Everful

Wholesale favor boxes

Factory-direct selection, vetted for quality and ready to order.

Sign Up
Favor Boxes

Find the perfect pieces: party gift bags, party favors, gift wrapping supplies and more

filterShow Filters
Best Seller
New Arrivals
Price Drop
Free Shipping
Christmas Scented Candle Gift Box Handmade Soy Wax Aromatherapy Holiday Decor Gingerbread Man Tree Shape Party Favor
Christmas Scented Candle Gift Box Handmade Soy Wax Aromatherapy Holiday Decor Gingerbread Man Tree Shape Party Favor
like
Find Similar
Christmas tree and snowflake scented candle gift box in eco-friendly kraft packaging - Gift Box B (Green Christmas Tree + White Snowflake Candle)
Pink Christmas tree and glove scented candle gift set in a brown kraft paper box - Gift Box C (Pink Christmas Tree + Pink Glove Candle)
Christmas scented candle gift set featuring a knitted glove and snowflake design - Gift Box A (Red Glove + White Snowflake Candle)
Christmas scented candle gift set with green tree, gingerbread man and reindeer shapes - Gift Box D (Yellow Gingerbread Man + Green Christmas Tree Candle)
+1
Christmas Scented Candle Gift Box Handmade Soy Wax Aromatherapy Holiday Decor Gingerbread Man Tree Shape Party Favor
-10%
$3.11
No MOQ
 · 
16 sold recently
Laser Cut Shell Shape Wedding Favor Candy Box With Ribbon Pearlescent Paper Hollow Out Gift Box For Party Decorations
Laser Cut Shell Shape Wedding Favor Candy Box With Ribbon Pearlescent Paper Hollow Out Gift Box For Party Decorations
like
Find Similar
White shell shaped laser cut wedding favor box with an elegant white ribbon bow - White
Light blue shell-shaped laser-cut wedding favor box with a white silk ribbon bow - Pearl Pale Blue
Red laser-cut seashell candy favor box with matching ribbon for wedding celebrations - Pearlescent Red
Silver shell-shaped candy box with white ribbon bow for wedding favor packaging - Reflective Silver
+7
Laser Cut Shell Shape Wedding Favor Candy Box With Ribbon Pearlescent Paper Hollow Out Gift Box For Party Decorations
$0.13
Mix MOQ : 50
 · 
200 sold recently
Mini Pillow Shape Gift Box Folding Paper Jewelry Packaging Decorative Patterns Gold Stamping Small Favor
Mini Pillow Shape Gift Box Folding Paper Jewelry Packaging Decorative Patterns Gold Stamping Small Favor
like
Find Similar
Mini dark purple forest style pillow gift box with green tropical leaf pattern and text - Mini Green Leaves
Mini paper pillow gift box with pink and black geometric pattern and thank you text - Mini Pink Geometric
Pink pillow gift box with black Christmas tree pattern and Thank You text on white background - Pink Pine Tree
Mini taupe pillow gift box with Thank You text and forest patterns on white background - Mini Snow Scene
Mini Pillow Shape Gift Box Folding Paper Jewelry Packaging Decorative Patterns Gold Stamping Small Favor
$0.08
No MOQ
 · 
265 sold recently
Small European Style Heart Shaped Window Candy Boxes Paper Gift Packaging For Wedding Party Favors Foldable
Small European Style Heart Shaped Window Candy Boxes Paper Gift Packaging For Wedding Party Favors Foldable
like
Find Similar
Pink cube gift box with heart-shaped window for weddings and candy packaging - Pink
Silver gift box with heart-shaped PVC window for wedding favors and candy packing - Gray
White heart-shaped window favor box in high-quality paper for wedding candy - White
Small European Style Heart Shaped Window Candy Boxes Paper Gift Packaging For Wedding Party Favors Foldable
$0.06
Mix MOQ : 50
 · 
900 sold recently
House Shaped Kraft Paper Gift Box With Handle Hollow Window For Candy Cookies Packaging Wedding Party Favors Box
House Shaped Kraft Paper Gift Box With Handle Hollow Window For Candy Cookies Packaging Wedding Party Favors Box
like
Find Similar
Eco-friendly house-shaped kraft paper gift box with hollow windows and twine handle - 7.5*7.5*18cm / Original Color
House Shaped Kraft Paper Gift Box With Handle Hollow Window For Candy Cookies Packaging Wedding Party Favors Box
-4%
$0.21
No MOQ
 · 
100 sold recently
Laser Cut Baby Shower Favor Boxes Hollow Stroller Design Its A Boy Paper Candy Box With Ribbon And Thank You Gift Tag
Laser Cut Baby Shower Favor Boxes Hollow Stroller Design Its A Boy Paper Candy Box With Ribbon And Thank You Gift Tag
like
Find Similar
White laser cut It's A Boy baby shower candy boxes with ribbon and thank you tag - White
Light blue laser-cut baby shower gift box with ribbon and It's A Boy baby carriage pattern - Pearl Pale Blue
Yellow laser-cut baby shower candy box with It's A Boy pattern and gold ribbon - Gold
Laser cut purple paper favor box with It's A Boy pattern and silk ribbon for baby shower - Dark Purple
+4
Laser Cut Baby Shower Favor Boxes Hollow Stroller Design Its A Boy Paper Candy Box With Ribbon And Thank You Gift Tag
$0.14
Mix MOQ : 50
 · 
50 sold recently
Elegant Wedding Favor Boxes Paper Candy Bags With Ribbon Bow Thank You Foil Print Party Gift Packaging For Guests
Elegant Wedding Favor Boxes Paper Candy Bags With Ribbon Bow Thank You Foil Print Party Gift Packaging For Guests
like
Find Similar
Detail of white marble wedding gift box with champagne gold ribbon and Thank You text - Small / White Marble THANK YOU (Champagne Ribbon)
Elegant black gift bag with gold ribbon and Thank You gold foil text on pedestal - Small / Black THANK YOU (Champagne Ribbon)
Detailed macro view of a pink trapezoid wedding candy gift box with a grey satin ribbon - Small / Pink Wedding Ceremony (Silver Ribbon)
Close-up of elegant dark green wedding candy box with a large matching satin ribbon bow - Small / Dark Green Wedding Ceremony (Green Ribbon)
+26
Elegant Wedding Favor Boxes Paper Candy Bags With Ribbon Bow Thank You Foil Print Party Gift Packaging For Guests
$0.14
No MOQ
 · 
61 views
Portable Flip Top Gift Box With Transparent Window Handle Cardboard Packaging Box For Wedding Party Holiday Favor Candy Box
Portable Flip Top Gift Box With Transparent Window Handle Cardboard Packaging Box For Wedding Party Holiday Favor Candy Box
