Hollow Floral Favor Box With Ribbon Bow For Wedding Party Gift Packaging Treat Boxes
Laser Cut Candy Boxes Pearlescent Paper Hollow Floral Favor Box With Ribbon Bow For Wedding Party Gift Packaging Treat Boxes
like
Find Similar
Elegant laser cut white floral gift box with silver ribbon for wedding favors and sweets - White
Detailed laser-cut wedding favor box in white pearlescent paper with elegant ribbon - Ivory
Pink laser-cut sunflower candy box with mandala patterns and light pink organza ribbon - Pink
Close-up of golden laser-cut wedding favor box with floral patterns and ribbon bow - Gold
+7
Laser Cut Candy Boxes Pearlescent Paper Hollow Floral Favor Box With Ribbon Bow For Wedding Party Gift Packaging Treat Boxes
-6%
$0.15
Mix MOQ : 50
Hollow Pumpkin Carriage Candy Box Laser Cut Paper Wedding Favor Gift Box With Ribbon For Engagement Celebration Party Decoration
Hollow Pumpkin Carriage Candy Box Laser Cut Paper Wedding Favor Gift Box With Ribbon For Engagement Celebration Party Decoration
like
Find Similar
Elegant light blue laser-cut crown carriage candy box with organza ribbon for weddings - Tiffany Blue
Macro view of white laser-cut carriage paper candy box with white organza ribbon bow - White
Detail view of white laser-cut wedding candy box with pumpkin carriage design and bow - Ivory
Pink laser-cut pumpkin carriage wedding favor box with ribbon and heart details - Pink
+7
Hollow Pumpkin Carriage Candy Box Laser Cut Paper Wedding Favor Gift Box With Ribbon For Engagement Celebration Party Decoration
$0.13
Mix MOQ : 50
European Romantic Laser Cut Wedding Candy Box Hollow Bride And Groom Silhouette Heart Shaped Gift Favor Paper Box Gold Inner
European Romantic Laser Cut Wedding Candy Box Hollow Bride And Groom Silhouette Heart Shaped Gift Favor Paper Box Gold Inner
like
Find Similar
European ivory laser-cut wedding favor box with golden lining and romantic silhouette - White + Gold
Pink and gold wedding favor box with laser-cut bride and groom silhouette and heart pattern - Pink & Gold
Laser cut wedding favor box with dark blue hollow patterns and gold foil lining - Blue + Gold
European wedding candy box with red laser-cut silhouette of bride and groom and gold liner - Red + Gold
+2
European Romantic Laser Cut Wedding Candy Box Hollow Bride And Groom Silhouette Heart Shaped Gift Favor Paper Box Gold Inner
$0.21
Mix MOQ : 50
Laser Cut Cross Hollow Candy Boxes With Ribbon Pearl Paper Reflective Mirror Silver Gold Favor Box For Wedding Baptism Party
Laser Cut Cross Hollow Candy Boxes With Ribbon Pearl Paper Reflective Mirror Silver Gold Favor Box For Wedding Baptism Party
like
Find Similar
Elegant white laser-cut cross gift box with pearlescent finish and ribbon for baptism - White
Detail of laser-cut cross pattern and ribbon bow on white hollow candy box for baptism - Ivory
Elegant laser-cut silver mirror cross candy box with ribbon for wedding and baptism - Reflective Gold
Silver laser-cut cross favor box with light blue ribbon for wedding or baptism events - Reflective Silver
Laser Cut Cross Hollow Candy Boxes With Ribbon Pearl Paper Reflective Mirror Silver Gold Favor Box For Wedding Baptism Party
$0.13
Mix MOQ : 50
European Hollow Laser Cut Flower Candy Gift Box With Ribbon Pearl Paper Wedding Party Favor Box For Chocolate Cookies
European Hollow Laser Cut Flower Candy Gift Box With Ribbon Pearl Paper Wedding Party Favor Box For Chocolate Cookies
like
Find Similar
Elegant white laser-cut gift box with floral patterns and satin ribbon for wedding favors - White
Hollow laser-cut light pink favor box with floral patterns and a white silk ribbon bow - Pink
Tiffany blue laser cut hollow gift candy box with delicate floral patterns and ribbon bow - Tiffany Blue
Purple laser-cut floral candy gift box with a matching sheer organza ribbon bow - Dark Purple
+4
European Hollow Laser Cut Flower Candy Gift Box With Ribbon Pearl Paper Wedding Party Favor Box For Chocolate Cookies
-7%
$0.12
Mix MOQ : 50
Free Shipping
European Crown Laser Cut Hollow Candy Box Pearl Paper Reflective Mirror Gift Box For Wedding Party Celebration Favors
European Crown Laser Cut Hollow Candy Box Pearl Paper Reflective Mirror Gift Box For Wedding Party Celebration Favors
like
Find Similar
8 options
European Crown Laser Cut Hollow Candy Box Pearl Paper Reflective Mirror Gift Box For Wedding Party Celebration Favors
$0.17
Mix MOQ : 50
Laser Cut Rose Floral Wedding Candy Box Hollowed Pearlescent Paper Gift Box For Wedding Baptism Party Favors Decorative Box
Laser Cut Rose Floral Wedding Candy Box Hollowed Pearlescent Paper Gift Box For Wedding Baptism Party Favors Decorative Box
like
Find Similar
8 options
Laser Cut Rose Floral Wedding Candy Box Hollowed Pearlescent Paper Gift Box For Wedding Baptism Party Favors Decorative Box
$0.18
Mix MOQ : 50
Hollow Rose Laser Cut Paper Candy Box With Ribbon And Thank You Tags For Wedding Valentine's Day Party Favor Gift Box
Hollow Rose Laser Cut Paper Candy Box With Ribbon And Thank You Tags For Wedding Valentine's Day Party Favor Gift Box
like
Find Similar
White laser cut hollow rose candy box with thank you tag and ribbon for weddings - White
Detail of pink laser-cut rose gift box with organza ribbon and Thank You tag - Pink
Detail of light blue laser-cut rose gift box with silk ribbon and thank you tag - Pearl Pale Blue
Golden hollow laser cut wedding candy box with rose pattern, ribbon and thank you tag - Gold
+4
