Everful

Wholesale favor boxes

Factory-direct selection, vetted for quality and ready to order.

Sign Up
Favor Boxes

Find the perfect pieces: party gift bags, party favors, gift wrapping supplies and more

filterShow Filters
Best Seller
New Arrivals
Price Drop
Free Shipping
Halloween Gift Boxes Paperboard Portable Candy Treat Bags Pumpkin Witch Patterns Festive Party Favors For Kids
Halloween Gift Boxes Paperboard Portable Candy Treat Bags Pumpkin Witch Patterns Festive Party Favors For Kids
like
Find Similar
Halloween portable paper candy gift box with pumpkin and witch motifs in green and orange - Green Halloween Party Box
Halloween children's pumpkin gift box with portable handle and night scene illustration - Dark Blue Halloween Party Box
Set of four colorful Halloween paper gift boxes with handles and spooky festive designs - Mixed Halloween Party Boxes
Orange Halloween candy gift box featuring pumpkin and ghost prints with handle - Orange Halloween Party Box
+1
Halloween Gift Boxes Paperboard Portable Candy Treat Bags Pumpkin Witch Patterns Festive Party Favors For Kids
-5%
$0.33
No MOQ
 · 
10 views
Vintage Rose Floral Tea Cup Shaped Paper Gift Boxes DIY Candy Favor Packaging For Wedding Party European Style
Vintage Rose Floral Tea Cup Shaped Paper Gift Boxes DIY Candy Favor Packaging For Wedding Party European Style
like
Find Similar
Pink vintage rose pattern paper gift box in teacup shape with saucer for wedding favors - Pink Teacup
Vintage mint green floral paper tea cup favor box with gold crown patterns and handles - Blue Teacup
Vintage Rose Floral Tea Cup Shaped Paper Gift Boxes DIY Candy Favor Packaging For Wedding Party European Style
$0.11
Mix MOQ : 100
 · 
24 views
Hollow Cross Favor Boxes White Cardboard Candy Gift Boxes With Satin Ribbon For Wedding Baptism Party Elegant Multicolor
Hollow Cross Favor Boxes White Cardboard Candy Gift Boxes With Satin Ribbon For Wedding Baptism Party Elegant Multicolor
like
Find Similar
White gift box with golden hollow cross and ribbon for weddings and christenings - Gold Cross + Gold Ribbon
Blue hollow cross gift boxes with ribbons for baptism and wedding candy packaging - Blue Cross + Blue Ribbon
Laser-cut cross favor boxes with pink ribbon for baptism and wedding candy packaging - Pink Cross + Pink Ribbon
Hollow Cross Favor Boxes White Cardboard Candy Gift Boxes With Satin Ribbon For Wedding Baptism Party Elegant Multicolor
$0.14
Mix MOQ : 50
Laser Cut It's A Girl Baby Shower Candy Box Stroller Heart Design Pearlescent Paper Gift Box For Newborn Birthday Party Favors
Laser Cut It's A Girl Baby Shower Candy Box Stroller Heart Design Pearlescent Paper Gift Box For Newborn Birthday Party Favors
like
Find Similar
White laser cut baby carriage favor box with It's A Girl text and organza ribbon bow - White
Detailed laser-cut pink gift box with It's A Girl text and ribbon for baby shower party - Pink
Detailed laser cut gold candy box featuring It's A Girl text and organza ribbon bow - Gold
Laser cut yellow It's A Girl baby shower gift box with stroller design and organza bow - Lemon Yellow
+6
Laser Cut It's A Girl Baby Shower Candy Box Stroller Heart Design Pearlescent Paper Gift Box For Newborn Birthday Party Favors
-7%
$0.12
Mix MOQ : 50
Eiffel Tower Laser Cut Candy Box Ribbon Romantic Hollow Out Favor Box For Wedding Birthday Party Decoration Pearl Paper Gift Box
Eiffel Tower Laser Cut Candy Box Ribbon Romantic Hollow Out Favor Box For Wedding Birthday Party Decoration Pearl Paper Gift Box
like
Find Similar
Detailed laser-cut Eiffel Tower pattern on red pearlescent paper wedding favor box - Pearlescent Red
Silver laser-cut Eiffel Tower gift box with light blue ribbon for wedding favors - Reflective Silver
Elegant white laser-cut Eiffel Tower favor box with pearl paper and a white ribbon bow - White
Detail of pink laser-cut Eiffel Tower favor box with pearlescent finish and ribbon - Pink
+6
Eiffel Tower Laser Cut Candy Box Ribbon Romantic Hollow Out Favor Box For Wedding Birthday Party Decoration Pearl Paper Gift Box
$0.12
Mix MOQ : 50
Elegant Laser Cut Wedding Favor Boxes Heart Champagne Glass Paper Candy Gift Box With Ribbon For Bridal Shower Birthday Party
Elegant Laser Cut Wedding Favor Boxes Heart Champagne Glass Paper Candy Gift Box With Ribbon For Bridal Shower Birthday Party
like
Find Similar
Detail of red laser-cut favor box with vine hollow patterns and decorative silk ribbon - Pearlescent Red
Macro shot of silver hollow gift box with blue ribbon bow for wedding celebrations - Reflective Silver
Pink laser cut wedding favor box with champagne glass design and elegant silk ribbon bow - Pink
Golden laser-cut gift box featuring intricate vine patterns and a silk ribbon bow - Gold
+6
Elegant Laser Cut Wedding Favor Boxes Heart Champagne Glass Paper Candy Gift Box With Ribbon For Bridal Shower Birthday Party
$0.13
Mix MOQ : 50
Rocking Horse Laser Cut Candy Box Pearlescent Paper Gift Box With Ribbon For Baby Shower Wedding Birthday Party Favors
Rocking Horse Laser Cut Candy Box Pearlescent Paper Gift Box With Ribbon For Baby Shower Wedding Birthday Party Favors
like
Find Similar
Detail of laser-cut hollow rocking horse candy box in gold with ribbon for baby parties - Reflective Gold
Hollow rocking horse laser-cut candy box with white ribbon for baby shower party - White
Detail of laser-cut rocking horse candy box with creamy white paper and organza ribbon bow - Ivory
Pink laser-cut candy box with rocking horse design and elegant white chiffon ribbon - Pink
+6
Rocking Horse Laser Cut Candy Box Pearlescent Paper Gift Box With Ribbon For Baby Shower Wedding Birthday Party Favors
$0.13
Mix MOQ : 50
Elegant Hollow Swan Heart Laser Cut Paper Wedding Favor Box with Ribbon Romantic Party Candy Gift Box Table Decoration
Elegant Hollow Swan Heart Laser Cut Paper Wedding Favor Box with Ribbon Romantic Party Candy Gift Box Table Decoration
like
Find Similar
Elegant white laser cut swan hollow candy gift box with ribbon for wedding party favors - White