like
Find Similar
Detail of kraft paper gift boxes with window and handle in large and small sizes - Kraft Paper Color / 15x10x6
Matte black gift boxes with transparent windows and integrated handles in two sizes - Black / 15x10x6
White cardboard gift box with handle and clear window in two different sizes - White / 15x10x6
Pink gift box with transparent window and handle in two sizes for festive packaging - Pink / 15x10x6
+8
Portable Flip Top Gift Box With Transparent Window Handle Cardboard Packaging Box For Wedding Party Holiday Favor Candy Box
$0.13-0.22
Mix MOQ : 12
 · 
55 views
Creative Cake Slice Shaped Gift Boxes Pink Strawberry Rainbow Cardboard Candy Treat Packaging For Birthday Party Cute Favor
Creative Cake Slice Shaped Gift Boxes Pink Strawberry Rainbow Cardboard Candy Treat Packaging For Birthday Party Cute Favor
like
Find Similar
Pink and white triangle cake shaped paper gift boxes with strawberry print and cream decor - Pink Strawberry / 14.5*11*7.5cm
Pink rainbow layer triangular cake gift box with blue striped candle paper topper - Colorful Polka Dots / 14.5*11*7.5cm
Creative Cake Slice Shaped Gift Boxes Pink Strawberry Rainbow Cardboard Candy Treat Packaging For Birthday Party Cute Favor
$0.12
No MOQ
 · 
234 sold recently
Kraft Paper Gift Boxes With Transparent Window Handle Portable Solid Color Party Favor Wrapping Packaging Minimalist
Kraft Paper Gift Boxes With Transparent Window Handle Portable Solid Color Party Favor Wrapping Packaging Minimalist
like
Find Similar
Three kraft paper gift boxes with clear windows in a home setting layout - 15*10*6cm / Kraft Color with Window and Flip Cover
Three-piece red kraft gift bags with window display and sturdy carry handles - 15*10*6cm / Bright Red with Window and Flip Cover
Three white paper gift boxes with transparent windows in small, medium, and large sizes - 15*10*6cm / White with Window and Flip Cover
Detailed view of three pink gift boxes with clear window and handles in small medium and large - 15*10*6cm / Pink with Window and Flip Cover
+17
Kraft Paper Gift Boxes With Transparent Window Handle Portable Solid Color Party Favor Wrapping Packaging Minimalist
$0.13-0.30
Mix MOQ : 30
 · 
408 sold recently
European Style Laser Cut Rose Floral Candy Boxes Pearlescent Paper Gift Boxes With Ribbon For Wedding Party Favor Packaging
European Style Laser Cut Rose Floral Candy Boxes Pearlescent Paper Gift Boxes With Ribbon For Wedding Party Favor Packaging
like
Find Similar
Laser-cut white wedding favor box with intricate floral hollows and silk ribbon bow - Folded 6.5x6.5x8cm / Pearlescent Ice White
Laser-cut red wedding favor box with intricate rose patterns and a satin ribbon bow - Folded 6.5x6.5x8cm / Pearlescent Red
Purple laser-cut floral candy box tutorial showing four-step folding process with ribbon - Folded 6.5x6.5x8cm / Pearlescent Light Purple
Beige laser-cut wedding favor box with floral patterns and a silk ribbon bow, size 8x6.5cm - Folded 6.5x6.5x8cm / Pearlescent Star White
+3
European Style Laser Cut Rose Floral Candy Boxes Pearlescent Paper Gift Boxes With Ribbon For Wedding Party Favor Packaging
-6%
$0.15
Mix MOQ : 50
 · 
131 sold recently
Christmas Candy Gift Boxes Pyramid Triangle Paper Packaging With Ribbon Santa Reindeer Patterns Holiday Party Favors Decorative
Christmas Candy Gift Boxes Pyramid Triangle Paper Packaging With Ribbon Santa Reindeer Patterns Holiday Party Favors Decorative
like
Find Similar
Green Christmas candy pillow gift boxes featuring Santa Claus and Happy Christmas text - Single Piece / S553 Green Santa Claus (Small)
Christmas reindeer pattern pillow gift boxes in red paper for holiday treat packaging - Single Piece / S3020 Elk (Small)
Star-shaped red Christmas candy box with Santa Claus motif and red ribbon handle - Single Piece / S931 Red Santa Claus (Star Shape)
Star-shaped green Christmas gift box with Santa Claus patterns and green ribbon hanging - Single Piece / S931 Dark Green Little Gift (Star Shape)
+29
Christmas Candy Gift Boxes Pyramid Triangle Paper Packaging With Ribbon Santa Reindeer Patterns Holiday Party Favors Decorative
-7%
$0.13-0.33
No MOQ
 · 
43 sold recently
Mini Handheld Gift Bag PU Leather Candy Box Sweet Love Metal Plate Wedding Favor Party Celebration Drawstring Mesh Liner
Mini Handheld Gift Bag PU Leather Candy Box Sweet Love Metal Plate Wedding Favor Party Celebration Drawstring Mesh Liner
like
Find Similar
Pink leather wedding candy gift bags in shell handbag style with Sweet Love tag - Pink
Three red leather wedding favor bags with gold accents and Sweet Love engraving - Red
Set of three blue PU leather wedding candy gift bags with gold handles and Sweet Love tags - Blue
Three beige leather wedding favor bags with gold accents and yellow drawstring pouch - Beige
Mini Handheld Gift Bag PU Leather Candy Box Sweet Love Metal Plate Wedding Favor Party Celebration Drawstring Mesh Liner
-4%
$0.69
Mix MOQ : 2
 · 
20 sold recently
Square Gift Box Cardboard With Ribbon Bow Folding Wedding Party Favor Candy Packaging Wavy Edge Elegant
Square Gift Box Cardboard With Ribbon Bow Folding Wedding Party Favor Candy Packaging Wavy Edge Elegant
like
Find Similar
Elegant beige square paper gift box with decorative cream ribbon bow for soaps - 9*9*5cm / Yellow
Light blue square paper gift box with beige ribbon bow and wavy cut-out design - 9*9*5cm / Blue
Detail of light blue polka dot gift box featuring a decorative white ribbon bow - 9*9*5cm / Green Polka Dot
Square candy pink paper gift box with wavy edges and a white silk ribbon bow closure - 9*9*5cm / Pink
+2
Square Gift Box Cardboard With Ribbon Bow Folding Wedding Party Favor Candy Packaging Wavy Edge Elegant
-7%
$0.13
No MOQ
 · 
72 sold recently
Marble Pattern Thank You Candy Boxes Gift Bags With Satin Ribbon Bow Gold Foil For Wedding Party Favors Elegant Packaging
Marble Pattern Thank You Candy Boxes Gift Bags With Satin Ribbon Bow Gold Foil For Wedding Party Favors Elegant Packaging
like