Hollow Rose Laser Cut Paper Candy Box With Ribbon And Thank You Tags For Wedding Valentine's Day Party Favor Gift Box
$0.14
Mix MOQ : 50
Halloween Candy Gift Box Cardboard Paper Witch Hat Shape Pumpkin Ghost Print Party Favors Novelty Decor
Halloween Candy Gift Box Cardboard Paper Witch Hat Shape Pumpkin Ghost Print Party Favors Novelty Decor
like
Find Similar
Purple Halloween cone hat with yellow stars and white skull pattern on white background - Purple
Orange Halloween party hat with black castle and pumpkin silhouette patterns - Orange
Halloween Candy Gift Box Cardboard Paper Witch Hat Shape Pumpkin Ghost Print Party Favors Novelty Decor
$0.15
No MOQ
 · 
27 views
Laser Cut Crown Favor Box Moon Star Pattern Reflective Pearlescent Paper Candy Gift Box For Wedding Ramadan Eid Party Decoration
Laser Cut Crown Favor Box Moon Star Pattern Reflective Pearlescent Paper Candy Gift Box For Wedding Ramadan Eid Party Decoration
like
Find Similar
7 options
Laser Cut Crown Favor Box Moon Star Pattern Reflective Pearlescent Paper Candy Gift Box For Wedding Ramadan Eid Party Decoration
-6%
$0.14
Mix MOQ : 50
Hollow Out Easter Egg Candy Box Laser Cut Pearlescent Paper Gift Box With Ribbon Bow For Wedding Birthday Party Favors
Hollow Out Easter Egg Candy Box Laser Cut Pearlescent Paper Gift Box With Ribbon Bow For Wedding Birthday Party Favors
like
Find Similar
White laser-cut Easter candy box with chick patterns and a delicate white organza bow - White
Detailed laser cut Easter egg pattern on white gift box with organza ribbon bow - Ivory
Pink hollow Easter egg candy box with laser-cut design and satin ribbon bow - Pink
Detail of red Easter favor box with laser-cut chick design and silk ribbon bow - Pearlescent Red
+3
Hollow Out Easter Egg Candy Box Laser Cut Pearlescent Paper Gift Box With Ribbon Bow For Wedding Birthday Party Favors
$0.13
Mix MOQ : 50
Laser Cut Cross Design Hollow Candy Gift Boxes With Handle For Wedding Baptism First Communion Party Favors Paper Treat Bags
Laser Cut Cross Design Hollow Candy Gift Boxes With Handle For Wedding Baptism First Communion Party Favors Paper Treat Bags
like
Find Similar
White laser-cut cross gift box with floral wreath design for religious celebrations - White
Detailed laser-cut hollow cross design on white pearlescent wedding favor box with handle - Ivory
Detail of pink laser-cut candy box featuring hollow cross and floral pattern - Pink
Close-up of light blue laser-cut candy box with hollow cross and floral pattern details - Tiffany Blue
+8
Laser Cut Cross Design Hollow Candy Gift Boxes With Handle For Wedding Baptism First Communion Party Favors Paper Treat Bags
$0.16
Mix MOQ : 50
Graduation Cap Candy Box Graduation Party Gift Wrapping Box Graduation Ceremony Favors Cardboard Box With Tassel Graduation Mortarboard Shape Treat Box For Graduates
Graduation Cap Candy Box Graduation Party Gift Wrapping Box Graduation Ceremony Favors Cardboard Box With Tassel Graduation Mortarboard Shape Treat Box For Graduates
like
Find Similar
Mini graduation cap gift box in black cardstock featuring a vibrant red tassel accent - Red Tassel Style (s685)
Black graduation cap favor box with a blue silk tassel for party candy and gifts - Blue Tassel Style (s802)
Detail of black matte graduation cap gift box with decorative silky long tassel - S685# Black Box + (black Tassel) + White Buckle
Creative black graduation cap favor box with golden tassel for party candy gift packaging - Yellow Tassel Style (s685)
+4
Graduation Cap Candy Box Graduation Party Gift Wrapping Box Graduation Ceremony Favors Cardboard Box With Tassel Graduation Mortarboard Shape Treat Box For Graduates
$0.11
Mix MOQ : 10
Laser Cut Butterfly Hollow Pearlescent Paper Candy Box With Ribbon Bow Elegant Wedding Favor Gift Box For Chocolate Candy
Laser Cut Butterfly Hollow Pearlescent Paper Candy Box With Ribbon Bow Elegant Wedding Favor Gift Box For Chocolate Candy
like
Find Similar
White laser cut Christmas candy box with hollow bell pattern and white organza ribbon bow - White
Pink laser cut wedding candy box with floral heart patterns and a soft chiffon ribbon bow - Pink
Detail of laser-cut sky blue favor box with intricate floral pattern and sheer ribbon - Tiffany Blue
Macro view of kraft paper gift box featuring laser-cut floral patterns and black ribbon bow - Kraft Paper
+5
Laser Cut Butterfly Hollow Pearlescent Paper Candy Box With Ribbon Bow Elegant Wedding Favor Gift Box For Chocolate Candy
$0.13
Mix MOQ : 50
Laser Cut Hollow Heart Love Paper Favor Box With Ribbon For Wedding Party Valentine's Day Romantic Gift Candy Packaging Box
Laser Cut Hollow Heart Love Paper Favor Box With Ribbon For Wedding Party Valentine's Day Romantic Gift Candy Packaging Box
like
Find Similar
Laser cut white heart candy box with LOVE lettering and a white ribbon bow - White
Laser-cut white wedding favor box with heart-shaped LOVE cutouts and a white ribbon bow - Ivory
Pink hollow LOVE laser cut wedding favor box with a white ribbon bow on top - Pink
Laser cut champagne gold wedding favor box with heart patterns and LOVE text detail - Gold
+5
Laser Cut Hollow Heart Love Paper Favor Box With Ribbon For Wedding Party Valentine's Day Romantic Gift Candy Packaging Box
$0.13
Mix MOQ : 50
Laser Cut Butterfly Rose Hollow Candy Box With Ribbon Pearlescent Paper Gift Boxes For Wedding Birthday Party Favors
Laser Cut Butterfly Rose Hollow Candy Box With Ribbon Pearlescent Paper Gift Boxes For Wedding Birthday Party Favors
