Everful

Wholesale favor boxes

Factory-direct selection, vetted for quality and ready to order.

Sign Up
Favor Boxes

Find the perfect pieces: party gift bags, party favors, gift wrapping supplies and more

filterShow Filters
Best Seller
New Arrivals
Price Drop
Free Shipping
Laser Cut Hollow Floral Wedding Candy Box Pearlescent Paper Gift Boxes With Ribbon For Party Favor Celebration Decoration
Laser Cut Hollow Floral Wedding Candy Box Pearlescent Paper Gift Boxes With Ribbon For Party Favor Celebration Decoration
like
Find Similar
Elegant white laser-cut heart wedding favor box with a delicate white ribbon bow - White
Detail of red laser-cut candy box with floral patterns and matching chiffon ribbon bow - Pearlescent Red
Elegant hollow black favor box with intricate floral laser-cut design and ribbon - Black Khaki
Laser cut hollow wedding candy gift box in tiffany blue with elegant silk ribbon bow - Tiffany Blue
+6
Laser Cut Hollow Floral Wedding Candy Box Pearlescent Paper Gift Boxes With Ribbon For Party Favor Celebration Decoration
$0.12
Mix MOQ : 50
Elegant Laser Cut Rose Hollow Favor Box Pearl Paper Wedding Candy Chocolate Gift Box For Party Decorations Valentine
Elegant Laser Cut Rose Hollow Favor Box Pearl Paper Wedding Candy Chocolate Gift Box For Party Decorations Valentine
like
Find Similar
Laser-cut hollow pink candy box with gold lining and rose pattern for weddings - Pearlescent Red
Purple glitter favor box with laser-cut rose design and gold interior for weddings - Dark Purple
Laser-cut rose pattern blue gift box with golden interior for wedding candies and chocolates - Tiffany Blue
Golden laser-cut wedding candy box with elegant rose pattern for chocolates - Reflective Gold
+6
NewElegant Laser Cut Rose Hollow Favor Box Pearl Paper Wedding Candy Chocolate Gift Box For Party Decorations Valentine
-5%
$0.16
Mix MOQ : 50
Laser Cut Star Of David Favor Boxes With Ribbon Hollow Out Paper Candy Gift Boxes For Hanukkah Jewish Wedding Party Celebration
Laser Cut Star Of David Favor Boxes With Ribbon Hollow Out Paper Candy Gift Boxes For Hanukkah Jewish Wedding Party Celebration
like
Find Similar
Elegant white laser cut Hanukkah favor box with Star of David and white ribbon bow - White
Close-up of laser-cut hexagonal star patterns on white pearlescent gift candy box - Ivory
Close-up of pink house-shaped paper gift box with hollow geometric cutout and white ribbon bow - Pink
Elegant gold laser cut Hanukkah gift box with hexagonal pattern and silk ribbon - Gold
+6
Laser Cut Star Of David Favor Boxes With Ribbon Hollow Out Paper Candy Gift Boxes For Hanukkah Jewish Wedding Party Celebration
$0.13
Mix MOQ : 50
Laser Cut Floral Paper Candy Box With Ribbon Bow European Style Hollow Wedding Party Favor Chocolate Gift Packaging Box
Laser Cut Floral Paper Candy Box With Ribbon Bow European Style Hollow Wedding Party Favor Chocolate Gift Packaging Box
like
Find Similar
Detail of red laser-cut candy box with floral patterns and a matching organza ribbon bow - Pearlescent Red
Silver laser-cut hollow floral wedding favor box with a light blue satin ribbon bow - Reflective Silver
Laser-cut white wedding favor box with floral patterns and ribbon on dark wood background - White
Detail of pink laser-cut paper gift box with floral patterns and a soft ribbon bow - Pink
+6
Laser Cut Floral Paper Candy Box With Ribbon Bow European Style Hollow Wedding Party Favor Chocolate Gift Packaging Box
$0.13
Mix MOQ : 50
Laser Cut Hollow Heart Love Candy Box With Ribbon Wedding Favor Gift Box For Party Chocolate Packaging