Find Similar
Detail of marble pattern gift box with golden Thank You text and grey ribbon bow - Gray
Elegant marble pattern gift bag with pink ribbon and gold Thank You lettering - Pink
Elegant marble pattern gift bag with Thank You gold foil text and green satin bow ribbon - Green
Detailed view of marble pattern gift bag with a red ribbon bow and gold Thank You text - Burgundy
+3
Marble Pattern Thank You Candy Boxes Gift Bags With Satin Ribbon Bow Gold Foil For Wedding Party Favors Elegant Packaging
-5%
$0.16
No MOQ
 · 
85 sold recently
European Hollow Cross Candy Box Laser Cut Pearl Paper Gift Box With Ribbon For Wedding Baptism Party Favor Decor
European Hollow Cross Candy Box Laser Cut Pearl Paper Gift Box With Ribbon For Wedding Baptism Party Favor Decor
like
Find Similar
Elegant white laser-cut wedding favor candy box with cross and flower hollow pattern - 5x8.5cm / White
Elegant yellow laser-cut hollow-out candy gift box with cross pattern and ribbon - 5x8.5cm / Gold
Elegant pink laser-cut candy gift box featuring a cross floral pattern and sheer ribbon - 5x8.5cm / Pink
Mint green laser-cut gift box with floral cross pattern and ribbon for candies - 5x8.5cm / Tiffany Blue
European Hollow Cross Candy Box Laser Cut Pearl Paper Gift Box With Ribbon For Wedding Baptism Party Favor Decor
$0.08
Mix MOQ : 10
 · 
11 views
Marble Pattern Paper Gift Bag With Transparent Window Handheld Packing Box For Wedding Birthday Holiday Party Presents Favor Bag
Marble Pattern Paper Gift Bag With Transparent Window Handheld Packing Box For Wedding Birthday Holiday Party Presents Favor Bag
like
Find Similar
Detail of matte black gift bag with large clear PVC window and woven handles - 30cmx20cmx16cm / Black
Close-up of pink paper gift bag featuring a large clear window and woven rope handles - 30cmx20cmx16cm / Pink
Minimalist white marble pattern gift paper bag with transparent window and ribbon handle - 30cmx20cmx16cm / White Black Frame
Detail of marble gift bag with transparent window, gold trim, and black woven handle - 30cmx20cmx16cm
+24
Marble Pattern Paper Gift Bag With Transparent Window Handheld Packing Box For Wedding Birthday Holiday Party Presents Favor Bag
$0.30-0.61
Mix MOQ : 12
 · 
13 views
Kraft Paper Pillow Boxes DIY Candy Gift Packaging Cases For Wedding Party Favors With Hemp Rope Ribbons
Kraft Paper Pillow Boxes DIY Candy Gift Packaging Cases For Wedding Party Favors With Hemp Rope Ribbons
like
Find Similar
Six white kraft paper pillow boxes for wedding favors and small gift packaging - White Plain Box
European style white kraft paper pillow candy boxes with jute twine bows on white background - White + White Jute Rope
Brown kraft paper pillow candy boxes set with shiny gold ribbon bows for wedding favors - Kraft Color + Gold Ribbon
Set of 6 white pillow boxes with silver satin ribbons for wedding party favors - White + Silver Ribbon
+3
Kraft Paper Pillow Boxes DIY Candy Gift Packaging Cases For Wedding Party Favors With Hemp Rope Ribbons
$0.03-0.06
Mix MOQ : 50
 · 
1K+ sold recently
Creative Handbag Shaped Candy Boxes Paper Bronzing Polka Dots Bow Gift Box Wedding Party Favor Celebration European Style
Creative Handbag Shaped Candy Boxes Paper Bronzing Polka Dots Bow Gift Box Wedding Party Favor Celebration European Style
like
Find Similar
Light blue gift box with gold polka dots and bow tie, elegant wedding candy bag design - Light Blue Polka Dot
Navy blue gift box with gold foil polka dots and a large decorative bow handle - Dark Blue Polka Dot
Elegant white wedding favor box with gold foil polka dots and a decorative bow handle - Champagne Polka Dot
Elegant dark green gift box with gold foil dots and bow on a white background - Green Polka Dot
+2
Creative Handbag Shaped Candy Boxes Paper Bronzing Polka Dots Bow Gift Box Wedding Party Favor Celebration European Style
$0.12
Mix MOQ : 100
 · 
46 views
Gift Box Embossed Paper Gold Stamping Ribbon Bow Merci Beaucoup Folding Candy Packaging Wedding Party Favor Decorative
Gift Box Embossed Paper Gold Stamping Ribbon Bow Merci Beaucoup Folding Candy Packaging Wedding Party Favor Decorative
like
Find Similar
Elegant white textured gift box with orange ribbon and merci beaucoup gold foil printing - White Embossed/5.7x6x10cm
Gift Box Embossed Paper Gold Stamping Ribbon Bow Merci Beaucoup Folding Candy Packaging Wedding Party Favor Decorative
-6%
$0.14
No MOQ
 · 
114 sold recently
White Laser Cut Candy Box Pearlescent Paper Hollow Butterfly Mr Mrs Wedding Party Favor Gift Box Ribbon Packaging
White Laser Cut Candy Box Pearlescent Paper Hollow Butterfly Mr Mrs Wedding Party Favor Gift Box Ribbon Packaging
like
Find Similar
Elegant white laser-cut gift box with floral patterns and a translucent ribbon bow - Hollow Floral Style (XTH-94)
Detail of white laser-cut pearlescent favor box with rose patterns and organza ribbon - Rose Hollow Style (XTH-102)
Laser cut white Mr & Mrs wedding candy box with butterfly design and ribbon bow - Couple Silhouette Style (XTH-26)
Elegant laser-cut heart pattern white gift box with white ribbon bow for wedding - Heart Floral Style (XTH-31)
+5
White Laser Cut Candy Box Pearlescent Paper Hollow Butterfly Mr Mrs Wedding Party Favor Gift Box Ribbon Packaging
$0.12-0.17
Mix MOQ : 50
 · 
50 sold recently
Laser Cut Artificial Pearl Paper Wedding Candy Gift Boxes Mr And Mrs Bride Groom Silhouette Rose Pattern Ribbon Bow Party Favor Case
Laser Cut Artificial Pearl Paper Wedding Candy Gift Boxes Mr And Mrs Bride Groom Silhouette Rose Pattern Ribbon Bow Party Favor Case
like
Find Similar
Laser-cut white wedding favor box with Mr & Mrs heart silhouette and organza ribbon - Ivory
Detail of purple laser-cut wedding favor box with Mr & Mrs silhouette and ribbon bow - Sapphire Blue
Silver laser cut wedding candy box with Mr & Mrs hollow design and white silk ribbon - Reflective Silver
White laser-cut Mr & Mrs wedding candy box with a white organza ribbon bow on top - White
+7