like
Find Similar
Detail of laser-cut butterfly candy box in light blue paper with matching ribbon bow - Pearl Pale Blue
Detail of red laser-cut butterfly candy box with rose patterns and a silk ribbon bow - Pearlescent Red
Close-up of white laser-cut rose pattern gift box with silver ribbon on dark wood - White
Pink laser-cut butterfly favor box with rose patterns and ribbon for wedding parties - Pink
+5
Laser Cut Butterfly Rose Hollow Candy Box With Ribbon Pearlescent Paper Gift Boxes For Wedding Birthday Party Favors
$0.13
Mix MOQ : 50
Laser Cut Mubarak Moon Star Gift Box Eid Ramadan Party Favors Pearlescent Paper Hollow Candy Boxes Celebration Supplies
Laser Cut Mubarak Moon Star Gift Box Eid Ramadan Party Favors Pearlescent Paper Hollow Candy Boxes Celebration Supplies
like
Find Similar
Detail of square white and gold Eid Mubarak favor box with laser-cut moon patterns - 5*5*8CM / White
Detail of laser-cut moon and mosque patterns on pink Eid Mubarak gift box - 5*5*8CM / Pink
Detailed laser cut crescent moon and Mubarak lettering on dark blue square gift box - 5*5*8CM / Tiffany Blue
Close-up of golden Mubarak moon gift box with laser-cut mosque design and metallic finish - 5*5*8CM / Gold
+5
Laser Cut Mubarak Moon Star Gift Box Eid Ramadan Party Favors Pearlescent Paper Hollow Candy Boxes Celebration Supplies
$0.22
Mix MOQ : 50
Laser Cut Princess Dress Candy Box Glitter Paper Floral Hollow Out Gift Box With Ribbon Bow For Wedding Party Favors
Laser Cut Princess Dress Candy Box Glitter Paper Floral Hollow Out Gift Box With Ribbon Bow For Wedding Party Favors
like
Find Similar
Laser-cut gold glitter paper candy box in elegant princess dress shape with pink ribbon - Thick Rich Gold 93#
Close-up of laser-cut glitter silver candy box with elegant floral hollow pattern - Thick Silver 91#
Detail of laser-cut gold glitter wedding candy box in princess dress shape with silk bow - Light Gold 42#
Detailed laser-cut rose gold glitter gift box in princess dress shape with organza bow - Thick Champagne 96#
+3
Laser Cut Princess Dress Candy Box Glitter Paper Floral Hollow Out Gift Box With Ribbon Bow For Wedding Party Favors
$0.14
Mix MOQ : 50
Heart Shape Laser Cut Rose Candy Boxes Wedding Party Favor Boxes Elegant Pearlescent Paper Gift Packaging With Silk Ribbon
Heart Shape Laser Cut Rose Candy Boxes Wedding Party Favor Boxes Elegant Pearlescent Paper Gift Packaging With Silk Ribbon
like
Find Similar
Laser-cut white heart-shaped wedding favor box with floral patterns and a ribbon bow - White
Detail of laser-cut white heart candy box with rose pattern and silk ribbon - Ivory
Close-up of light blue heart-shaped gift box with laser-cut rose patterns and ribbon - Pearl Pale Blue
Close-up of pink heart-shaped laser cut favor box with intricate rose pattern and ribbon - Pink
+4
Heart Shape Laser Cut Rose Candy Boxes Wedding Party Favor Boxes Elegant Pearlescent Paper Gift Packaging With Silk Ribbon
$0.12
Mix MOQ : 50
Hexagon Kraft Paper Gift Boxes European Style Candy Favors With Hemp Rope Portable Folding Wedding Party
Hexagon Kraft Paper Gift Boxes European Style Candy Favors With Hemp Rope Portable Folding Wedding Party
like
Find Similar
Close-up of white hexagonal paper gift box with a brown jute twine ribbon bow - White
Detail of a hexagonal kraft paper gift box with a rustic hemp rope tie on white background - Yellow
Hexagon Kraft Paper Gift Boxes European Style Candy Favors With Hemp Rope Portable Folding Wedding Party
$0.08
No MOQ
 · 
22 sold recently
Laser Cut Princess Dress Favor Boxes Hollow Paper Candy Gift Bags With Ribbon For Wedding Birthday Party Table Decorations
Laser Cut Princess Dress Favor Boxes Hollow Paper Candy Gift Bags With Ribbon For Wedding Birthday Party Table Decorations
like
Find Similar
Elegant white laser-cut wedding favor box with gown design and silver organza ribbon bow - White
Close-up of laser-cut wedding favor box in bridal dress shape with white ribbon - Ivory
Detail of pink princess-shaped laser-cut gift box with a white organza ribbon bow - Pink
Detailed laser-cut Tiffany blue princess dress gift box with white ribbon bow - Tiffany Blue
+7
Laser Cut Princess Dress Favor Boxes Hollow Paper Candy Gift Bags With Ribbon For Wedding Birthday Party Table Decorations
$0.14
Mix MOQ : 50
Square Glitter Paper Candy Boxes With Ribbon Handle For Wedding Party Favor Gift Packaging
Square Glitter Paper Candy Boxes With Ribbon Handle For Wedding Party Favor Gift Packaging
like
Find Similar
Macro detail of white wedding candy box with colorful glitter lid and satin ribbon - Colorful
Sparkly glitter square gift box with silver and black lid plus white satin ribbon handle - Silver
European square candy gift box with golden glitter finish and white ribbon handle - Gold
Square Glitter Paper Candy Boxes With Ribbon Handle For Wedding Party Favor Gift Packaging
$0.20
Mix MOQ : 50
 · 
14 views
Halloween Candy Gift Boxes Paper Foldable Treat Bags With Handle Cartoon Mummy Monster Pumpkin Patterns Party Favors
Halloween Candy Gift Boxes Paper Foldable Treat Bags With Handle Cartoon Mummy Monster Pumpkin Patterns Party Favors
like
Find Similar
Orange monster-shaped Halloween candy box with large eyes and toothy smile - Orange Monster Style
Cute mummy style Halloween candy gift box with white bandage pattern and vivid eyes design - White Mummy Style
Green monster themed Halloween candy box with cartoon eyes and sturdy paper handle - Green Stitched Monster Style