Laser Cut Hollow Heart Love Candy Box With Ribbon Wedding Favor Gift Box For Party Chocolate Packaging
like
Find Similar
White laser-cut Love candy box with heart patterns and silk ribbon for wedding favors - White
Elegant white laser-cut heart favor box with Love script and a silk ribbon bow - Ivory
Close-up of golden hollow candy box with heart Love laser cut and yellow ribbon - Reflective Gold
Detail of silver laser-cut candy box with Love heart hollow design and blue ribbon bow - Reflective Silver
+6
Laser Cut Hollow Heart Love Candy Box With Ribbon Wedding Favor Gift Box For Party Chocolate Packaging
$0.12
Mix MOQ : 50
Laser Cut Floral Hollow Wedding Candy Box Paper Gift Box With Ribbon For Bridal Shower Birthday Party Decoration Favors
Laser Cut Floral Hollow Wedding Candy Box Paper Gift Box With Ribbon For Bridal Shower Birthday Party Decoration Favors
like
Find Similar
Detail of laser-cut vine pattern on white gift box with elegant organza ribbon bow - White
Close-up of laser-cut white wedding favor box with lace pattern and white ribbon bow - Ivory
Detailed laser-cut vine patterns on gold wedding candy box with orange organza ribbon - Reflective Gold
Detail of laser-cut gold gift box featuring a blue satin ribbon on reflective cardstock - Reflective Silver
+6
Laser Cut Floral Hollow Wedding Candy Box Paper Gift Box With Ribbon For Bridal Shower Birthday Party Decoration Favors
$0.13
Mix MOQ : 50
Laser Cut Hollow Flower Wedding Candy Box European Style Pearlescent Paper Gift Box With Ribbon For Party Favor Decoration
Laser Cut Hollow Flower Wedding Candy Box European Style Pearlescent Paper Gift Box With Ribbon For Party Favor Decoration
like
Find Similar
Elegant white laser-cut floral favor box with a delicate white organza ribbon bow - White
White laser-cut floral gift box with an elegant silk ribbon bow for wedding favors - Ivory
Detail of pink laser-cut floral gift box with an elegant white ribbon bow closure - Pink
Close-up of bright yellow laser-cut candy box with floral patterns and matching ribbon - Gold
+6
Laser Cut Hollow Flower Wedding Candy Box European Style Pearlescent Paper Gift Box With Ribbon For Party Favor Decoration
$0.13
Mix MOQ : 50
Laser Cut Cross Candy Boxes With Ribbon Elegant Hollow Paper Gift Box For Wedding Baptism Communion Party Favors
Laser Cut Cross Candy Boxes With Ribbon Elegant Hollow Paper Gift Box For Wedding Baptism Communion Party Favors
like
Find Similar
Detail of white laser-cut wedding favor box with cross pattern and organza ribbon - White
Laser cut white cross wedding favor box with floral patterns and a chiffon ribbon tie - Ivory
Pink laser-cut hollow candy box with light pink ribbon for weddings and elegant parties - Pink
Detail of laser-cut cross floral pattern on golden candy box with ribbon bow - Gold
+6
Laser Cut Cross Candy Boxes With Ribbon Elegant Hollow Paper Gift Box For Wedding Baptism Communion Party Favors
$0.13
Mix MOQ : 50
Laser Cut Heart Shape Wedding Candy Boxes Ribbon Couple Silhouette Party Favor Gift Boxes For Valentine Day Engagement
Laser Cut Heart Shape Wedding Candy Boxes Ribbon Couple Silhouette Party Favor Gift Boxes For Valentine Day Engagement
like
Find Similar
Laser cut white wedding favor box with bride groom silhouette and white ribbon - White
Close-up of white laser-cut wedding favor box with organza ribbon and couple silhouette - Ivory
Pink heart laser cut wedding favor box with silhouette design and white ribbon bow - Pink
Golden laser-cut wedding favor box with romantic heart and couple silhouette design - Gold
+6