Detail of laser-cut white favor box featuring swan heart design and white silk ribbon - Ivory
Laser-cut hollow swan wedding candy box in light pink with white sheer ribbon on porcelain - Pink
Close-up of sky blue laser-cut candy box with swan heart design and organza ribbon - Tiffany Blue
+5
Elegant Hollow Swan Heart Laser Cut Paper Wedding Favor Box with Ribbon Romantic Party Candy Gift Box Table Decoration
$0.13
Mix MOQ : 50
Laser Cut Hollow Rose Flower Candy Box With Ribbon Cardstock Gift Boxes For Wedding Party Valentine's Day Favor Boxes
Laser Cut Hollow Rose Flower Candy Box With Ribbon Cardstock Gift Boxes For Wedding Party Valentine's Day Favor Boxes
like
Find Similar
White laser-cut rose hollow paper gift box with elegant white ribbon for weddings - White
Detail of white laser-cut rose gift box with elegant organza ribbon on ceramic tray - Ivory
Detailed macro view of laser-cut rose patterns on pink paper gift box with ribbon - Pink
Detail of light blue laser-cut hollow rose wedding favor box with a matching silk ribbon - Tiffany Blue
+5
Laser Cut Hollow Rose Flower Candy Box With Ribbon Cardstock Gift Boxes For Wedding Party Valentine's Day Favor Boxes
$0.13
Mix MOQ : 50
Ramadan Eid Mubarak Candy Gift Box Laser Cut Pearlescent Paper Moon Star Mosque Hollow Paper Boxes For Wedding Party Favor
Ramadan Eid Mubarak Candy Gift Box Laser Cut Pearlescent Paper Moon Star Mosque Hollow Paper Boxes For Wedding Party Favor
like
Find Similar
Macro detail of Eid Mubarak white candy box with golden lid and laser-cut mosque patterns - White / 5*5*8CM
Pink and gold laser-cut Eid gift box with moon and mosque patterns in 45-degree view - Pink / 5*5*8CM
Detail of laser-cut moon and mosque pattern on light blue and gold gift box - Tiffany Blue / 5*5*8CM
Detail of golden laser-cut candy box with moon, heart, and mosque patterns for Ramadan - Gold / 5*5*8CM
+5
Ramadan Eid Mubarak Candy Gift Box Laser Cut Pearlescent Paper Moon Star Mosque Hollow Paper Boxes For Wedding Party Favor
$0.23
Mix MOQ : 50
Hollow Cross Laser Cut Candy Box With Ribbon Thank You Tag For Wedding Party Baptism Favors Paper Gift Box Sweet Storage
Hollow Cross Laser Cut Candy Box With Ribbon Thank You Tag For Wedding Party Baptism Favors Paper Gift Box Sweet Storage
like
Find Similar
Detailed laser-cut white wedding candy box with cross pattern, ribbon, and thank you tag - White
White hollow lace wedding candy box with cross laser cut and thank you tag ribbon - Ivory
Pink laser-cut candy box with cross pattern, white organza ribbon and thank you tag - Pink
Detail of light blue laser-cut favor box with cross pattern and Thank You card tag - Pearl Pale Blue
+4
Hollow Cross Laser Cut Candy Box With Ribbon Thank You Tag For Wedding Party Baptism Favors Paper Gift Box Sweet Storage
$0.13
Mix MOQ : 50
Laser Cut Cross Hollow Candy Boxes With Ribbon Thank You Tags Paper Gift Boxes For Wedding Baptism Party Favors Decoration
Laser Cut Cross Hollow Candy Boxes With Ribbon Thank You Tags Paper Gift Boxes For Wedding Baptism Party Favors Decoration
like
Find Similar
White laser-cut candy box with hollow cross design, ribbon bow and thank you tag - White
Elegant white laser-cut hollow cross candy gift box with white ribbon and thank you tag - Ivory
Laser-cut light blue candy gift box with hollow cross design, ribbon, and thank you tag - Pearl Pale Blue
Red laser-cut hollow cross candy box with ribbon and Thank You tag for weddings - Pearlescent Red
+4
Laser Cut Cross Hollow Candy Boxes With Ribbon Thank You Tags Paper Gift Boxes For Wedding Baptism Party Favors Decoration
$0.13
Mix MOQ : 50
Laser Cut Tropical Leaf Favor Box Hollow Paper Candy Box With Ribbon Bow For Wedding Party Thanksgiving Gift Packaging
Laser Cut Tropical Leaf Favor Box Hollow Paper Candy Box With Ribbon Bow For Wedding Party Thanksgiving Gift Packaging
like
Find Similar
Macro detail of laser-cut tropical leaf patterns on a white wedding favor gift box - White
Macro shot of ivory laser-cut gift box with tropical leaf patterns and white organza ribbon - Ivory
Close-up of pink laser-cut candy box with tropical leaf pattern and white organza ribbon - Pink
Close-up of laser-cut tropical leaf patterns on a mint green party favor gift box - Tiffany Blue
+7
Laser Cut Tropical Leaf Favor Box Hollow Paper Candy Box With Ribbon Bow For Wedding Party Thanksgiving Gift Packaging
$0.13
Mix MOQ : 50
Laser Cut Hollow Cross Favor Box European Style Paper Candy Boxes With Ribbon For Wedding Baptism Party Religious Event
Laser Cut Hollow Cross Favor Box European Style Paper Candy Boxes With Ribbon For Wedding Baptism Party Religious Event
like
Find Similar
Elegant white laser-cut hollow cross gift box with white organza ribbon for weddings - White
Macro detail of laser-cut white favor box with elegant cross pattern and white ribbon - Ivory
Pink laser-cut cross favor box with white ribbon for wedding or baptism events - Pink
Detail of gold hollow cross candy box with laser cut floral patterns and organza ribbon - Gold
+7
Laser Cut Hollow Cross Favor Box European Style Paper Candy Boxes With Ribbon For Wedding Baptism Party Religious Event
$0.13
Mix MOQ : 50
Laser Cut Wedding Favor Candy Boxes With Ribbon Heart Groom Bride Hollow Paper Gift Box For Engagement Valentine Party
Laser Cut Wedding Favor Candy Boxes With Ribbon Heart Groom Bride Hollow Paper Gift Box For Engagement Valentine Party
like
Find Similar
Detail of white laser-cut wedding favor box with Mr & Mrs silhouette and organza ribbon - White
Laser-cut white wedding favor box with Mr & Mrs heart silhouette and organza ribbon - Ivory
Pink laser cut wedding candy box with Mr & Mrs heart pattern and white ribbon bow - Pink
Golden laser cut wedding favor box with Mr & Mrs heart design and organza ribbon - Gold
+7
Laser Cut Wedding Favor Candy Boxes With Ribbon Heart Groom Bride Hollow Paper Gift Box For Engagement Valentine Party
$0.12
Mix MOQ : 50