Halloween Candy Gift Boxes Paper Foldable Treat Bags With Handle Cartoon Mummy Monster Pumpkin Patterns Party Favors
-6%
$0.15
No MOQ
Halloween Gift Boxes Cardboard With PVC Window Trick Or Treat Patterns For Party Favor Candy Cookie Storage
Halloween Gift Boxes Cardboard With PVC Window Trick Or Treat Patterns For Party Favor Candy Cookie Storage
like
Find Similar
Halloween black and white grid candy box with wave window and trick or treat ghost print - Black (Ghost Pattern)
Halloween orange polka dot cookie box with pumpkin and window for trick or treat candy - Orange (Pumpkin Pattern)
Purple Halloween gift box with a transparent window featuring a black cat and candy corn - Purple (Black Cat Pattern)
Halloween Gift Boxes Cardboard With PVC Window Trick Or Treat Patterns For Party Favor Candy Cookie Storage
$0.52
Mix MOQ : 50
Laser Cut Hajj Mabrour Favor Boxes Reflective Gold Silver Paper Gift Box With Ribbon For Eid Mubarak Party Celebration Wedding
Laser Cut Hajj Mabrour Favor Boxes Reflective Gold Silver Paper Gift Box With Ribbon For Eid Mubarak Party Celebration Wedding
like
Find Similar
Detail of gold Hajj Mabrour gift box with hollow design and shiny yellow ribbon bow - Reflective Gold
Mirror silver Hajj Mabrour gift box with blue ribbon and hollowed laser-cut patterns - Reflective Silver
Close-up of laser-cut Hajj Mabrour hollow candy box with texture and organza ribbon - Black
Laser Cut Hajj Mabrour Favor Boxes Reflective Gold Silver Paper Gift Box With Ribbon For Eid Mubarak Party Celebration Wedding
$0.13
Mix MOQ : 50
Laser Cut Hollow Wedding Favor Boxes European Style Pearl Paper Candy Box With Ribbon For Chocolate Souvenirs Party Decor
Laser Cut Hollow Wedding Favor Boxes European Style Pearl Paper Candy Box With Ribbon For Chocolate Souvenirs Party Decor
like
Find Similar
Elegant white laser-cut wedding candy gift box with floral patterns and a silk ribbon - White
Pink laser-cut wedding favor box with pearl shimmer finish and white ribbon bow - Pink
Elegant light blue laser-cut wedding favor box with intricate hollow floral patterns - Tiffany Blue
Macro detail of purple laser-cut wedding candy box with floral patterns and silk ribbon - Dark Purple
+3
Laser Cut Hollow Wedding Favor Boxes European Style Pearl Paper Candy Box With Ribbon For Chocolate Souvenirs Party Decor
$0.13
Mix MOQ : 50
Laser Cut Rose Candy Boxes Pearlescent Paper Hollow Out Gift Boxes With Ribbon For Wedding Valentine's Day Party Favor Boxes
Laser Cut Rose Candy Boxes Pearlescent Paper Hollow Out Gift Boxes With Ribbon For Wedding Valentine's Day Party Favor Boxes
like
Find Similar
White laser-cut hollow rose wedding favor box with ribbon for candy and small gifts - White
Elegant white laser-cut rose hollow wedding favor box with a delicate white ribbon bow - Ivory
Pink laser-cut rose gift boxes with white ribbons for weddings and Valentine's Day - Pink
Close-up of golden laser-cut rose gift box with elegant ribbon for wedding favors - Gold
+4
Laser Cut Rose Candy Boxes Pearlescent Paper Hollow Out Gift Boxes With Ribbon For Wedding Valentine's Day Party Favor Boxes
$0.13
Mix MOQ : 50
Laser Cut Rose Flower Candy Box Glitter Paper Ribbon Bow Gift Box For Wedding Valentine's Party favor Box
Laser Cut Rose Flower Candy Box Glitter Paper Ribbon Bow Gift Box For Wedding Valentine's Party favor Box
like
Find Similar
Elegant gold laser-cut rose candy box with yellow organza ribbon and glitter finish - Glitter Rose Gold and Reflective Gold
Pink glitter laser-cut rose favor box with gold insert and white ribbon tie - Glitter Pink and Reflective Gold
Glittering gold laser-cut favor box with rose patterns and yellow ribbon bow - Glitter Golden Yellow and Reflective Gold
Laser cut gift box with red glitter rose pattern, gold liner and red ribbon bow - Glitter Red and Reflective Gold
+1
NewLaser Cut Rose Flower Candy Box Glitter Paper Ribbon Bow Gift Box For Wedding Valentine's Party favor Box
$0.19
Mix MOQ : 50
Laser Cut Hollow Rose Flower Wedding Candy Box Mirror Metallic Cardboard Gift Box Ribbon Bow Party Decoration Favors
Laser Cut Hollow Rose Flower Wedding Candy Box Mirror Metallic Cardboard Gift Box Ribbon Bow Party Decoration Favors
like
Find Similar
Golden laser-cut hollow rose wedding candy box with elegant organza ribbon decoration - Mirror Gold
Holographic laser cut favor box with floral patterns and a white ribbon bow for parties - Mirror Iridescent
Elegant laser-cut rose hollow candy box with ribbon for weddings and party favors - Nail Powder
Hollow laser-cut floral wedding favor box in cyan blue with matching satin ribbon bow - Mirror Indigo
+1
Laser Cut Hollow Rose Flower Wedding Candy Box Mirror Metallic Cardboard Gift Box Ribbon Bow Party Decoration Favors
$0.13
Mix MOQ : 50
Christmas Laser Cut Hollow Out Candy Gift Box Pearlescent Paper Snowflake Christmas Tree Pattern Gift Box With Ribbon For Party Wedding Favor
Christmas Laser Cut Hollow Out Candy Gift Box Pearlescent Paper Snowflake Christmas Tree Pattern Gift Box With Ribbon For Party Wedding Favor
like
Find Similar
White laser-cut Christmas candy box with tree and snowflake patterns and ribbon - White
Dark blue laser-cut Christmas candy box with snowflake tree patterns and white ribbon - Royal Blue
Detail of purple laser-cut Christmas tree gift box with ribbon and snowflake patterns - Dark Purple