Laser Cut Heart Shape Wedding Candy Boxes Ribbon Couple Silhouette Party Favor Gift Boxes For Valentine Day Engagement
$0.13
Mix MOQ : 50
Laser Cut Heart Love Wedding Favor Candy Boxes With Ribbon And Thank You Tags Rose Floral Gift Box For Wedding Party Favor
Laser Cut Heart Love Wedding Favor Candy Boxes With Ribbon And Thank You Tags Rose Floral Gift Box For Wedding Party Favor
like
Find Similar
Macro shot of white laser-cut wedding favor box with Love heart and silk bow detail - White
Detail of white laser-cut favor box with Love motif and thank you tag with ribbon - Ivory
Pink hollowed heart Love candy gift box with rose pattern and thank you tag for weddings - Pink
Detail of golden laser-cut wedding favor box with Love motif and thank you tag - Gold
+6
Laser Cut Heart Love Wedding Favor Candy Boxes With Ribbon And Thank You Tags Rose Floral Gift Box For Wedding Party Favor
$0.14
Mix MOQ : 50
Laser Cut Wedding Favor Boxes Hollow Bride And Groom Silhouette Candy Box Pearl Paper Gift Box With Ribbon For Marriage Party
Laser Cut Wedding Favor Boxes Hollow Bride And Groom Silhouette Candy Box Pearl Paper Gift Box With Ribbon For Marriage Party
like
Find Similar
Detailed laser-cut white wedding favor box with bride and groom silhouette and ribbon - White
Detailed laser-cut wedding favor box with bride and groom silhouette and white ribbon bow - Starry White
Macro view of laser-cut wedding favor box featuring bride and groom silhouette detail - Jewelry Cream Star
Close-up of pink laser-cut wedding favor box with ribbon detail on a white ceramic plate - Pink
+6
Laser Cut Wedding Favor Boxes Hollow Bride And Groom Silhouette Candy Box Pearl Paper Gift Box With Ribbon For Marriage Party
$0.13
No MOQ
Laser Cut Wedding Favor Candy Boxes With Ribbon Hollow Rose Pattern Pearl Paper Gift Boxes For Party Wedding Celebration
Laser Cut Wedding Favor Candy Boxes With Ribbon Hollow Rose Pattern Pearl Paper Gift Boxes For Party Wedding Celebration
like
Find Similar
Laser-cut floral wedding candy box with elegant white ribbon on wooden surface - White
Detail of laser-cut white favor box with floral patterns and organza ribbon bow - Ivory
Laser cut laser-cut gold favor box with pearl paper floral bird patterns and ribbon - Jewelry Cream Star
Detail of laser-cut floral patterns on light blue wedding favor box with ribbon bow - Tiffany Blue
+6
Laser Cut Wedding Favor Candy Boxes With Ribbon Hollow Rose Pattern Pearl Paper Gift Boxes For Party Wedding Celebration
$0.15
Mix MOQ : 50
Laser Cut Wedding Favor Box With Ribbon Bride Groom Silhouette Hollow Paper Candy Box Party Decoration Celebration Gift
Laser Cut Wedding Favor Box With Ribbon Bride Groom Silhouette Hollow Paper Candy Box Party Decoration Celebration Gift
like
Find Similar
White laser cut wedding favor box with romantic bride and groom silhouette and ribbon - 5*5*8CM / White
Detail of laser-cut white wedding favor box showing bride and groom silhouette with ribbon - 5*5*8CM / Ivory
Pink laser-cut wedding favor box featuring romantic couple silhouette and organza ribbon bow - 5*5*8CM / Pink
Detailed laser-cut light blue wedding candy box with ribbon and bride groom silhouette - 5*5*8CM / Pearl Pale Blue
+6
Laser Cut Wedding Favor Box With Ribbon Bride Groom Silhouette Hollow Paper Candy Box Party Decoration Celebration Gift
$0.13
Mix MOQ : 50
Elegant Laser Cut Butterfly Hollow Wedding Candy Box Pearlescent Paper Gift Box With Ribbon For Valentine Day Party Favor Box
Elegant Laser Cut Butterfly Hollow Wedding Candy Box Pearlescent Paper Gift Box With Ribbon For Valentine Day Party Favor Box