Christmas Paper Gift Box Cartoon Santa Claus Snowman Printed Handheld Triangular Packaging Favor Treat Boxes Holiday Party Decoration
Christmas Paper Gift Box Cartoon Santa Claus Snowman Printed Handheld Triangular Packaging Favor Treat Boxes Holiday Party Decoration
like
Find Similar
Set of 12 Christmas candy boxes with snowman and Santa designs including dimensions - Handheld Horn Style (Christmas Horn Box) / Set of 12
Christmas pyramid candy box with snowman and reindeer illustrations, 10-piece set - Triangular Pyramid Style (Christmas Triangle Box) / 10 Pieces Pack
Christmas Paper Gift Box Cartoon Santa Claus Snowman Printed Handheld Triangular Packaging Favor Treat Boxes Holiday Party Decoration
-4%
$0.88-2.96
No MOQ
Simple Black White Square Gift Box With White Satin Ribbon Bow And Gold Glitter Heart Pattern For Wedding Birthday Party Favors Packaging
Simple Black White Square Gift Box With White Satin Ribbon Bow And Gold Glitter Heart Pattern For Wedding Birthday Party Favors Packaging
like
Find Similar
Elegant black and white square gift box with gold glitter hearts and white satin bow - Black Gold Heart Pattern Style / 10 Pieces/Pack (10x10x8cm)
Simple Black White Square Gift Box With White Satin Ribbon Bow And Gold Glitter Heart Pattern For Wedding Birthday Party Favors Packaging
$0.81
No MOQ
 · 
12 views
Graduation Cap Gift Box Doctoral Hat Paper Candy Box With Tassels Stickers For Graduation Party Favors Celebration Decor
Graduation Cap Gift Box Doctoral Hat Paper Candy Box With Tassels Stickers For Graduation Party Favors Celebration Decor
like
Find Similar
Detail of DIY graduation cap favor box with black matte finish and yellow tassel - Black (Without Stickers)
Detail view of navy blue graduation cap candy box with a yellow silk tassel on a white plate - Blue (Without Stickers)
Navy graduation cap candy boxes with gold tassels and Class of 2026 stickers set - Blue (With Stickers)
Black graduation cap gift boxes with gold tassels and Class of 2023 decorative stickers - Black (With Stickers)
Graduation Cap Gift Box Doctoral Hat Paper Candy Box With Tassels Stickers For Graduation Party Favors Celebration Decor
$0.10
No MOQ
European Laser Cut Pearl Paper Wedding Favor Candy Box Bride Groom Silhouette Gift Box With Ribbon For Party Chocolate
European Laser Cut Pearl Paper Wedding Favor Candy Box Bride Groom Silhouette Gift Box With Ribbon For Party Chocolate
like
Find Similar
Elegant white laser-cut wedding favor box with bride and groom silhouette and organza ribbon - White
Elegant laser cut pink wedding candy box with bride and groom silhouette and ribbon - Pink
European style light blue laser cut wedding favor box with bride and groom silhouette - Turquoise Blue
Elegant gold laser-cut wedding favor box with romantic couple silhouette and ribbon - Reflective Gold
+5
European Laser Cut Pearl Paper Wedding Favor Candy Box Bride Groom Silhouette Gift Box With Ribbon For Party Chocolate
$0.13
Mix MOQ : 50
Laser Cut Wedding Candy Box Bride and Groom Silhouette Pearl Paper Hollow Favor Box With Ribbon And Thank You Tags For Marriage Party
Laser Cut Wedding Candy Box Bride and Groom Silhouette Pearl Paper Hollow Favor Box With Ribbon And Thank You Tags For Marriage Party
like
Find Similar
Ivory laser cut wedding favor box with bride groom silhouette and thank you tag - White
Pink laser-cut ivory wedding favor box with bride and groom silhouette and ribbon - Pink
Laser cut light blue wedding favor box with bride groom silhouette and ribbon - Turquoise Blue
Mirror gold laser-cut wedding candy box with bride groom silhouette and gold ribbon - Reflective Gold
+5
Laser Cut Wedding Candy Box Bride and Groom Silhouette Pearl Paper Hollow Favor Box With Ribbon And Thank You Tags For Marriage Party
$0.14
Mix MOQ : 50
European Laser Cut Crown Hollow Candy Box Pearl Paper Floral Gift Box For Wedding Party Celebration Chocolate Favor Box
European Laser Cut Crown Hollow Candy Box Pearl Paper Floral Gift Box For Wedding Party Celebration Chocolate Favor Box
like
Find Similar
Silver laser-cut candy box with crown hollow design and intricate floral patterns - Reflective Silver
Close-up of elegant laser-cut floral patterns and crown top on white paper wedding favor box - White
Pink laser cut candy box with crown top and floral hollow design for wedding favors - Pink
Elegant gold laser-cut candy box with crown top and floral pattern for weddings - Gold
+5
European Laser Cut Crown Hollow Candy Box Pearl Paper Floral Gift Box For Wedding Party Celebration Chocolate Favor Box
$0.15
Mix MOQ : 50
Laser Cut Angel Star Hollow Paper Favor Box With Ribbon Elegant Candy Gift Packaging For Wedding Baptism Baby Shower
Laser Cut Angel Star Hollow Paper Favor Box With Ribbon Elegant Candy Gift Packaging For Wedding Baptism Baby Shower
like
Find Similar
Pink hollow baby shower gift box with laser-cut angel and star patterns for candies - Pink
Detail of purple laser-cut gift box with angel and star patterns and organza ribbon - Dark Purple
Detail of white laser-cut angel gift box with stars, clouds and a silver ribbon bow - White
Close-up of red house-shaped gift box with hollow angel pattern and silk ribbon - Pearlescent Red
+9
Laser Cut Angel Star Hollow Paper Favor Box With Ribbon Elegant Candy Gift Packaging For Wedding Baptism Baby Shower
$0.12
Mix MOQ : 50
European Laser Cut Wedding Favor Candy Boxes Mr & Mrs Couple Silhouette Pearl Paper Gift Box With Ribbon For Bridal Party
European Laser Cut Wedding Favor Candy Boxes Mr & Mrs Couple Silhouette Pearl Paper Gift Box With Ribbon For Bridal Party
like
Find Similar
Elegant red laser-cut wedding candy box with MR & MRS text and matching ribbon - Pearlescent Red
Silver laser-cut Mr & Mrs wedding favor box with a light blue silk ribbon decoration - Reflective Silver
White laser-cut wedding favor box featuring Mr & Mrs silhouettes with a white ribbon bow - White
Pink laser-cut wedding favor box with Mr & Mrs silhouette and white ribbon bow - Pink