Detail of laser-cut orange Christmas candy box with snowflake patterns and white ribbon - Orange Red
+10
Christmas Laser Cut Hollow Out Candy Gift Box Pearlescent Paper Snowflake Christmas Tree Pattern Gift Box With Ribbon For Party Wedding Favor
-7%
$0.12
Mix MOQ : 50
Laser Cut Pearlescent Paper Favor Boxes With Ribbon Thank You Tags For Wedding Party Decoration Gift Wrapping Box
Laser Cut Pearlescent Paper Favor Boxes With Ribbon Thank You Tags For Wedding Party Decoration Gift Wrapping Box
like
Find Similar
Close-up of white laser-cut gift box with floral patterns, ribbon, and Thank You tag - Tag Included / 5x5x8CM / White
Detail of cream laser-cut gift box with floral patterns and Thank You tag - Tag Included / 5x5x8CM / Ivory
Detail of pink laser-cut gift box with floral patterns and a white Thank You tag - Tag Included / 5x5x8CM / Pink
Detail of laser-cut gift box with mint green leaf pattern, white ribbon, and thank you tag - Tag Included / 5x5x8CM / Pearl Pale Blue
+6
Laser Cut Pearlescent Paper Favor Boxes With Ribbon Thank You Tags For Wedding Party Decoration Gift Wrapping Box
$0.14
Mix MOQ : 50
Laser Cut Hollow Sunflower Favor Box Pearlescent Paper Gift Box With Ribbon For Wedding Bridal Shower Party Candy Chocolate Box
Laser Cut Hollow Sunflower Favor Box Pearlescent Paper Gift Box With Ribbon For Wedding Bridal Shower Party Candy Chocolate Box
like
Find Similar
Macro detail of laser-cut house-shaped favor box with white organza ribbon bow - White
Pink laser-cut lantern candy box with floral patterns and a soft chiffon ribbon bow - Pink
Detail of laser cut sunflower pattern on light blue paper wedding favor gift box - Tiffany Blue
Close-up of purple hollow-out gift box with floral patterns and a matching organza ribbon - Dark Purple
+5
Laser Cut Hollow Sunflower Favor Box Pearlescent Paper Gift Box With Ribbon For Wedding Bridal Shower Party Candy Chocolate Box
$0.13
Mix MOQ : 50
Exquisite Laser Cut Flower Candy Box Wedding Favor Gift Packaging Box With Ribbon Bowknot For Valentine's Day Chocolate
Exquisite Laser Cut Flower Candy Box Wedding Favor Gift Packaging Box With Ribbon Bowknot For Valentine's Day Chocolate
like
Find Similar
Elegant white laser-cut floral candy box with a delicate sheer ribbon bow for weddings - White
Elegant purple laser-cut flower candy box with matching organza ribbon bow detail - Dark Purple
Elegant purple hollow-out paper candy gift box with floral laser-cut pattern and blue ribbon bow - Sapphire Blue
Exquisite red hollow flower candy box with matching ribbon for wedding favors - Pearlescent Red
+7
Exquisite Laser Cut Flower Candy Box Wedding Favor Gift Packaging Box With Ribbon Bowknot For Valentine's Day Chocolate
-6%
$0.15
Mix MOQ : 50
Laser Cut Flower Hollowed-out Wedding Favor Candy Box Pearlescent Paper Gift Packaging With Ribbon European Style For Party Celebration
Laser Cut Flower Hollowed-out Wedding Favor Candy Box Pearlescent Paper Gift Packaging With Ribbon European Style For Party Celebration
like
Find Similar
Elegant white laser-cut floral wedding favor box with a delicate white organza ribbon bow - White
Pink laser-cut flower candy box with elegant white organza ribbon for weddings - Pink
Macro shot of laser-cut floral patterns on golden gift box with organza ribbon - Reflective Gold
Macro detail of laser-cut floral pattern on silver metallic wedding candy gift box - Reflective Silver
+5
Laser Cut Flower Hollowed-out Wedding Favor Candy Box Pearlescent Paper Gift Packaging With Ribbon European Style For Party Celebration
-5%
$0.16
Mix MOQ : 50
Christmas Advent Calendar Candy Gift Boxes Cardboard Square Holiday Party Favor Small Treat Containers Cartoon Pattern
Christmas Advent Calendar Candy Gift Boxes Cardboard Square Holiday Party Favor Small Treat Containers Cartoon Pattern
like
Find Similar
1 option
Christmas Advent Calendar Candy Gift Boxes Cardboard Square Holiday Party Favor Small Treat Containers Cartoon Pattern
-5%
$2.84
No MOQ
 · 
11 sold recently
Baby Shower Candy Boxes Hollow Stroller Laser Cut Paper Favor Boxes With Ribbon For Christening Birthday Party Baptism Novelty
Baby Shower Candy Boxes Hollow Stroller Laser Cut Paper Favor Boxes With Ribbon For Christening Birthday Party Baptism Novelty
like
Find Similar
Hollow laser-cut baby carriage candy box in lavender purple with silk bow accent - Purple
Pink laser-cut baby carriage candy box with matching silk ribbon for baby showers - Pink
Navy blue baby carriage candy box with ribbon for baby shower gift packaging - Dark Blue
Mint green baby carriage cutout candy box with ribbon for baby shower favors - Green
+1
Baby Shower Candy Boxes Hollow Stroller Laser Cut Paper Favor Boxes With Ribbon For Christening Birthday Party Baptism Novelty
$0.10
Mix MOQ : 50
 · 
15 views
Halloween Portable Cake Paper Box Handle Gift Boxes Candy Packing Spider Web Ghost Witch Skeleton Party Favors Packaging
Halloween Portable Cake Paper Box Handle Gift Boxes Candy Packing Spider Web Ghost Witch Skeleton Party Favors Packaging
like
Find Similar
Halloween black cake gift box with white spider web patterns and portable handle - Spider Web - Black
Halloween paper cake box with handle featuring cartoon witch and starry sky on white plate - Witch - Blue
Halloween orange cake gift box with ghost and witch prints featuring a top handle design - Ghost - Orange
Halloween portable cake box with spider web and haunted house design in orange and black - Skull - Yellow