like
Find Similar
Laser cut white butterfly candy box made of pearlescent paper with white ribbon bow - White
Golden laser-cut butterfly gift box with matching organza ribbon for weddings - Gold
Elegant white laser-cut butterfly gift box with translucent ribbon for weddings - Ivory
Laser cut butterfly candy box in Tiffany blue with ribbon bow for wedding gifts - Turquoise Blue
+5
Elegant Laser Cut Butterfly Hollow Wedding Candy Box Pearlescent Paper Gift Box With Ribbon For Valentine Day Party Favor Box
-6%
$0.15
Mix MOQ : 50
Laser Cut Wedding Candy Box Hollow Floral Gift Box With Ribbon For Party Favor Chocolate Sugar Packaging Case
Laser Cut Wedding Candy Box Hollow Floral Gift Box With Ribbon For Party Favor Chocolate Sugar Packaging Case
like
Find Similar
Detailed laser-cut red wedding favor box with elegant floral hollows and ribbon bow - Pearlescent Red
Close-up of light blue laser-cut candy box with elegant ribbon and heart detail - Tiffany Blue
Macro view of silver laser-cut wedding candy box with floral patterns and blue ribbon - Reflective Silver
Close-up of white laser-cut floral wedding candy box with ribbon bow and heart detail - White
+6
Laser Cut Wedding Candy Box Hollow Floral Gift Box With Ribbon For Party Favor Chocolate Sugar Packaging Case
$0.12
Mix MOQ : 50
Elegant Laser Cut Butterfly Wedding Candy Box Hollow Gold Silver Chocolate Gift Box For Wedding Party Favors Decoration
Elegant Laser Cut Butterfly Wedding Candy Box Hollow Gold Silver Chocolate Gift Box For Wedding Party Favors Decoration
like
Find Similar
Hollow laser cut butterfly gift box in bright gold finish for wedding favors and candy - Reflective Gold
Elegant laser-cut butterfly wedding candy box with shiny metallic finish and chocolates - Reflective Silver
Elegant white laser-cut butterfly candy box with gold inner lining for wedding gifts - White
White laser-cut butterfly gift box with hollow pattern for wedding favors or candies - Ivory
+5
Elegant Laser Cut Butterfly Wedding Candy Box Hollow Gold Silver Chocolate Gift Box For Wedding Party Favors Decoration
$0.16
Mix MOQ : 50
European Laser Cut Love Birds Wedding Candy Box Heart Shaped Hollow Pearlescent Paper Gift Favor Box With Ribbon Bow For Party Decor
European Laser Cut Love Birds Wedding Candy Box Heart Shaped Hollow Pearlescent Paper Gift Favor Box With Ribbon Bow For Party Decor
like
Find Similar
Laser-cut white wedding favor box with lovebird patterns and elegant white silk ribbon - White
Pink laser cut wedding favor box with love birds pattern and sheer silver ribbon bow - Pink
Golden laser cut lovebird candy box with ribbon for European wedding and Valentine gift - Gold
Detailed laser-cut dark purple candy box featuring bird patterns and matching silk ribbon bow - Dark Purple
+7
European Laser Cut Love Birds Wedding Candy Box Heart Shaped Hollow Pearlescent Paper Gift Favor Box With Ribbon Bow For Party Decor
$0.12
Mix MOQ : 50
Laser Cut Hollow Cross Candy Box European Style Wedding Party Favor Chocolate Gift Packaging Paper Box With Ribbon
Laser Cut Hollow Cross Candy Box European Style Wedding Party Favor Chocolate Gift Packaging Paper Box With Ribbon
like
Find Similar
Elegant white laser-cut hollow cross gift box with white organza ribbon for weddings - White
Detail of laser-cut white cross favor box with elegant organza ribbon for weddings - Ivory
Pink laser-cut cross favor box with white ribbon for wedding or baptism events - Pink
Laser cut gold favor box with hollow cross design and orange organza ribbon bow - Reflective Gold
+7