+11
European Laser Cut Wedding Favor Candy Boxes Mr & Mrs Couple Silhouette Pearl Paper Gift Box With Ribbon For Bridal Party
$0.12
Mix MOQ : 50
Christmas Gift Boxes Kraft Paper Candy Packaging Clear Window Reindeer Santa Cookie Boxes Holiday Party Favors
Christmas Gift Boxes Kraft Paper Candy Packaging Clear Window Reindeer Santa Cookie Boxes Holiday Party Favors
like
Find Similar
Christmas kraft paper gift boxes with windows and festive prints on a wooden surface - Set of 24
Christmas Gift Boxes Kraft Paper Candy Packaging Clear Window Reindeer Santa Cookie Boxes Holiday Party Favors
$2.02-10.37
No MOQ
 · 
44 views
Elegant Laser Cut Wedding Favor Boxes Bird Flower Pattern Pearl Paper Candy Gift Boxes With Ribbon For Party Anniversary
Elegant Laser Cut Wedding Favor Boxes Bird Flower Pattern Pearl Paper Candy Gift Boxes With Ribbon For Party Anniversary
like
Find Similar
White laser-cut bird and flower gift box with white satin ribbon on wood surface - White
Pink laser cut wedding favor box with bird and flower patterns and a white ribbon bow - Pink
Purple laser-cut favor box featuring intricate bird and floral patterns with ribbon - Dark Purple
Laser-cut light blue candy gift box with bird patterns and a delicate chiffon ribbon bow - Tiffany Blue
+8
Elegant Laser Cut Wedding Favor Boxes Bird Flower Pattern Pearl Paper Candy Gift Boxes With Ribbon For Party Anniversary
$0.13
Mix MOQ : 50
Elegant Butterfly Candy Boxes Laser Cut Hollow Out Pearl Paper Gift Box With Ribbon For Wedding Party Birthday Favor
Elegant Butterfly Candy Boxes Laser Cut Hollow Out Pearl Paper Gift Box With Ribbon For Wedding Party Birthday Favor
like
Find Similar
Detail of laser-cut butterfly wedding favor box with cream paper and pink ribbon - Champagne
Detail of yellow laser-cut butterfly favor box with ribbon bow and hollow star patterns - Gold Yellow
Macro detail of laser-cut butterfly gift box in light blue with elegant white ribbon bow - Teal Blue
Elegant purple laser cut butterfly wedding favor box with a satin ribbon on white floral background - Deep purple
+8
Elegant Butterfly Candy Boxes Laser Cut Hollow Out Pearl Paper Gift Box With Ribbon For Wedding Party Birthday Favor
$0.13
Mix MOQ : 50
Elegant Laser Cut Butterfly Floral Pearlescent Paper Favor Box European Style Wedding Candy Gift Packaging With Ribbon
Elegant Laser Cut Butterfly Floral Pearlescent Paper Favor Box European Style Wedding Candy Gift Packaging With Ribbon
like
Find Similar
White laser-cut butterfly gift box with floral patterns and white organza ribbon bow - White
Elegant red laser-cut candy box with butterfly hollow pattern and matching silk ribbon - Pearlescent Red
Elegant laser-cut flower hollow gift box with golden ribbon for European party candy packaging - Beige Gold
Detail of silver laser-cut wedding favor box with floral patterns and blue ribbon bow - Reflective Silver
+5
Elegant Laser Cut Butterfly Floral Pearlescent Paper Favor Box European Style Wedding Candy Gift Packaging With Ribbon
$0.12
Mix MOQ : 50
Princess Dress Shape Laser Cut Glitter Paper Favor Box Elegant Hollow Out Floral Candy Gift Box For Wedding Party Favor
Princess Dress Shape Laser Cut Glitter Paper Favor Box Elegant Hollow Out Floral Candy Gift Box For Wedding Party Favor
like
Find Similar
Silver glitter ballerina favor box with laser-cut hollow lace dress and ribbon bow - Silver Glitter
Elegant gold glitter bride silhouette candy box with laser-cut floral lace details - Glitter Rose Gold
Red glitter hollow-out princess gown wedding favor box with elegant rose lace patterns - Glitter Red
Blue glitter princess dress candy box with laser-cut lace and organza ribbon bow - Glitter Royal Blue
+5
Princess Dress Shape Laser Cut Glitter Paper Favor Box Elegant Hollow Out Floral Candy Gift Box For Wedding Party Favor
-5%
$0.17
Mix MOQ : 50
Laser Cut Love You Mom Candy Boxes With Ribbon Elegant Mother's Day Gift Boxes For Chocolate Party Favor Pearlescent Paper Box
Laser Cut Love You Mom Candy Boxes With Ribbon Elegant Mother's Day Gift Boxes For Chocolate Party Favor Pearlescent Paper Box
like
Find Similar
Close-up of laser-cut 'Love You Mom' white candy box with elegant floral patterns and ribbon - 5*5*8CM / White
Detail of pink laser-cut gift box with Love you mom text and white ribbon bow - 5*5*8CM / Pink
Cream laser-cut 'love you mom' gift box with floral patterns and a silk ribbon bow - 5*5*8CM / Jewelry Cream Star
Light blue Mother's Day gift box with Love You Mom laser-cut design and satin ribbon - 5*5*8CM / Tiffany Blue
+6
Laser Cut Love You Mom Candy Boxes With Ribbon Elegant Mother's Day Gift Boxes For Chocolate Party Favor Pearlescent Paper Box
$0.13
Mix MOQ : 50
Christmas Candy Gift Box Tinplate Metal Handheld Suitcase Shape Portable Storage Container Holiday Party Favor Organizer
Christmas Candy Gift Box Tinplate Metal Handheld Suitcase Shape Portable Storage Container Holiday Party Favor Organizer
like
Find Similar
Blue Christmas tin suitcase with Santa and Reindeer print, 20x18.5x6cm metal gift box - Santa Claus
Christmas snowman tin storage box with gold handle and cozy winter theme pattern - Snowman
Red Christmas nutcracker tin storage box with golden handle and festive illustration - Nutcracker
Red Christmas tin storage box with festive wreath and gold handle, 20x18.5x6cm - Christmas Wreath
Christmas Candy Gift Box Tinplate Metal Handheld Suitcase Shape Portable Storage Container Holiday Party Favor Organizer
-4%
$4.44
No MOQ
 · 
20 views
Laser Hollow Christmas Tree Candy Box Pearlescent Paper Gift Box With Ribbon For Wedding Party Festival Favor Box
Laser Hollow Christmas Tree Candy Box Pearlescent Paper Gift Box With Ribbon For Wedding Party Festival Favor Box
like
Find Similar
White laser-cut Christmas tree candy box with white organza ribbon bow for wedding party - White
Golden laser-cut Christmas tree candy box with sparkling finish and ribbon bow - Gold