Halloween Portable Cake Paper Box Handle Gift Boxes Candy Packing Spider Web Ghost Witch Skeleton Party Favors Packaging
$0.13
Mix MOQ : 50
Halloween Laser Cut Hollow Candy Gift Box Pumpkin Castle Cat Design European Style Party Favor Paper Box Packaging
Halloween Laser Cut Hollow Candy Gift Box Pumpkin Castle Cat Design European Style Party Favor Paper Box Packaging
like
Find Similar
Hollow out Halloween candy box with pumpkin and black cat design on white ceramic plate - White
Golden laser cut Halloween candy box with ghost and castle hollowed patterns - Beige Gold
Detailed view of hollow mirror gold Halloween candy box with pumpkin and castle motifs - Reflective Gold
Detail of silver laser-cut Halloween gift box with bat and pumpkin hollow patterns - Reflective Silver
+1
Halloween Laser Cut Hollow Candy Gift Box Pumpkin Castle Cat Design European Style Party Favor Paper Box Packaging
-6%
$0.14
Mix MOQ : 50
Halloween Candy Gift Boxes Cardboard Portable Handle Window Pumpkin Ghost Skull Black Cat Party Favors
Halloween Candy Gift Boxes Cardboard Portable Handle Window Pumpkin Ghost Skull Black Cat Party Favors
like
Find Similar
4 options
Halloween Candy Gift Boxes Cardboard Portable Handle Window Pumpkin Ghost Skull Black Cat Party Favors
$0.28
Mix MOQ : 50
Laser Cut Heart Love Pearl Paper Candy Favor Box For Wedding Party Valentine Gift Packaging Decoration Ribbon Folding Box
Laser Cut Heart Love Pearl Paper Candy Favor Box For Wedding Party Valentine Gift Packaging Decoration Ribbon Folding Box
like
Find Similar
Macro shot of silver pearl paper favor box with laser-cut Love motif and organza ribbon - Reflective Silver
Elegant white laser-cut LOVE candy box with ribbon for wedding party gift packaging - White
Pink laser cut wedding favor box with Love heart pattern and white organza ribbon - Pink
Detailed laser-cut pearl paper wedding candy box with Love heart design and white ribbon - Jewelry Cream Star
+5
Laser Cut Heart Love Pearl Paper Candy Favor Box For Wedding Party Valentine Gift Packaging Decoration Ribbon Folding Box
$0.13
Mix MOQ : 50
Laser Cut Rose Flower Candy Boxes Wedding Favor Gift Box Pearlescent Paper Hollow Chocolate Souvenir Boxes With Ribbon
Laser Cut Rose Flower Candy Boxes Wedding Favor Gift Box Pearlescent Paper Hollow Chocolate Souvenir Boxes With Ribbon
like
Find Similar
White laser cut hollow rose candy box with ribbon for wedding party favors - White
Pink laser cut rose candy box with white velvet ribbon for weddings and parties - Pink
Elegant light blue laser-cut rose gift box with matching sheer organza bow for weddings - Tiffany Blue
Detailed laser-cut purple candy box with elegant rose pattern and silk ribbon bow - Dark Purple
+3
Laser Cut Rose Flower Candy Boxes Wedding Favor Gift Box Pearlescent Paper Hollow Chocolate Souvenir Boxes With Ribbon
$0.13
Mix MOQ : 50
Laser Cut Wedding Candy Box Hollow Love Heart Gift Box With Ribbon And Thank You Tag For Valentine Engagement Party Favor
Laser Cut Wedding Candy Box Hollow Love Heart Gift Box With Ribbon And Thank You Tag For Valentine Engagement Party Favor
like
Find Similar
White laser-cut wedding favor box with Love motif, organza ribbon and thank you tag - White
Laser cut wedding favor box with Love silhouette and Thank You ribbon in white - Ivory
Pink laser-cut wedding candy box with Love silhouette, ribbon and thank you tag - Pink
Detail view of laser-cut gold wedding favor box with love motif and thank you tag - Gold
+3
Laser Cut Wedding Candy Box Hollow Love Heart Gift Box With Ribbon And Thank You Tag For Valentine Engagement Party Favor
$0.13
Mix MOQ : 50
Laser Cut Eiffel Tower Wedding Favor Candy Box With Ribbon Hollow Pearlescent Paper Gift Box For Party Decoration
Laser Cut Eiffel Tower Wedding Favor Candy Box With Ribbon Hollow Pearlescent Paper Gift Box For Party Decoration
like
Find Similar
Elegant laser cut white Eiffel Tower favor box with delicate organza ribbon for weddings - White
Detail of laser-cut Eiffel Tower favor box in cream paper with a white satin ribbon - Ivory
Pink laser-cut candy box with Eiffel Tower pattern and soft pink organza ribbon - Pink
Close-up of golden Eiffel Tower laser cut favor box with a delicate silk ribbon bow - Gold
+3
Laser Cut Eiffel Tower Wedding Favor Candy Box With Ribbon Hollow Pearlescent Paper Gift Box For Party Decoration
$0.13
Mix MOQ : 50
Laser Cut Wedding Favor Boxes Bird Flower Hollow Candy Gift Box Pearlescent Paper Gift Bags With Ribbon Party Decoration Accessories
Laser Cut Wedding Favor Boxes Bird Flower Hollow Candy Gift Box Pearlescent Paper Gift Bags With Ribbon Party Decoration Accessories
like
Find Similar
Close-up of laser-cut red glitter candy box with bird and floral patterns and a ribbon bow - Pearlescent Red
Silver laser-cut candy box with floral patterns and white organza ribbon - Reflective Silver
Elegant white laser-cut wedding candy box with bird patterns and silk ribbon - White
Pink laser-cut wedding candy box with bird and flower hollow pattern and white ribbon - Pink
+8
Laser Cut Wedding Favor Boxes Bird Flower Hollow Candy Gift Box Pearlescent Paper Gift Bags With Ribbon Party Decoration Accessories
$0.12
Mix MOQ : 50
European Style Laser Cut Wedding Candy Box Hollow Out Pearlescent Paper Chocolate Gift Bag With Ribbon Bow Party Favor Decor
European Style Laser Cut Wedding Candy Box Hollow Out Pearlescent Paper Chocolate Gift Bag With Ribbon Bow Party Favor Decor
like
Find Similar