Laser Cut Artificial Pearl Paper Wedding Candy Gift Boxes Mr And Mrs Bride Groom Silhouette Rose Pattern Ribbon Bow Party Favor Case
$0.13
Mix MOQ : 50
 · 
45 views
Graduation Cap Shape Gift Boxes Paper Candy Treat Case With Tassel Congrats GRAD Print Party Favors DIY Novelty
Graduation Cap Shape Gift Boxes Paper Candy Treat Case With Tassel Congrats GRAD Print Party Favors DIY Novelty
like
Find Similar
Red graduation cap gift box with gold tassel and Congrats Grad text for party favors - Red
Purple Graduation Cap candy gift box with yellow tassel and Congrats GRAD text - Purple
Navy blue graduation cap candy box with yellow tassel and Congrats GRAD text - Blue
Doctoral cap gift box in black with gold Congrats Grad print and yellow silk tassel - Black
Graduation Cap Shape Gift Boxes Paper Candy Treat Case With Tassel Congrats GRAD Print Party Favors DIY Novelty
$0.13
Mix MOQ : 50
 · 
60 sold recently
Pillow Gift Boxes Kraft Paper Candy Box With Clear Window For Wedding Party Favor Packaging Jewelry Display
Pillow Gift Boxes Kraft Paper Candy Box With Clear Window For Wedding Party Favor Packaging Jewelry Display
like
Find Similar
Set of two white pillow-shaped kraft gift boxes with transparent window for candy packaging - White
Brown kraft paper pillow gift box with transparent PVC window for wedding candy display - Kraft Color
Elegant black kraft paper pillow gift boxes with transparent window for wedding favors - Black
Pillow Gift Boxes Kraft Paper Candy Box With Clear Window For Wedding Party Favor Packaging Jewelry Display
$0.06
No MOQ
 · 
42 sold recently
Square Flip Top Gift Packaging Box White Cardboard Foldable Storage Box For Handmade Soap Flower Tea Nougat Party Favors
Square Flip Top Gift Packaging Box White Cardboard Foldable Storage Box For Handmade Soap Flower Tea Nougat Party Favors
like
Find Similar
Elegant square pink gift box with vintage alphabet print for luxury tea and soap packaging - Pink Letters / 15x15x5cm
Black square gift box with pink floral design and elegant matte paper finish - Black Cherry Blossom / 15x15x5cm
Square Flip Top Gift Packaging Box White Cardboard Foldable Storage Box For Handmade Soap Flower Tea Nougat Party Favors
-5%
$0.32
No MOQ
 · 
69 views
Wedding Gift Box Eucalyptus Leaf Floral Thank You Paper Party Favor Bag Ribbon Handle Elegant Minimalist Handbag
Wedding Gift Box Eucalyptus Leaf Floral Thank You Paper Party Favor Bag Ribbon Handle Elegant Minimalist Handbag
like
Find Similar
Close-up of white wedding favor box with green ribbon and gold Thank You lettering - Eucalyptus + Green Ribbon
Detail of white wedding favor bag with gold Thank You text and green eucalyptus leaf - Eucalyptus + Gold Ribbon
Close-up of white paper gift bag with eucalyptus wreath design and white silk bow detail - Eucalyptus + White Ribbon
White wedding favor box with green satin bow and golden Thank You wreath print - Wreath Leaves + Green Ribbon
Wedding Gift Box Eucalyptus Leaf Floral Thank You Paper Party Favor Bag Ribbon Handle Elegant Minimalist Handbag
$0.17
Mix MOQ : 3
 · 
316 sold recently
Vintage Easter Tinplate Gift Box With Handle Retro Rabbit Floral Printed Metal Storage Box For Holiday Treats Favors
Vintage Easter Tinplate Gift Box With Handle Retro Rabbit Floral Printed Metal Storage Box For Holiday Treats Favors
like
Find Similar
Easter garden tin gift box with a green handle and bunny pattern on white background - Easter Handheld Tin Box Type A
Purple Easter bunny tin gift box with handle and decorative floral egg patterns - Purple Easter Greeting Style (Style B)
Easter bunny tin gift box with green handle and vintage floral patterns for cookies - Easter Handheld Tin Box Type C
Vintage Easter rabbit tin gift box with blue metal handle and floral bunny illustrations - Peter Rabbit Inspired Pastoral Style (Style D)
+2
Vintage Easter Tinplate Gift Box With Handle Retro Rabbit Floral Printed Metal Storage Box For Holiday Treats Favors
$1.15
No MOQ
 · 
30 views
Heart Shaped Top Pearlescent Paper Candy Boxes Square Bottom Elegant Wedding Party Favor Gift Packaging Foldable Cardstock
Heart Shaped Top Pearlescent Paper Candy Boxes Square Bottom Elegant Wedding Party Favor Gift Packaging Foldable Cardstock
like
Find Similar
Set of six purple pearlescent paper candy boxes with a creative heart-shaped top closure - Purple
Set of 6 peach pink square gift boxes with interlocking heart shaped closure tops - Pink
Set of six white heart-shaped pearl paper candy boxes for wedding favors and gifts - White
Dark red pearlescent paper candy boxes with heart-shaped seal in a 6-piece pack - Dark Red
+1
Heart Shaped Top Pearlescent Paper Candy Boxes Square Bottom Elegant Wedding Party Favor Gift Packaging Foldable Cardstock
$0.05
Mix MOQ : 50
 · 
86 sold recently
Sakura Pyramid Candy Gift Boxes Cardboard With Ribbon Handle And Tags For Wedding Party Favors
Sakura Pyramid Candy Gift Boxes Cardboard With Ribbon Handle And Tags For Wedding Party Favors
like
Find Similar
Pink pyramid candy box with cherry blossom pattern and silk ribbon for wedding gifts - Pink With Tag
Golden Xi character wedding favors pendants and clips set on a ceramic plate - Double Happiness Pin Accessories
Golden safety pins with pearl and rhinestone detail on white ceramic plate for candy boxes - Rhinestone Pearl Pin Accessories
Pink pyramid candy box with red floral patterns and silk ribbon for wedding gifts - Red With Tag
+3
Sakura Pyramid Candy Gift Boxes Cardboard With Ribbon Handle And Tags For Wedding Party Favors
$0.04-0.14
No MOQ
 · 
47 views
Handbag Shape Wedding Candy Gift Box Paper Ribbon Bow Thank You Gold Stamping Party Favor
Handbag Shape Wedding Candy Gift Box Paper Ribbon Bow Thank You Gold Stamping Party Favor
like
Find Similar
Detail of pink and red handbag style wedding candy box with silk ribbon and gold foil - Small 6.3*13*9.5cm / Red with Wine Red Ribbon
Elegant white wedding candy gift box with green leaf patterns and silk ribbon bow - Small 6.3*13*9.5cm / Green