Detail of laser-cut Christmas tree patterns on a Tiffany blue pearl paper gift box - Tiffany Blue
Laser-cut red glitter Christmas tree gift box with elegant ribbon for festive candy treats - Pearlescent Red
+3
Laser Hollow Christmas Tree Candy Box Pearlescent Paper Gift Box With Ribbon For Wedding Party Festival Favor Box
$0.13
Mix MOQ : 50
Hollow Leaf Laser Cut Candy Box Pearlescent Paper Wedding Favor Box Ribbon Gift Packaging For Chocolate Party Decorations
Hollow Leaf Laser Cut Candy Box Pearlescent Paper Wedding Favor Box Ribbon Gift Packaging For Chocolate Party Decorations
like
Find Similar
Elegant pearlescent white laser-cut hollow leaf wedding favor box with a silk ribbon bow - White
Elegant red laser-cut candy box with floral leaf patterns and a red ribbon bow - Pearlescent Red
Elegant European matte black laser-cut hollow leaf gift box with a black ribbon bow - Black
Pearly bright blue candy box with laser cut leaf patterns and matching silk ribbon bow - Teal Blue
+7
Hollow Leaf Laser Cut Candy Box Pearlescent Paper Wedding Favor Box Ribbon Gift Packaging For Chocolate Party Decorations
-7%
$0.12
Mix MOQ : 50
European Style Crown Laser Cut Candy Box Floral Paper Gift Box For Wedding Party Favor Chocolate Packaging
European Style Crown Laser Cut Candy Box Floral Paper Gift Box For Wedding Party Favor Chocolate Packaging
like
Find Similar
Close-up of laser-cut crown favor box with intricate floral hollow pattern in white - White
Detailed close-up of ivory laser-cut candy box with ornate crown and floral patterns - Ivory
Pink laser-cut candy box with intricate floral hollow design and crown top for weddings - Pink
Detailed laser-cut pattern of crown wedding favor box in elegant cream finish - Jewelry Cream Star
+7
European Style Crown Laser Cut Candy Box Floral Paper Gift Box For Wedding Party Favor Chocolate Packaging
$0.15
Mix MOQ : 50
Laser Cut Rose Wedding Favor Boxes With Ribbon Elegant European Style Paper Candy Gift Boxes For Party Reception Table Decor
Laser Cut Rose Wedding Favor Boxes With Ribbon Elegant European Style Paper Candy Gift Boxes For Party Reception Table Decor
like
Find Similar
Elegant white laser-cut rose candy box with silk ribbon for wedding party favors - White
Detailed laser-cut rose pattern on premium white paper wedding candy gift box with silk ribbon - Ivory
Macro shot of laser-cut rose hollow candy box in pink pearlescent paper with organza ribbon - Pink
Light blue laser-cut wedding candy box with rose pattern and silk ribbon bow - Tiffany Blue
+7
Laser Cut Rose Wedding Favor Boxes With Ribbon Elegant European Style Paper Candy Gift Boxes For Party Reception Table Decor
$0.16
Mix MOQ : 50
Elegant Laser Cut Pearl Paper Wedding Favor Candy Boxes With Satin Ribbon Hollow Love Heart Design For Party Gift Packaging
Elegant Laser Cut Pearl Paper Wedding Favor Candy Boxes With Satin Ribbon Hollow Love Heart Design For Party Gift Packaging
like
Find Similar
White laser cut LOVE wedding favor box with intricate patterns and elegant white ribbon - White
Pink laser-cut hollow LOVE candy box with white organza ribbon for wedding gift favors - Pink
Elegant purple laser-cut LOVE candy gift box with silk ribbon bow for weddings - Dark Purple
Golden laser cut Love wedding favor box with an orange ribbon bow for sweets - Reflective Gold
+4
Elegant Laser Cut Pearl Paper Wedding Favor Candy Boxes With Satin Ribbon Hollow Love Heart Design For Party Gift Packaging
-7%
$0.12
Mix MOQ : 50
Heart Shaped Laser Cut Candy Box With Ribbon LOVE Hollow Design Pearl Paper Gift Box For Wedding Party Favor Packaging
Heart Shaped Laser Cut Candy Box With Ribbon LOVE Hollow Design Pearl Paper Gift Box For Wedding Party Favor Packaging
like
Find Similar
Detail of white laser-cut wedding favor box featuring IN LOVE hollow heart pattern - White
Golden laser cut LOVE heart wedding favor box with matching ribbon for sweets and gifts - Reflective Gold
Detail of silver laser-cut heart candy box with LOVE lettering and white silk ribbon - Reflective Silver
Top view of pink heart-shaped paper gift box with laser-cut IN LOVE design and ribbon - Pink
+4
Heart Shaped Laser Cut Candy Box With Ribbon LOVE Hollow Design Pearl Paper Gift Box For Wedding Party Favor Packaging
-7%
$0.13
Mix MOQ : 50
Heart Laser Cut Candy Box Pearl Paper Gift Boxes For Wedding Party Valentine's Day DIY Folding Hollow Ribbon Favor Box
Heart Laser Cut Candy Box Pearl Paper Gift Boxes For Wedding Party Valentine's Day DIY Folding Hollow Ribbon Favor Box
like
Find Similar
Elegant laser cut heart wedding favor box with white ribbon and floral vine patterns - White
Macro detail of laser-cut vine patterns on a black heart-shaped gift box with a silk bow - Black
Golden heart laser-cut hollow candy gift box with yellow ribbon bow for wedding party - Reflective Gold
Detail of silver heart-shaped hollow gift box with reflective finish and white ribbon bow - Reflective Silver
+4
Heart Laser Cut Candy Box Pearl Paper Gift Boxes For Wedding Party Valentine's Day DIY Folding Hollow Ribbon Favor Box
$0.14
Mix MOQ : 50
Christmas Gift Boxes Pyramid Shape Candy Packaging With Ribbon Cardboard Cartoon Santa Reindeer Pattern Holiday Party Favor
Christmas Gift Boxes Pyramid Shape Candy Packaging With Ribbon Cardboard Cartoon Santa Reindeer Pattern Holiday Party Favor
like
Find Similar
Green Christmas gift box with festive snowman and Santa motifs and a satin handle - Green Santa/Snowman
Red Christmas candy gift box with silk ribbon and festive Merry Christmas patterns - Red Spherical Santa
Red pyramid Christmas gift box with green trees and a red satin ribbon bow - Red Pyramid Christmas Tree
Reindeer design Christmas pyramid gift box with green ribbon and Merry Christmas text - Green Pyramid Reindeer
+1
Christmas Gift Boxes Pyramid Shape Candy Packaging With Ribbon Cardboard Cartoon Santa Reindeer Pattern Holiday Party Favor
$0.14
No MOQ
Heart Shaped Candy Boxes Reflective Mirror Metallic Finish Paper Gift Packaging Wedding Birthday Party Favors Folding