Elegant white laser-cut wedding favor box with intricate hollow design and silver ribbon - White
Detailed laser-cut red lace candy box with elegant ribbon bow for wedding favors - Pearlescent Red
Elegant black laser-cut wedding favor gift box with ribbon and intricate hollow pattern - Black Khaki
Laser-cut silver hollow candy box with light blue ribbon for wedding favors - Reflective Silver
+6
NewEuropean Style Laser Cut Wedding Candy Box Hollow Out Pearlescent Paper Chocolate Gift Bag With Ribbon Bow Party Favor Decor
$0.13
Mix MOQ : 50
Laser Cut Rose Candy Boxes European Wedding Favor Gift Box Pearlescent Paper Hollowed Out Chocolate Packaging For Party
Laser Cut Rose Candy Boxes European Wedding Favor Gift Box Pearlescent Paper Hollowed Out Chocolate Packaging For Party
like
Find Similar
Pink laser-cut hollow rose favor box with organza ribbon for wedding and party gifts - Pink
Laser cut hollow rose wedding favor box with white organza ribbon on dark wood background - White
Laser cut mint green hollow rose wedding favor box with ribbon for candy and gifts - Tiffany Blue
Close-up of laser-cut purple hollow wedding candy box with rose pattern and ribbon - Dark Purple
+4
Laser Cut Rose Candy Boxes European Wedding Favor Gift Box Pearlescent Paper Hollowed Out Chocolate Packaging For Party
$0.13
Mix MOQ : 50
Heart Shaped Laser Cut Hollow LOVE Candy Box With Ribbon Bow For Wedding Valentines Day Party Favors Gift Box
Heart Shaped Laser Cut Hollow LOVE Candy Box With Ribbon Bow For Wedding Valentines Day Party Favors Gift Box
like
Find Similar
Laser-cut heart gift box with LOVE text and white ribbon for wedding party favors - White
Black heart laser-cut LOVE candy box with ribbon for weddings and Valentine's Day - Black
Golden laser cut LOVE heart wedding favor box with matching ribbon for sweets and gifts - Reflective Gold
Detail of silver laser-cut heart candy box with LOVE lettering and white silk ribbon - Reflective Silver
+4
Heart Shaped Laser Cut Hollow LOVE Candy Box With Ribbon Bow For Wedding Valentines Day Party Favors Gift Box
$0.13
Mix MOQ : 50
Laser Cut Rose Flower Candy Box Pearlescent Paper Hollow Out Gift Box For Wedding Party Favor Elegant European Chocolate Case
Laser Cut Rose Flower Candy Box Pearlescent Paper Hollow Out Gift Box For Wedding Party Favor Elegant European Chocolate Case
like
Find Similar
Laser cut white rose paper gift box with elegant ribbon for wedding and party favors - White
Close-up of pink laser-cut hollow rose candy gift box with elegant white ribbon bow - Pink
Laser cut rose candy box in light blue pearl cardstock with ribbon for wedding party - Tiffany Blue
Purple laser-cut rose candy gift box with elegant ribbon for weddings and celebrations - Dark Purple
+4
Laser Cut Rose Flower Candy Box Pearlescent Paper Hollow Out Gift Box For Wedding Party Favor Elegant European Chocolate Case
$0.13
Mix MOQ : 50
Laser Cut Love Hollow Candy Box Pearl Paper Wedding Favor Gift Box Hollow Chocolate Packaging Rectangular Decoration
Laser Cut Love Hollow Candy Box Pearl Paper Wedding Favor Gift Box Hollow Chocolate Packaging Rectangular Decoration
like
Find Similar
Golden laser-cut Love wedding favor box on porcelain plate with chocolate inside - Reflective Gold
Macro shot of silver laser-cut Love wedding favor box with pearl detail - Reflective Silver
Laser-cut white gift box with gold Love text and hollow pattern for wedding favors - White
Detail of laser-cut white wedding candy box with Love motif on an elegant table setting - Ivory
+4
Laser Cut Love Hollow Candy Box Pearl Paper Wedding Favor Gift Box Hollow Chocolate Packaging Rectangular Decoration
$0.17
Mix MOQ : 50
Laser Cut Wedding Favor Boxes Pearlescent Paper Candy Gift Box With Ribbon Thank You Tags For Baptism Party Decoration
Laser Cut Wedding Favor Boxes Pearlescent Paper Candy Gift Box With Ribbon Thank You Tags For Baptism Party Decoration
like
Find Similar
Detailed laser-cut white gift box featuring floral patterns and Thank You hang tag - 5*5cm / White
Detail of white hollow-out wedding favor box with ribbon and gold Thank You tag - 5*5cm / Ivory
Close-up of pink laser-cut wedding favor box with ribbon and Thank You tag - 5*5cm / Pink
Macro detail of laser-cut wedding favor box in light blue with groom and bride silhouette - 5*5cm / Pearl Pale Blue
+6
Laser Cut Wedding Favor Boxes Pearlescent Paper Candy Gift Box With Ribbon Thank You Tags For Baptism Party Decoration
$0.14
Mix MOQ : 50
Baby Bottle Shaped Paper Candy Box With Satin Ribbon Bow For Baby Shower Birthday Party Favor Gift Packaging Box
Baby Bottle Shaped Paper Candy Box With Satin Ribbon Bow For Baby Shower Birthday Party Favor Gift Packaging Box
like
Find Similar
2 options
Baby Bottle Shaped Paper Candy Box With Satin Ribbon Bow For Baby Shower Birthday Party Favor Gift Packaging Box
$0.06
No MOQ
Eiffel Tower Laser Cut Candy Box With Ribbon And Thank You Tag Pearl Paper Favor Box For Wedding Party Banquet Chocolate Gift
Eiffel Tower Laser Cut Candy Box With Ribbon And Thank You Tag Pearl Paper Favor Box For Wedding Party Banquet Chocolate Gift
like
Find Similar
Eiffel Tower laser cut white candy gift box with silk ribbon and thank you tag - White
Elegant white laser-cut Eiffel Tower gift box with silk ribbon and gold thank you tag - Ivory
Pink laser-cut Eiffel Tower favor box with Thank You tag and pink organza ribbon - Pink
Elegant dark green laser-cut Eiffel Tower gift box with silk ribbon and thank you tag - Pearlescent Dark Green