Laser Cut Hollow Cross Candy Box European Style Wedding Party Favor Chocolate Gift Packaging Paper Box With Ribbon
-7%
$0.12
Mix MOQ : 50
Laser Cut Heart Shaped Wedding Favor Candy Box Floral Hollow Gift Paper Box Ribbon Embellishment For Marriage Celebration
Laser Cut Heart Shaped Wedding Favor Candy Box Floral Hollow Gift Paper Box Ribbon Embellishment For Marriage Celebration
like
Find Similar
Elegant white laser-cut hollow heart wedding favor box with ribbon on wooden background - White
Laser cut heart shaped candy box in pink with floral patterns and a satin ribbon bow - Pink
Elegant laser-cut heart candy box in gold finish with delicate floral patterns - Gold Yellow
Elegant white heart-shaped laser-cut wedding favor box with a delicate ribbon bow - Ivory
+3
Laser Cut Heart Shaped Wedding Favor Candy Box Floral Hollow Gift Paper Box Ribbon Embellishment For Marriage Celebration
$0.13
Mix MOQ : 50
White Laser Cut Wedding Favor Box Heart Hollow Paper Confetti Cone For Petals Candy Packaging Gift Box With Ribbon Party Decorations
White Laser Cut Wedding Favor Box Heart Hollow Paper Confetti Cone For Petals Candy Packaging Gift Box With Ribbon Party Decorations
like
Find Similar
1 option
White Laser Cut Wedding Favor Box Heart Hollow Paper Confetti Cone For Petals Candy Packaging Gift Box With Ribbon Party Decorations
$0.12
Mix MOQ : 50
Laser Cut Rose Floral Hollow Candy Box Pearlescent Paper Gift Box With Ribbon For Wedding Valentine's Day Party Favor
Laser Cut Rose Floral Hollow Candy Box Pearlescent Paper Gift Box With Ribbon For Wedding Valentine's Day Party Favor
like
Find Similar
Detailed laser-cut hollow rose pattern on a white wedding favor box with ribbon - White
Detail of laser-cut rose hollow gift box with elegant white organza ribbon bow - Ivory
Elegant pink hollow rose gift box with white organza ribbon and laser-cut design - Pink
Elegant gold hollow rose gift box with shimmering ribbon for weddings and celebrations - Reflective Gold
+5
Laser Cut Rose Floral Hollow Candy Box Pearlescent Paper Gift Box With Ribbon For Wedding Valentine's Day Party Favor
-7%
$0.12
Mix MOQ : 50
Laser Cut Cross Candy Boxes Wedding Favor Gift Box With Ribbon For Baptism Religious Celebration Paper Chocolate Boxes
Laser Cut Cross Candy Boxes Wedding Favor Gift Box With Ribbon For Baptism Religious Celebration Paper Chocolate Boxes
like
Find Similar
Laser cut white paper gift box with cross pattern and white ribbon for wedding candy - White
Close-up of laser-cut white favor box with cross design and white organza ribbon bow - Ivory
Pink laser-cut wedding candy box with hollow cross design and decorative pink ribbon bow - Pink
Golden laser-cut cross favor box with elegant hollow vines and a matching gold silk ribbon - Gold
+5
Laser Cut Cross Candy Boxes Wedding Favor Gift Box With Ribbon For Baptism Religious Celebration Paper Chocolate Boxes
$0.13
Mix MOQ : 50
Laser Cut Hollow Rose Flower Wedding Candy Box Pearl Paper Gift Box With Ribbon For Chocolate Party Favor Packaging
Laser Cut Hollow Rose Flower Wedding Candy Box Pearl Paper Gift Box With Ribbon For Chocolate Party Favor Packaging
like
Find Similar
9 options
Laser Cut Hollow Rose Flower Wedding Candy Box Pearl Paper Gift Box With Ribbon For Chocolate Party Favor Packaging
$0.17
Mix MOQ : 50
Teddy Bear Laser Cut Candy Boxes Pearl Paper Gift Box With Ribbon Bow For Wedding Birthday Party Favors Children Day Decoration
Teddy Bear Laser Cut Candy Boxes Pearl Paper Gift Box With Ribbon Bow For Wedding Birthday Party Favors Children Day Decoration
like
Find Similar