Pink creative wedding favor gift boxes with golden marble texture and silk ribbons - Small 6.3*13*9.5cm / Pink with Pink Ribbon
Pink handbag style wedding candy box with red patterns and a gold ribbon bow tie - Small 6.3*13*9.5cm / Red with Gold Ribbon
+6
Handbag Shape Wedding Candy Gift Box Paper Ribbon Bow Thank You Gold Stamping Party Favor
-8%
$0.10-0.22
No MOQ
 · 
62 views
3D Butterfly Romantic Tiffany Blue Square Wedding Candy Box Gift Favor Paper Boxes For Party Celebration Decoration
3D Butterfly Romantic Tiffany Blue Square Wedding Candy Box Gift Favor Paper Boxes For Party Celebration Decoration
like
Find Similar
3D butterfly gift box in tiffany blue with white trim and glitter details - Tiffany Butterfly Style (HB0046) / 10 Pieces/Pack (10x7x4.5cm)
3D Butterfly Romantic Tiffany Blue Square Wedding Candy Box Gift Favor Paper Boxes For Party Celebration Decoration
-4%
$1.59
No MOQ
 · 
33 views
European Creative Wedding Candy Box With Leather Handle Metal Flower Embossed Sweet Time Favor Box Champagne Wine Red Party Gift Box
European Creative Wedding Candy Box With Leather Handle Metal Flower Embossed Sweet Time Favor Box Champagne Wine Red Party Gift Box
like
Find Similar
Elegant burgundy wedding candy bags featuring golden handles and gold flower charms - Small / Wine Red Box + Leather Handle + Flower Plate
Elegant burgundy European wedding candy gift boxes with gold embossed Sweet Present text - Small / Wine Red Box + Flower Handle
Elegant burgundy wedding candy gift bag with gold leather handle and gold script text - Small / Wine Red Box + Leather Handle
Elegant burgundy wedding candy gift box with gold handle and embossed text - Small / Wine Red Box + Gold Handle
+6
European Creative Wedding Candy Box With Leather Handle Metal Flower Embossed Sweet Time Favor Box Champagne Wine Red Party Gift Box
$1.59-1.99
No MOQ
 · 
151 sold recently
Transparent Gift Box With Gold Edges Portable Clear PVC Candy Packaging For Wedding Party Favors Elegant Thank You Print
Transparent Gift Box With Gold Edges Portable Clear PVC Candy Packaging For Wedding Party Favors Elegant Thank You Print
like
Find Similar
Transparent PVC gift box with gold edges and handles featuring Thank You print - Gold Edged PVC Portable Box
Transparent Gift Box With Gold Edges Portable Clear PVC Candy Packaging For Wedding Party Favors Elegant Thank You Print
$0.43
Mix MOQ : 12
 · 
53 views
Christmas Gift Box Book Shaped Cardboard Candy Packaging With Ribbon Creative Holiday Party Favor Magic Book Style
Christmas Gift Box Book Shaped Cardboard Candy Packaging With Ribbon Creative Holiday Party Favor Magic Book Style
like
Find Similar
Dark green book-shaped Christmas candy box with silk bow and Merry Christmas text - With Green Ribbon / Mastery Green
Creative magic book style Christmas candy box with Santa Claus and red ribbon bow - With Red Ribbon / Santa Delivering Gifts
Green Christmas book-shaped gift box with festive foliage patterns and silk ribbon - With Green Ribbon / Green Marijuana Leaf
Creative Christmas magic book candy boxes with festive ribbons and Santa Claus patterns - With Red Ribbon / Santa Claus
Christmas Gift Box Book Shaped Cardboard Candy Packaging With Ribbon Creative Holiday Party Favor Magic Book Style
$0.36
Mix MOQ : 3
 · 
35 sold recently
Laser Cut Crown Chocolate Wrapper Mirror Paper Candy Box For Wedding Birthday Party Table Decoration Favor Ornament
Laser Cut Crown Chocolate Wrapper Mirror Paper Candy Box For Wedding Birthday Party Table Decoration Favor Ornament
like
Find Similar
Detailed laser-cut hollow crown candy box in deep purple metallic finish for parties - 3.5cm / Mirror Dark Purple
Macro view of laser-cut crown candy box in mirrored gold paper for party favors - 3.5cm / Mirror Gold
Macro shot of laser-cut crown cupcake wrapper in metallic red with heart hollow details - 3.5cm / Mirror Apple Gold
Laser-cut crown candy box with iridescent mirror finish and intricate hollow pattern - 3.5cm / Mirror Iridescent
+8
Laser Cut Crown Chocolate Wrapper Mirror Paper Candy Box For Wedding Birthday Party Table Decoration Favor Ornament
$0.09
Mix MOQ : 50
 · 
50 sold recently
Floral Pillow Gift Box Cardboard Paper Small Packaging Case With Ribbon For Candy Scarf Party Favor Elegant Decorative
Floral Pillow Gift Box Cardboard Paper Small Packaging Case With Ribbon For Candy Scarf Party Favor Elegant Decorative
like
Find Similar
Floral pillow gift box with navy leaves and orange berries on a light yellow background - Light Yellow
Floral pillow-shaped gift box with green leaf patterns and small pink berries on light base - Mint Green
Light green floral pillow gift box with light blue satin ribbon and thank you seal sticker - Green with Yellow Flower
Floral print pillow-shaped gift box with a pink ribbon bow and Thank You sticker - Yellow with Red Flower
Floral Pillow Gift Box Cardboard Paper Small Packaging Case With Ribbon For Candy Scarf Party Favor Elegant Decorative
-8%
$0.11
No MOQ
 · 
30 sold recently
Portable Handheld Paper Gift Boxes For Candy Cake Packaging Wedding Party Favor Foldable Cardboard Treat Boxes Colorful
Portable Handheld Paper Gift Boxes For Candy Cake Packaging Wedding Party Favor Foldable Cardboard Treat Boxes Colorful
like
Find Similar
Elegant pink kraft paper handheld dessert box for mousse cakes and gift packaging - Pink
Light blue cardboard party gift box with integrated handle and rooftop folding design - Light Blue
Detail of red gift box showing sturdy paper texture and heart-shaped closure tab - Red
White cardboard pastry box with handle for baking desserts and gift packaging - White
+4
Portable Handheld Paper Gift Boxes For Candy Cake Packaging Wedding Party Favor Foldable Cardboard Treat Boxes Colorful
$0.17
Mix MOQ : 12
 · 
292 sold recently
Laser Cut Hollow Flower Wedding Candy Box Butterfly Decoration Gift Favor Box For Wedding Party Birthday Celebration
Laser Cut Hollow Flower Wedding Candy Box Butterfly Decoration Gift Favor Box For Wedding Party Birthday Celebration
like