+2
Eiffel Tower Laser Cut Candy Box With Ribbon And Thank You Tag Pearl Paper Favor Box For Wedding Party Banquet Chocolate Gift
-7%
$0.13
Mix MOQ : 50
European Laser Cut Butterfly Wedding Candy Gift Box Artificial Pearl Paper Triangle Cake Shape Party Favor Box
European Laser Cut Butterfly Wedding Candy Gift Box Artificial Pearl Paper Triangle Cake Shape Party Favor Box
like
Find Similar
Pink pearl paper candy boxes with 3D butterfly cutouts on a light wooden background - Small / Pink
White laser cut butterfly candy boxes made of pearlescent paper for wedding gift packaging - Small / White
European style red laser-cut butterfly candy box with pearlescent finish for weddings - Small / Red
Elegant white laser-cut butterfly favor box for weddings and party candies - Small / Cream
+1
European Laser Cut Butterfly Wedding Candy Gift Box Artificial Pearl Paper Triangle Cake Shape Party Favor Box
$0.06
Mix MOQ : 50
Laser Cut Butterfly Hollow Candy Box Pearlescent Paper Gift Box For Wedding Party Favor Chocolate Packaging Packaging Case
Laser Cut Butterfly Hollow Candy Box Pearlescent Paper Gift Box For Wedding Party Favor Chocolate Packaging Packaging Case
like
Find Similar
Hollow butterfly candy box with iridescent laser mirror finish and silver ribbon - Mirror Iridescent
Golden laser-cut butterfly candy gift box with mirror finish and organza ribbon bow - Mirror Gold
Pink metallic butterfly laser-cut favor box with white organza ribbon bow for candies - Nail Powder
Elegant rose gold butterfly hollow candy gift box with white ribbon and laser cut design - Mirror Rose Gold
+1
Laser Cut Butterfly Hollow Candy Box Pearlescent Paper Gift Box For Wedding Party Favor Chocolate Packaging Packaging Case
$0.15
Mix MOQ : 50
Pineapple Shaped Candy Packaging Gift Boxes Paper DIY For Tropical Luau Party Wedding Favors Decor
Pineapple Shaped Candy Packaging Gift Boxes Paper DIY For Tropical Luau Party Wedding Favors Decor
like
Find Similar
DIY pineapple shaped gift box with green leaf top and yellow paper fruit pattern - Yellow/Green
Pineapple Shaped Candy Packaging Gift Boxes Paper DIY For Tropical Luau Party Wedding Favors Decor
$0.13
Mix MOQ : 50
 · 
10 views
Graduation Candy Box Striped Paper Gift Case With Doctoral Hat Decor And Ribbon For Party Favors Celebration
Graduation Candy Box Striped Paper Gift Case With Doctoral Hat Decor And Ribbon For Party Favors Celebration
like
Find Similar
4 options
Graduation Candy Box Striped Paper Gift Case With Doctoral Hat Decor And Ribbon For Party Favors Celebration
-8%
$0.09-0.11
No MOQ
Laser Cut Thank You Hollow Favor Boxes European Style Wedding Candy Gift Paper Box With Ribbon For Thanksgiving Party
Laser Cut Thank You Hollow Favor Boxes European Style Wedding Candy Gift Paper Box With Ribbon For Thanksgiving Party
like
Find Similar
White laser-cut thank you gift box with floral patterns and a silver ribbon bow - White
Macro shot of white laser-cut 'Thank You' favor box with floral patterns and silver ribbon - Starry White
Close-up of champagne gold laser-cut Thank You gift box with ribbon and floral patterns - Jewelry Cream Star
Pink laser-cut thank you gift box with floral pattern and white organza ribbon bow - Pink
+8
Laser Cut Thank You Hollow Favor Boxes European Style Wedding Candy Gift Paper Box With Ribbon For Thanksgiving Party
$0.13
Mix MOQ : 50
Laser Cut Hollow Wedding Favor Boxes With Ribbon Pearlescent Paper Floral Candy Gift Box For Engagement Party Decorations
Laser Cut Hollow Wedding Favor Boxes With Ribbon Pearlescent Paper Floral Candy Gift Box For Engagement Party Decorations
like
Find Similar
Elegant red laser-cut lace candy box with silk ribbon for wedding party favors - Pearlescent Red
Close-up of silver laser-cut lace candy box with light blue silk ribbon and bow - Reflective Silver
Elegant white laser-cut wedding favor box with floral patterns and a white organza ribbon - White
Detail of pink laser-cut lace candy box featuring a delicate ribbon bow and floral pattern - Pink
+6
Laser Cut Hollow Wedding Favor Boxes With Ribbon Pearlescent Paper Floral Candy Gift Box For Engagement Party Decorations
$0.13
Mix MOQ : 50
Laser Cut Swan Heart Candy Box With Ribbon Bow Pearlescent Paper Wedding Party Favor Gift Box Hollow Chocolate Treat Boxes
Laser Cut Swan Heart Candy Box With Ribbon Bow Pearlescent Paper Wedding Party Favor Gift Box Hollow Chocolate Treat Boxes
like
Find Similar
Elegant white laser-cut swan heart wedding favor box with a delicate white organza ribbon - White
Close-up of white laser-cut wedding favor box featuring swan heart design and organza ribbon - Ivory
Pink laser cut wedding gift box featuring hollow swan heart design and organza ribbon - Pink
Detailed laser-cut gold swan heart wedding candy box with elegant ribbon bow tie - Gold
+7
Laser Cut Swan Heart Candy Box With Ribbon Bow Pearlescent Paper Wedding Party Favor Gift Box Hollow Chocolate Treat Boxes
$0.13
No MOQ
Go to

More in party supplies

Explore more in favor boxes

partygoldartificialdecorativeheartstoragehandmadestorage boxtagsdecoration accessories
hollowshapesquarewindowsmalltasselwrappingflippackaging baggift wrapping

Ready to source like an insider

Get a direct line to the factory floor — no minimums, no middlemen, no guesswork.
iconReal factory pricing, no markup in betweeniconEvery order hand-inspected before it shipsicon5,000+ new products added daily
Get Inside Access