Detail of laser-cut white favor box with bear hollow design and white organza ribbon bow - White
Pink hollow bear paper candy box with white ribbon for wedding party favors and gifts - Pink
Detail of purple hollow-out gift box with fine floral patterns and a ribbon bow - Dark Purple
Light blue hollowed-out bear candy paper box with elegant ribbon for party favors - Tiffany Blue
+5
Teddy Bear Laser Cut Candy Boxes Pearl Paper Gift Box With Ribbon Bow For Wedding Birthday Party Favors Children Day Decoration
$0.13
Mix MOQ : 50
Laser Cut Hollow Butterfly Candy Box Wedding Favor Gift Box With Ribbon For Chocolate Party Packaging Paper Favor Box
Laser Cut Hollow Butterfly Candy Box Wedding Favor Gift Box With Ribbon For Chocolate Party Packaging Paper Favor Box
like
Find Similar
White laser cut butterfly favor box with ribbon for weddings and elegant parties - White
Detailed laser-cut butterfly gift box with delicate floral hollow patterns and silk ribbon - Ivory
Pink laser-cut butterfly wedding favor box with hollow floral patterns and white ribbon - Pink
Laser cut butterfly candy box in bright gold finish with matching organza ribbon bow - Gold
+5
Laser Cut Hollow Butterfly Candy Box Wedding Favor Gift Box With Ribbon For Chocolate Party Packaging Paper Favor Box
$0.14
Mix MOQ : 50
Laser Cut Ramadan Eid Mubarak Candy Boxes Moon Star Hollow Pearlescent Paper Wedding Festival Party Favor Gift Packaging Box
Laser Cut Ramadan Eid Mubarak Candy Boxes Moon Star Hollow Pearlescent Paper Wedding Festival Party Favor Gift Packaging Box
like
Find Similar
Elegant red and gold Ramadan candy box featuring laser-cut mosque and moon patterns - 5*5cm / Pearlescent Red
Detail of white and gold gift box with laser-cut star and moon mosque patterns - 5*5cm / Reflective Silver
White and gold Ramadan gift box featuring laser-cut mosque and moon star patterns - 5*5cm / White
Detail of pink cardstock gift box with gold foil lining and laser-cut mosque motifs - 5*5cm / Pink
+5
Laser Cut Ramadan Eid Mubarak Candy Boxes Moon Star Hollow Pearlescent Paper Wedding Festival Party Favor Gift Packaging Box
$0.23
Mix MOQ : 50
Laser Cut Hollow Butterfly Chocolate Decoration Holder Pearl Paper Candy Box For Wedding Birthday Party Favors Dessert Decor
Laser Cut Hollow Butterfly Chocolate Decoration Holder Pearl Paper Candy Box For Wedding Birthday Party Favors Dessert Decor
like
Find Similar
Detailed laser-cut pearl paper butterfly card with intricate hollow white floral patterns - 3.9CM / Reflective Gold
Detailed laser-cut butterfly hollow pattern on white pearlescent paper wedding gift box - 3.9CM / White
Pink 3D butterfly laser-cut place card made of glitter pearlescent paper for party tables - 3.9CM / Pink
Macro shot of sky blue pearlescent candy box with laser cut hollow butterfly designs - 3.9CM / Pearl Pale Blue
+6
Laser Cut Hollow Butterfly Chocolate Decoration Holder Pearl Paper Candy Box For Wedding Birthday Party Favors Dessert Decor
$0.08
Mix MOQ : 50
Laser Cut Cross Paper Candy Box European Style Hollow Gift Favor Box With Ribbon For Wedding Baptism Party Communion
Laser Cut Cross Paper Candy Box European Style Hollow Gift Favor Box With Ribbon For Wedding Baptism Party Communion
like
Find Similar
White laser-cut cross favor box with delicate European floral patterns and organza ribbon - White
Detail of white laser-cut wedding favor box featuring an elegant hollow cross design - Ivory
Pink laser-cut candy box with cross hollow pattern and ribbon for wedding favors - Pink
Macro detail of laser-cut cross pattern on golden wedding candy box with ribbon - Gold