Find Similar
Hollow flower candy box in cyan with gold-edged laser cut patterns and butterfly decor - Large / Light Blue
Red hollow floral favor box with a 3D butterfly topper and Sweet Love golden print - Large / Colorful
Deep purple laser-cut gift box with hollow floral patterns and gold butterfly accent - Small / Purple
Purple hollow-out floral candy box with 3D butterfly lid and Sweet Love gold lettering - Large / Purple
+6
Laser Cut Hollow Flower Wedding Candy Box Butterfly Decoration Gift Favor Box For Wedding Party Birthday Celebration
$0.12-0.15
Mix MOQ : 50
 · 
300 sold recently
Elegant Square Cardboard Gift Boxes With Ribbon Bowknot For Cake Pastry Party Birthday Wedding Favor Packaging
Elegant Square Cardboard Gift Boxes With Ribbon Bowknot For Cake Pastry Party Birthday Wedding Favor Packaging
like
Find Similar
Square paper gift boxes in black, white and kraft with ribbons, small and large sizes - 9*9*6 / Multicolor
Minimalist black square pastry gift boxes with elegant ribbon bows on white background - 12*12*9 / Black
Elegant white square pastry gift boxes with brown ribbon bows for cake packaging - 12*12*9 / White
Minimalist kraft paper gift boxes with brown ribbon bows on a white background - 12*12*9 / Kraft Color
+4
Elegant Square Cardboard Gift Boxes With Ribbon Bowknot For Cake Pastry Party Birthday Wedding Favor Packaging
$0.16-0.24
Mix MOQ : 12
 · 
69 views
Butterfly Laser Cut Candy Boxes Pearlescent Paper Favor Gift Boxes With Ribbon For Wedding Party Birthday Celebration Elegant
Butterfly Laser Cut Candy Boxes Pearlescent Paper Favor Gift Boxes With Ribbon For Wedding Party Birthday Celebration Elegant
like
Find Similar
Elegant laser-cut butterfly wedding favor box in white pearlescent paper with ribbon - 4.5CM / Ivory White
White laser cut butterfly wedding favor box with shimmer paper and silk ribbon - 4.5CM / Silver
Elegant black butterfly laser-cut favor box with ribbon on a ceramic plate - 4.5CM / Black
Detailed macro view of laser-cut butterfly wedding favor box with purple ribbon - 4.5CM / Light Purple
+22
Butterfly Laser Cut Candy Boxes Pearlescent Paper Favor Gift Boxes With Ribbon For Wedding Party Birthday Celebration Elegant
$0.13
Mix MOQ : 50
 · 
15 views
Elegant Wedding Favor Candy Box Cardboard Paper Thank You Gold Stamping Ribbon Bow Minimalist Party Gift Packaging Bag
Elegant Wedding Favor Candy Box Cardboard Paper Thank You Gold Stamping Ribbon Bow Minimalist Party Gift Packaging Bag
like
Find Similar
Close-up of a white wedding favor box with a gold silk bow and Thank You lettering - White Box + Gold Ribbon
Detail of elegant white gift box with golden Thank You text and large white satin bow - White Box + White Ribbon
Detail of white wedding favor box with a purple satin bow and gold Thank You text - White Box + Purple Ribbon
Detail of white wedding favor box with black ribbon and gold thank you lettering - White Box + Black Ribbon
+2
Elegant Wedding Favor Candy Box Cardboard Paper Thank You Gold Stamping Ribbon Bow Minimalist Party Gift Packaging Bag
-5%
$0.16
Mix MOQ : 3
 · 
255 sold recently
Pillow Gift Box White Cardboard Christmas Halloween Party Candy Cookie Packaging Cartoon Santa Reindeer Festival Favor Bags
Pillow Gift Box White Cardboard Christmas Halloween Party Candy Cookie Packaging Cartoon Santa Reindeer Festival Favor Bags
like
Find Similar
Red Christmas reindeer pillow gift box for candy packaging, size 16x10x3cm - Red Base Reindeer
Forest green Christmas pillow gift box with Santa Claus print for sweets and treats - Snowman
Christmas pillow candy box with Santa and reindeer patterns for holiday gifts, size 16x11cm - Santa and Deer
Christmas snowman pillow candy box 16x11cm green holiday gift packaging for cookies - Snowman and Tree
+3
Pillow Gift Box White Cardboard Christmas Halloween Party Candy Cookie Packaging Cartoon Santa Reindeer Festival Favor Bags
$0.10
No MOQ
 · 
633 sold recently
Kraft Paper Gift Boxes With Handles Portable Candy Cake Treat Packaging For Wedding Birthday Party Holiday Favors
Kraft Paper Gift Boxes With Handles Portable Candy Cake Treat Packaging For Wedding Birthday Party Holiday Favors
like
Find Similar
Brown kraft paper gift box with handle and rustic decorations on white surface - 11.5*8.5*15.5cm / Kraft Paper Color
White kraft paper gift box with handle and clear window for pastry or candy packaging - 11.5*8.5*15.5cm / White
Kraft Paper Gift Boxes With Handles Portable Candy Cake Treat Packaging For Wedding Birthday Party Holiday Favors
$0.12
Mix MOQ : 50
 · 
30 sold recently
Laser Cut Floral Hollow Candy Box Pearl Paper Wedding Favor Gift Boxes Square Chocolate Packaging For Party Decoration
Laser Cut Floral Hollow Candy Box Pearl Paper Wedding Favor Gift Boxes Square Chocolate Packaging For Party Decoration
like
Find Similar
Laser cut white and gold gift box with floral pattern for wedding favors and cosmetics - White + Gold
Laser cut hollow gift box in navy blue with gold lining for perfume and candy packaging - Royal Blue + Gold
Square black laser-cut hollow gift box with elegant golden floral pattern and mirrored lid - Black + Gold
Red laser cut floral gift box with golden lining for weddings and cosmetics packaging - Pearl Red + Gold
+2
Laser Cut Floral Hollow Candy Box Pearl Paper Wedding Favor Gift Boxes Square Chocolate Packaging For Party Decoration
$0.21
Mix MOQ : 50
 · 
15 views
Laser-Cut Butterfly Candy Box Wedding Party Favor Gift Packaging Hollow Paper Box With Ribbon For Chocolate Sweet Treats
Laser-Cut Butterfly Candy Box Wedding Party Favor Gift Packaging Hollow Paper Box With Ribbon For Chocolate Sweet Treats
like
Find Similar
Pink laser-cut butterfly wedding favor box with a white ribbon and delicate pearl finish - 50 Pieces / Pink
Laser cut butterfly gift box in purple cardstock with matching ribbon bow - 50 Pieces / Dark Purple
Golden laser-cut butterfly gift box with elegant translucent ribbon for wedding favors - 50 Pieces / Reflective Gold