Heart Shaped Candy Boxes Reflective Mirror Metallic Finish Paper Gift Packaging Wedding Birthday Party Favors Folding
like
Find Similar
Elegant mirror gold heart-shaped candy gift box with cross-fold closure for weddings - Reflective Gold
Macro view of silver mirror cube gift box with unique butterfly cross closure lid - Reflective Silver
Glossy red heart-shaped gift box with creative cubic structure for weddings and parties - Reflective Bright Red
Elegant blue metallic cube gift box with unique interlocking top for party favors - Reflective Blue
+1
Heart Shaped Candy Boxes Reflective Mirror Metallic Finish Paper Gift Packaging Wedding Birthday Party Favors Folding
$0.14
Mix MOQ : 50
 · 
16 views
European Style Hollow Baby Footprint Candy Box Creative Paper Baby Shower Favor Gift Box With Ribbon For Birthday Party Decor
European Style Hollow Baby Footprint Candy Box Creative Paper Baby Shower Favor Gift Box With Ribbon For Birthday Party Decor
like
Find Similar
White baby shower candy box with blue ribbon bow and footprints for party favors - Dark Blue
Pink and white hollow baby footprint candy boxes with silk ribbons on a gold-rimmed plate - Pink
Mint green hollow baby footprint candy box with white lid and matching ribbon bow decoration - Green
European baby shower candy box with hollow footprints design and purple satin ribbon - Purple
+1
European Style Hollow Baby Footprint Candy Box Creative Paper Baby Shower Favor Gift Box With Ribbon For Birthday Party Decor
$0.10
Mix MOQ : 50
 · 
13 views
Christmas Snowman Laser Cut Candy Box With Ribbon Pearlescent Paper Gift Boxes For Holiday Wedding Party Favors
Christmas Snowman Laser Cut Candy Box With Ribbon Pearlescent Paper Gift Boxes For Holiday Wedding Party Favors
like
Find Similar
Detailed laser-cut white Christmas favor box with snowman motif and large white ribbon bow - White
Green Christmas snowman gift box with laser-cut design and satin ribbon bow decoration - Dark Green
Champagne laser-cut snowman gift box with organza ribbon for Christmas candy - Gold
Red Christmas snowman hollow gift box with ribbon for festive candy and chocolate packaging - Pearlescent Red
+2
Christmas Snowman Laser Cut Candy Box With Ribbon Pearlescent Paper Gift Boxes For Holiday Wedding Party Favors
$0.13
Mix MOQ : 50
Christmas Gift Bags Santa Claus Snowman Reindeer Pattern Portable Paper Candy Box Holiday Party Favor Decorative Packaging
Christmas Gift Bags Santa Claus Snowman Reindeer Pattern Portable Paper Candy Box Holiday Party Favor Decorative Packaging
like
Find Similar
Santa Claus Christmas Eve apple gift box with green lattice decorative back panel - Christmas Small Gift Box - Santa Claus (3 Pcs/Pack)
Colorful gradient Christmas gift box with satin handle and Merry Christmas greetings - Creative Gradient Handbag (3 Pcs/Pack)
Christmas gift box with LED lights green striped lid and transparent body 16x17cm - Christmas Reindeer Apple Box - Green (With LED)
Brown kraft Christmas Santa gift bag with woven handles, size 26x12x32cm - Santa Style - Kraft Paper (5 Pcs/Pack)
+3
Christmas Gift Bags Santa Claus Snowman Reindeer Pattern Portable Paper Candy Box Holiday Party Favor Decorative Packaging
$1.96-3.69
Mix MOQ : 5
European Eiffel Tower Laser Cut Favor Box Romantic Pearlescent Paper Candy Packaging Box With Ribbon For Wedding Party
European Eiffel Tower Laser Cut Favor Box Romantic Pearlescent Paper Candy Packaging Box With Ribbon For Wedding Party
like
Find Similar
White laser cut Eiffel Tower favor box with intricate patterns and a satin ribbon bow - White
Golden Eiffel Tower laser cut candy box with orange organza ribbon for weddings - Reflective Gold
Silver Eiffel Tower favor box with light blue ribbon and laser-cut hollow pattern - Reflective Silver
Golden laser-cut Eiffel Tower favor box with elegant organza ribbon and floral pattern - Gold
+6
European Eiffel Tower Laser Cut Favor Box Romantic Pearlescent Paper Candy Packaging Box With Ribbon For Wedding Party
-7%
$0.12
Mix MOQ : 50
Laser Cut Heart Rose Love Pearl Paper Favor Box With Ribbon Tag Hollow Candy Gift Box For Wedding Party Celebration
Laser Cut Heart Rose Love Pearl Paper Favor Box With Ribbon Tag Hollow Candy Gift Box For Wedding Party Celebration
like
Find Similar
White laser-cut heart favor box with LOVE pattern, white ribbon and thank you tag - White
Detail of white laser-cut favor box with Love motif and thank you tag with ribbon - Ivory
Pink hollowed heart Love candy gift box with rose pattern and thank you tag for weddings - Pink
Elegant gold hollow laser-cut favor box with Love design and Thank You tag for weddings - Reflective Gold
+6
Laser Cut Heart Rose Love Pearl Paper Favor Box With Ribbon Tag Hollow Candy Gift Box For Wedding Party Celebration
-7%
$0.13
Mix MOQ : 50
Laser Cut Rose Wedding Candy Box Hollow Paper Gift Packaging Box With Ribbon Bow For Party Favor Celebration
Laser Cut Rose Wedding Candy Box Hollow Paper Gift Packaging Box With Ribbon Bow For Party Favor Celebration
like
Find Similar
Detail of laser-cut rose patterns on a white wedding favor box with a satin ribbon bow - White
Macro view of white laser-cut rose hollow favor box with creamy satin ribbon bow - Ivory
Macro shot of light pink laser cut rose candy box with a white silk ribbon bow - Pink
Elegant gold laser cut rose wedding favor box with champagne ribbon for party candy storage - Gold
+6
Laser Cut Rose Wedding Candy Box Hollow Paper Gift Packaging Box With Ribbon Bow For Party Favor Celebration
$0.13
Mix MOQ : 50
Laser Cut Birdcage Favor Box With Ribbon Bow Hollow Paper Candy Boxes For Wedding Birthday Party Baptism Gift Packaging
Laser Cut Birdcage Favor Box With Ribbon Bow Hollow Paper Candy Boxes For Wedding Birthday Party Baptism Gift Packaging
like
Find Similar
Detail of red laser-cut birdcage candy box with elegant ribbon bow for weddings - Pearlescent Red
Detail of black laser-cut birdcage candy box with elegant silk ribbon for wedding - Black Khaki