Emerald green hollow butterfly gift box with elegant laser cut pattern and matching ribbon - 50 Pieces / Reflective Green
+15
Laser-Cut Butterfly Candy Box Wedding Party Favor Gift Packaging Hollow Paper Box With Ribbon For Chocolate Sweet Treats
$0.14
Mix MOQ : 50
 · 
101 sold recently
French Style Wedding Candy Boxes Elegant Floral Pattern Paper Gift Bags With Ribbon Handle And Metal Clip Party Favors
French Style Wedding Candy Boxes Elegant Floral Pattern Paper Gift Bags With Ribbon Handle And Metal Clip Party Favors
like
Find Similar
French style light blue wedding candy box with gold floral patterns and silk handle - 11.2*6*8.2cm / Blue
Pink French wedding candy box with yellow floral patterns and For You gold charm handle - 11.2*6*8.2cm / Pink
Light green triangular wedding favor box with yellow floral patterns and green ribbon handle - 11.2*6*8.2cm / Yellow-Green
French Style Wedding Candy Boxes Elegant Floral Pattern Paper Gift Bags With Ribbon Handle And Metal Clip Party Favors
$0.24
No MOQ
 · 
23 sold recently
Creative Diamond Wedding Candy Boxes Cardboard Gift Packaging With Ribbon Bronzing Letters For Bridal Shower Party Favors
Creative Diamond Wedding Candy Boxes Cardboard Gift Packaging With Ribbon Bronzing Letters For Bridal Shower Party Favors
like
Find Similar
Elegant red geometric wedding candy box with gold heart print and silk ribbon - Small Diamond / Burgundy [Burgundy Ribbon]
Red hexagonal wedding candy box with golden ribbon and Chinese Xi character pendant - Small Diamond / Burgundy [Champagne Gold Ribbon]
Elegant wine red square candy box with golden satin ribbon and best wishes print - Small Square / Wine Red [Gold Ribbon] (Double Happiness Print)
Elegant red diamond wedding candy box with a silk bow and golden BEST WISHES text - Small Square / Wine Red [Red Satin Ribbon] (With Double Happiness Wedding Candy Text)
+5
Creative Diamond Wedding Candy Boxes Cardboard Gift Packaging With Ribbon Bronzing Letters For Bridal Shower Party Favors
-11%
$0.08-0.14
Mix MOQ : 2
 · 
72 views
Kraft Paper Square Candy Box Pink Polka Dot Gift Packaging Box With Ribbon Twine For Wedding Birthday Party Favor Boxes
Kraft Paper Square Candy Box Pink Polka Dot Gift Packaging Box With Ribbon Twine For Wedding Birthday Party Favor Boxes
like
Find Similar
Pink polka dot square candy gift box with elegant silk ribbon bow on white background - Polka Dot With Ribbon / 50 Pieces / Pink Top-Bottom Lid Box
Eco-friendly brown kraft paper square gift box with natural twine bow for candy and party favors - With Twine Bow / 50 Pieces / Kraft Paper (Natural)
Kraft Paper Square Candy Box Pink Polka Dot Gift Packaging Box With Ribbon Twine For Wedding Birthday Party Favor Boxes
$0.06-0.07
Mix MOQ : 50
 · 
25 views
Square Gift Box Flower Petal Top Folding Kraft Paper Holographic Laser Favor Box Wedding Candy Soap Packaging Decor
Square Gift Box Flower Petal Top Folding Kraft Paper Holographic Laser Favor Box Wedding Candy Soap Packaging Decor
like
Find Similar
Minimalist square matte black gift box with a unique petal fold closure design - Black
White paper gift box with camellia petal folding top for wedding candy and favors - White
Square kraft paper gift box featuring a unique four-petal floral folding closure design - Kraft Color
Square laser gift box in kraft color with geometric holographic pattern and top buckle - Mini Plaid
Square Gift Box Flower Petal Top Folding Kraft Paper Holographic Laser Favor Box Wedding Candy Soap Packaging Decor
-16%
$0.05-0.06
Mix MOQ : 20
 · 
147 sold recently
Laser Cut Butterfly Wedding Candy Box Elegant Pearlescent Paper Gift Box With Ribbon For Party Favor Chocolate Packaging
Laser Cut Butterfly Wedding Candy Box Elegant Pearlescent Paper Gift Box With Ribbon For Party Favor Chocolate Packaging
like
Find Similar
Detail of white laser-cut butterfly gift box with delicate floral patterns and silk ribbon - White
Close-up of white laser-cut hollow butterfly gift box with elegant organza ribbon - Ivory
Detail of pink laser-cut butterfly wedding favor box with a soft sheer ribbon - Pink
Detailed close-up of a golden laser-cut butterfly wedding favor box with a silk ribbon bow - Gold
+6
Laser Cut Butterfly Wedding Candy Box Elegant Pearlescent Paper Gift Box With Ribbon For Party Favor Chocolate Packaging
$0.13
Mix MOQ : 50
 · 
50 sold recently
Glitter Candy Gift Boxes With Ribbon And Artificial Pearl For Wedding Engagement Party French Style Elegant Favor Box
Glitter Candy Gift Boxes With Ribbon And Artificial Pearl For Wedding Engagement Party French Style Elegant Favor Box
like
Find Similar
12 options
Glitter Candy Gift Boxes With Ribbon And Artificial Pearl For Wedding Engagement Party French Style Elegant Favor Box
$0.17-0.24
No MOQ
 · 
201 sold recently
Mini Lipstick Gift Box Drawer Style Cardboard Portable Packaging Bag With Ribbon Handle Floral Gingham For Party Favor
Mini Lipstick Gift Box Drawer Style Cardboard Portable Packaging Bag With Ribbon Handle Floral Gingham For Party Favor
like
Find Similar
Pink drawer gift box with pink and white plaid pattern and ribbon handle for small items - 9*4.5*10cm / Pink Plaid
Mini salmon pink lipstick gift box with summer themed patterns and a small ribbon handle - 9*4.5*10cm / Coral Red Watermelon
Mini light green floral lipstick gift box with a white lid and matching ribbon loop - 9*4.5*10cm / Mint Green Floral
Mini Lipstick Gift Box Drawer Style Cardboard Portable Packaging Bag With Ribbon Handle Floral Gingham For Party Favor
$0.14
No MOQ
 · 
83 views
Mini Kraft Paper Square Candy Box DIY Vintage Gift Containers With Hemp Rope For Wedding Party Favors Souvenirs Rustic
Mini Kraft Paper Square Candy Box DIY Vintage Gift Containers With Hemp Rope For Wedding Party Favors Souvenirs Rustic
like
Find Similar
Vintage small 5x5x5cm square kraft paper favor gift box with rustic jute twine string - 5cm Cowhide Leather + Round Tag
Elegant white 5x5x5cm square DIY candy favor box featuring white twine and gift tag - 5cm White Cowhide + Round Hanging Clip
Mini Kraft Paper Square Candy Box DIY Vintage Gift Containers With Hemp Rope For Wedding Party Favors Souvenirs Rustic
$0.06
Mix MOQ : 50
 · 
101 sold recently
Christmas Candy Gift Boxes Pyramid Shape Paper Santa Snowman Reindeer Elf Holiday Party Favors Ribbon Decoration
Christmas Candy Gift Boxes Pyramid Shape Paper Santa Snowman Reindeer Elf Holiday Party Favors Ribbon Decoration
like
Find Similar
Triangle Christmas gift box with snowman pattern, red ribbon and Merry Christmas tag - Snowman Face
Pyramid Christmas candy box with cute elf face design and festive red ribbon bow - Elf / Boy Face
Pyramid Christmas Santa gift box with red ribbon and Merry Christmas tag on white background - Santa Claus Face
Brown reindeer pyramid Christmas gift box with white snow top and a red ribbon bow - Reindeer Face
Christmas Candy Gift Boxes Pyramid Shape Paper Santa Snowman Reindeer Elf Holiday Party Favors Ribbon Decoration
$0.09
Mix MOQ : 50
 · 
80 sold recently
Heart Shaped Laser Cut Candy Box Artificial Pearl Paper Hollow Favor Gift Box With Ribbon For Wedding Party Decoration
Heart Shaped Laser Cut Candy Box Artificial Pearl Paper Hollow Favor Gift Box With Ribbon For Wedding Party Decoration
like
Find Similar
Laser-cut white heart wedding favor box with ribbon for chocolate and candy packaging - White
Close-up of pink laser-cut heart favor box with white ribbon on a white porcelain plate - Pink
Detail of champagne gold laser-cut heart candy box with silk ribbon on white plate - Gold
Detail of laser-cut heart pattern on tiffany blue wedding candy favor box with ribbon - Tiffany Blue
+12
Heart Shaped Laser Cut Candy Box Artificial Pearl Paper Hollow Favor Gift Box With Ribbon For Wedding Party Decoration
$0.13
Mix MOQ : 50
 · 
50 sold recently
Thank You Gift Box Paper Candy Packaging Handbag Shape With Satin Ribbon Handle Metal Buckle For Wedding Party Favor
Thank You Gift Box Paper Candy Packaging Handbag Shape With Satin Ribbon Handle Metal Buckle For Wedding Party Favor
like
Find Similar
Elegant white trapezoid gift box with gold ribbon handle and Thank You gold stamping - White
Detail of black matte gift box with golden ribbon and embossed Thank You text - Black
Trapezoidal brown kraft paper gift box with gold Thank You text and ribbon handle - Kraft Color
Thank You Gift Box Paper Candy Packaging Handbag Shape With Satin Ribbon Handle Metal Buckle For Wedding Party Favor
-15%
$0.17
No MOQ
 · 
61 sold recently
Marble Pattern Paper Gift Bags Ribbon Bow Thank You Print Wedding Party Favors Candy Boxes European Elegant Packaging
Marble Pattern Paper Gift Bags Ribbon Bow Thank You Print Wedding Party Favors Candy Boxes European Elegant Packaging
like
Find Similar
Elegant white marble gift box with golden Thank You text and grey ribbon bow - Grey Ribbon
Detail of marble pattern wedding candy box featuring elegant pink ribbon and gold Thank You text - Pink Ribbon
White marble pattern gift bag with gold Thank You text and red ribbon bow finish - Wine Red Ribbon
+3
Marble Pattern Paper Gift Bags Ribbon Bow Thank You Print Wedding Party Favors Candy Boxes European Elegant Packaging
-5%
$0.18-0.19
No MOQ
 · 
69 views
European Style Pillow Gift Boxes Bronzing Gold Silver Candy Box For Wedding Party Favor Elegant Cardstock Packaging
European Style Pillow Gift Boxes Bronzing Gold Silver Candy Box For Wedding Party Favor Elegant Cardstock Packaging
like
Find Similar
Silver geometric pillow gift box with 3D cube pattern and grey ribbon decoration - Silver Foil Stripes + Silver Ribbon
Elegant white pillow candy box with symmetrical golden foil pattern for wedding favors - Gold Foil Floral Pattern (Naked Box)
Pillow-shaped wedding favor box with silver metallic geometric 3D cube patterns - Silver Foil Stripes (Naked Box)
White and gold foil pillow gift box set with elegant gold satin ribbon for weddings - Gold Foil Floral Pattern + Gold Ribbon
+4
European Style Pillow Gift Boxes Bronzing Gold Silver Candy Box For Wedding Party Favor Elegant Cardstock Packaging
$0.05-0.06
Mix MOQ : 50
 · 
62 sold recently
Hexagon Gift Box Mini Candy Favor Boxes Gold Foil Stripes Dots Folding Cardboard For Wedding Birthday Party Celebration
Hexagon Gift Box Mini Candy Favor Boxes Gold Foil Stripes Dots Folding Cardboard For Wedding Birthday Party Celebration
like
Find Similar
Mini white hexagonal gift box with gold dots, ribbon tie and for you tag - Gold Polka Dots
Mini hexagonal gift box with gold and white vertical stripes and a gold bow tie knot - Gold Striped
Hexagon Gift Box Mini Candy Favor Boxes Gold Foil Stripes Dots Folding Cardboard For Wedding Birthday Party Celebration
$0.09
No MOQ
 · 
100 sold recently
Eid Mubarak Laser Cut Paper Candy Box Moon Mosque Pattern Favor Box With Satin Ribbon For Ramadan Party Gift Wrap Supplies
Eid Mubarak Laser Cut Paper Candy Box Moon Mosque Pattern Favor Box With Satin Ribbon For Ramadan Party Gift Wrap Supplies
like
Find Similar
Macro shot of gold hollow gift box featuring laser-cut moon and mosque patterns - Reflective Gold
Silver laser-cut candy box with crescent moon and blue ribbon for Eid party favors - Reflective Silver
Close-up of black laser-cut candy box with hollow moon and mosque pattern and silk ribbon - Black Khaki
White iridescent laser-cut favor box with moon palace pattern and white organza ribbon - Mirror Iridescent
Eid Mubarak Laser Cut Paper Candy Box Moon Mosque Pattern Favor Box With Satin Ribbon For Ramadan Party Gift Wrap Supplies
$0.13
Mix MOQ : 50
Go to

More in party supplies

Explore more in favor boxes

partygoldartificialdecorativeheartstoragehandmadestorage boxtagsdecoration accessories
hollowshapesquarewindowsmalltasselwrappingflippackaging baggift wrapping

Ready to source like an insider

Get a direct line to the factory floor — no minimums, no middlemen, no guesswork.
iconReal factory pricing, no markup in betweeniconEvery order hand-inspected before it shipsicon5,000+ new products added daily
Get Inside Access