Detail of silver birdcage wedding favor box with laser-cut birds and blue ribbon - Reflective Silver
Pink laser cut birdcage wedding favor box with an elegant organza ribbon bow - Pink
+6
Laser Cut Birdcage Favor Box With Ribbon Bow Hollow Paper Candy Boxes For Wedding Birthday Party Baptism Gift Packaging
$0.13
No MOQ
Laser Cut Hollow Wedding Candy Boxes Pearlescent Paper Gift Box With Ribbon For Party Chocolate Favors Decorations
Laser Cut Hollow Wedding Candy Boxes Pearlescent Paper Gift Box With Ribbon For Party Chocolate Favors Decorations
like
Find Similar
Detailed laser-cut floral wedding favor box in red cardstock with organza ribbon bow - Pearlescent Red
Macro shot of silver laser-cut floral favor box with a light blue translucent ribbon bow - Reflective Silver
White laser cut floral paper favor box with white organza ribbon for wedding gifts - White
Macro detail of pink laser-cut wedding favor box with white ribbon bow and floral hollows - Pink
+6
NewLaser Cut Hollow Wedding Candy Boxes Pearlescent Paper Gift Box With Ribbon For Party Chocolate Favors Decorations
$0.13
Mix MOQ : 50
Laser Cut Rose Heart Love Candy Box Pearl Paper Hollow Out Gift Box With Ribbon For Wedding Party Valentine Day Favor Box
Laser Cut Rose Heart Love Candy Box Pearl Paper Hollow Out Gift Box With Ribbon For Wedding Party Valentine Day Favor Box
like
Find Similar
White laser-cut wedding favor box with Love text, rose patterns, and a white ribbon bow - White
Detail of white laser-cut wedding favor box with Love heart design and satin ribbon bow - Ivory
Pink laser-cut hollow rose heart gift box with Love text and white organza ribbon - Pink
Golden laser cut Love heart wedding favor box with rose design and ribbon bow - Gold
+6
Laser Cut Rose Heart Love Candy Box Pearl Paper Hollow Out Gift Box With Ribbon For Wedding Party Valentine Day Favor Box
$0.13
Mix MOQ : 50
Laser Cut Wedding Favor Candy Box Bride And Groom Silhouette Pearlescent Paper Gift Boxes With Ribbon For Wedding Party Decor
Laser Cut Wedding Favor Candy Box Bride And Groom Silhouette Pearlescent Paper Gift Boxes With Ribbon For Wedding Party Decor
like
Find Similar
Detail showing the intricate laser-cut groom and bride silhouette on golden gift box - Mirror Gold
Macro shot of laser-cut wedding candy box with iridescent finish and silver ribbon - Mirror Iridescent
Macro shot of rose gold laser-cut wedding favor box with bride and groom silhouette - Mirror Rose Gold
Macro shot of silver laser-cut wedding candy box with silhouette and ribbon detail - Mirror Silver
+6
Laser Cut Wedding Favor Candy Box Bride And Groom Silhouette Pearlescent Paper Gift Boxes With Ribbon For Wedding Party Decor
$0.13
Mix MOQ : 50
Laser Cut Heart Rose Wedding Candy Box Ribbon Bow Hollow Paper Gift Box For Chocolate Favors Pink White Gold Silver Party Decor
Laser Cut Heart Rose Wedding Candy Box Ribbon Bow Hollow Paper Gift Box For Chocolate Favors Pink White Gold Silver Party Decor
like
Find Similar
Pink heart-shaped hollow rose candy box with laser cut design and ribbon bow - Pink
Laser cut heart shaped wedding favor box with hollow rose patterns and white ribbon bow - White
Hollow rose heart gift box with elegant red ribbon bow for wedding and party favors - Pearlescent Red
Elegant black heart-shaped laser-cut gift box with rose pattern and silk ribbon bow - Black Khaki
+6
Laser Cut Heart Rose Wedding Candy Box Ribbon Bow Hollow Paper Gift Box For Chocolate Favors Pink White Gold Silver Party Decor
$0.13
Mix MOQ : 50
Laser Cut Cross Hollow Wedding Candy Boxes With Ribbon Elegant Religious Baptism Favor Boxes Floral Vine Paper Gift Boxes
Laser Cut Cross Hollow Wedding Candy Boxes With Ribbon Elegant Religious Baptism Favor Boxes Floral Vine Paper Gift Boxes
like
Find Similar
Laser cut white cross favor box with ribbon for weddings and religious ceremonies - White
Detailed laser-cut white favor box with a cross pattern and white organza ribbon - Ivory
Pink laser-cut gift box with white ribbon bow and intricate cross pattern detail - Pink
Detailed laser-cut gold candy box with cross pattern and elegant organza ribbon - Gold
+6
Laser Cut Cross Hollow Wedding Candy Boxes With Ribbon Elegant Religious Baptism Favor Boxes Floral Vine Paper Gift Boxes
$0.13
Mix MOQ : 50
Christmas Gift Box Paper Candy Packaging Bag Ribbon Tag Santa Snowman Reindeer Design Festive Party Favors Decorative
Christmas Gift Box Paper Candy Packaging Bag Ribbon Tag Santa Snowman Reindeer Design Festive Party Favors Decorative
like
Find Similar
Flat lay of star-shaped Christmas candy gift boxes with festive reindeer and Santa prints - 8Pcs Star Shaped Boxes
Three geometric Christmas gift boxes in red, green, and blue with festive ribbon handles - 12Pcs Geometric Ball Boxes
Detail view of 6 Kraft paper Christmas gift bags with various holiday cutout tags - 24Pcs Snowflake Kraft Bags
6-pack Christmas kraft paper gift bags with snowflake patterns and assorted laser-cut cards - 24Pcs New Snowflake Paper Bags
+4
Christmas Gift Box Paper Candy Packaging Bag Ribbon Tag Santa Snowman Reindeer Design Festive Party Favors Decorative
$1.15-4.90
No MOQ
European Heart Laser Cut Wedding Favor Box Thank You Hollow Candy Chocolate Paper Gift Box With Ribbon For Wedding Party
European Heart Laser Cut Wedding Favor Box Thank You Hollow Candy Chocolate Paper Gift Box With Ribbon For Wedding Party
like
Find Similar
Laser-cut white heart gift box with Thank You text and ribbon for wedding favors - White
Detail of laser cut lace heart gift box with thank you text and white ribbon bow - Ivory
Pink laser cut heart lace thank you gift box with white organza ribbon for weddings - Pink
Detail of laser-cut gold wedding favor box with thank you heart and yellow ribbon - Reflective Gold
+7
European Heart Laser Cut Wedding Favor Box Thank You Hollow Candy Chocolate Paper Gift Box With Ribbon For Wedding Party
-7%
$0.12
Mix MOQ : 50
Laser Cut Hollow Elephant Wedding Favor Candy Box With Ribbon Bow Elegant Pearlescent Paper Gift Box For Party Events
Laser Cut Hollow Elephant Wedding Favor Candy Box With Ribbon Bow Elegant Pearlescent Paper Gift Box For Party Events
like
Find Similar
White laser-cut elephant candy box with elegant ribbon for weddings and parties - White
Close-up of black laser-cut elephant pattern gift box with decorative ribbon bow - Black
Detailed laser-cut silver elephant favor box with blue ribbon and intricate palace pattern - Reflective Silver
Detail of pink laser-cut candy box with elephant pattern and silver organza ribbon - Pink
+7
Laser Cut Hollow Elephant Wedding Favor Candy Box With Ribbon Bow Elegant Pearlescent Paper Gift Box For Party Events
$0.13
No MOQ
Laser Cut Hollow Out Cross Candy Box Pearl Paper Wedding Favor Gift Boxes With Ribbons For Baptism Religious Party Favor
Laser Cut Hollow Out Cross Candy Box Pearl Paper Wedding Favor Gift Boxes With Ribbons For Baptism Religious Party Favor
like
Find Similar
Detail of laser-cut white cross favor box with delicate patterns and organza ribbon - White
Macro shot of white laser-cut cross favor box with organza ribbon on porcelain plate - Ivory
Pink laser-cut cross gift box with pearlescent finish and white organza ribbon - Pink
Detail of light blue laser-cut gift box with hollow cross design and ribbon bow - Tiffany Blue
+7
Laser Cut Hollow Out Cross Candy Box Pearl Paper Wedding Favor Gift Boxes With Ribbons For Baptism Religious Party Favor
$0.13
Mix MOQ : 50
Elegant Laser Cut Hollow Wedding Candy Box Bride Gown Silhouette Pearlescent Paper Gift Box With Ribbon For Party Favors
Elegant Laser Cut Hollow Wedding Candy Box Bride Gown Silhouette Pearlescent Paper Gift Box With Ribbon For Party Favors
like
Find Similar
Elegant white laser-cut butterfly wedding favor box with lace patterns and ribbon - White
Laser-cut white wedding favor box featuring elegant bridal gown silhouette and ribbon - Ivory
Detailed laser-cut gold candy box with elegant lady silhouette and silk bow - Reflective Gold
Laser-cut hollow light blue princess candy gift box with elegant satin ribbon bow - Turquoise Blue
+3
Elegant Laser Cut Hollow Wedding Candy Box Bride Gown Silhouette Pearlescent Paper Gift Box With Ribbon For Party Favors
-7%
$0.13
Mix MOQ : 50
Elegant Heart Shaped Laser Cut Hollow Candy Boxes Pearlescent Paper Wedding Favor Boxes With Ribbons For Party Gifts
Elegant Heart Shaped Laser Cut Hollow Candy Boxes Pearlescent Paper Wedding Favor Boxes With Ribbons For Party Gifts
like
Find Similar
Elegant white laser-cut heart candy box with ribbons for wedding party favors - White
Pink heart-shaped laser-cut wedding favor box with intricate floral patterns and ribbon - Pink
Elegant gold heart-shaped laser cut wedding favor box with a satin ribbon bow detail - Gold
Elegant cream heart-shaped laser cut favor box with a delicate ribbon for wedding gifts - Ivory
+4
Elegant Heart Shaped Laser Cut Hollow Candy Boxes Pearlescent Paper Wedding Favor Boxes With Ribbons For Party Gifts
-7%
$0.13
Mix MOQ : 50
Happy Retirement Laser Cut Hollow Candy Boxes Floral Ribbon Bow Paper Gift Boxes For Party Celebration Favors Wedding Decor
Happy Retirement Laser Cut Hollow Candy Boxes Floral Ribbon Bow Paper Gift Boxes For Party Celebration Favors Wedding Decor
like
Find Similar
White laser cut Happy Retirement favor box with ribbon and elegant flower patterns - White
Pink pearl Happy Retirement gift box with laser cut floral patterns and white ribbon - Pink
Close-up of light blue laser-cut candy box featuring Happy Retirement text and ribbon - Pearl Pale Blue
Detail of light blue laser-cut Happy Retirement favor box with delicate ribbon bow - Tiffany Blue
+4
Happy Retirement Laser Cut Hollow Candy Boxes Floral Ribbon Bow Paper Gift Boxes For Party Celebration Favors Wedding Decor
$0.13
Mix MOQ : 50
Laser Cut Angel Hollow Candy Boxes Pearlescent Paper Chocolate Wrappers For Wedding Birthday Party Decorations Party Favors
Laser Cut Angel Hollow Candy Boxes Pearlescent Paper Chocolate Wrappers For Wedding Birthday Party Decorations Party Favors
like
Find Similar
Detailed laser-cut white angel favor box with intricate hollow design on dark wood - White
Pink laser-cut candy box featuring angel design with intricate hollow patterns - Pink
Macro detail of laser-cut cream cupcake wrapper with an elegant angel cutout design - Reflective Gold
Detailed laser-cut red paper cupcake wrapper featuring an angelic motif for party decor - Pearlescent Red
+4
Laser Cut Angel Hollow Candy Boxes Pearlescent Paper Chocolate Wrappers For Wedding Birthday Party Decorations Party Favors
$0.10
Mix MOQ : 50
Free Shipping
Butterfly Hollow Candy Box Wedding Favor Gift Packing Pearlescent Paper Boxes Laser Cut Party Celebration Decoration
Butterfly Hollow Candy Box Wedding Favor Gift Packing Pearlescent Paper Boxes Laser Cut Party Celebration Decoration
like
Find Similar
Close-up of laser-cut white paper wedding favor box with a 3D butterfly design and hollow pattern - White
Pink laser-cut butterfly gift box for weddings featuring a 3D hollow design on wood surface - Pink
Sky blue laser cut butterfly gift box for wedding favors placed on white porcelain plate - Tiffany Blue
Laser-cut golden butterfly wedding favor box on porcelain plate for elegant celebrations - Gold
+5
Butterfly Hollow Candy Box Wedding Favor Gift Packing Pearlescent Paper Boxes Laser Cut Party Celebration Decoration
$0.13
Mix MOQ : 50
 · 
14 views
Go to

More in party supplies

Explore more in favor boxes

partygoldartificialdecorativeheartstoragehandmadestorage boxtagsdecoration accessories
hollowshapesquarewindowsmalltasselwrappingflippackaging baggift wrapping

Ready to source like an insider

Get a direct line to the factory floor — no minimums, no middlemen, no guesswork.
iconReal factory pricing, no markup in betweeniconEvery order hand-inspected before it shipsicon5,000+ new products added daily
Get Inside Access