+4
Laser Cut Cross Paper Candy Box European Style Hollow Gift Favor Box With Ribbon For Wedding Baptism Party Communion
$0.13
Mix MOQ : 50
Elegant Laser Cut Butterfly Hollow Candy Box Pearlescent Paper Floral Gift Box Wedding Party Celebration Favor Packaging
Elegant Laser Cut Butterfly Hollow Candy Box Pearlescent Paper Floral Gift Box Wedding Party Celebration Favor Packaging
like
Find Similar
Detailed laser-cut white butterfly candy box with elegant floral hollow patterns for wedding - White
Elegant purple laser-cut wedding candy box with intricate butterfly and floral patterns - Dark Purple
Close-up of pink laser-cut wedding candy box with intricate floral patterns and butterfly top - Pink
Elegant light blue laser-cut wedding favor box with intricate butterfly and floral patterns - Tiffany Blue
+4
Elegant Laser Cut Butterfly Hollow Candy Box Pearlescent Paper Floral Gift Box Wedding Party Celebration Favor Packaging
-7%
$0.12
Mix MOQ : 50
European Laser Cut Hollow Paper Candy Box With Letter Mosque Silhouette Pattern Favor Box For Wedding Eid Party Decoration
European Laser Cut Hollow Paper Candy Box With Letter Mosque Silhouette Pattern Favor Box For Wedding Eid Party Decoration
like
Find Similar
8 options
European Laser Cut Hollow Paper Candy Box With Letter Mosque Silhouette Pattern Favor Box For Wedding Eid Party Decoration
$0.23
Mix MOQ : 50
Laser Cut Hollow Rose Flower Candy Box Pearlescent Paper Wedding Favor Gift Box For Party Souvenirs Guest Decoration
Laser Cut Hollow Rose Flower Candy Box Pearlescent Paper Wedding Favor Gift Box For Party Souvenirs Guest Decoration
like
Find Similar
Macro view of white laser-cut floral pattern and hollow detail on wedding favor box - Laser Hollow (XTH-433) / White
Macro shot of pink laser-cut candy box with elegant floral patterns and pearlescent finish - Laser Hollow (XTH-433) / Pink
Laser cut sky blue floral wedding favor box with intricate hollow pumpkin shape design - Laser Hollow (XTH-433) / Tiffany Blue
Detailed laser-cut champagne gold floral favor box with intricate hollow design - Laser Hollow (XTH-433) / Beige Gold
+4
Laser Cut Hollow Rose Flower Candy Box Pearlescent Paper Wedding Favor Gift Box For Party Souvenirs Guest Decoration
$0.17
Mix MOQ : 50
Halloween Candy Gift Box Portable Paper Cake Box With Handle Spider Web Print Cardboard Festive Party Favor Packaging Box
Halloween Candy Gift Box Portable Paper Cake Box With Handle Spider Web Print Cardboard Festive Party Favor Packaging Box
like
Find Similar
Detail of red Spider-Man themed party gift box with spider web patterns and top handle - A026-3 Style / Red
Detail of Spiderman style gift box with red spider web print and handle - A026-4 Style / Black
Red Spider-Man themed gift box with spider web patterns and handle for parties - Red
Halloween Spiderweb Gift Box with Red Spider Print and Convenient Carry Handle - Black
+2
NewHalloween Candy Gift Box Portable Paper Cake Box With Handle Spider Web Print Cardboard Festive Party Favor Packaging Box
$0.19
Mix MOQ : 12
Laser Cut Heart Hollow Wedding Candy Boxes Pearlescent Paper Gift Box With Ribbon Thank You Tag For Party Favor Packaging
Laser Cut Heart Hollow Wedding Candy Boxes Pearlescent Paper Gift Box With Ribbon Thank You Tag For Party Favor Packaging
like
Find Similar
Macro detail of white laser-cut hollow heart candy box with ribbon and gold foil tag - White
Close-up of laser-cut white heart gift box with ribbon and gold thank you tag - Ivory
Pink laser-cut wedding favor box with heart pattern and white thank you ribbon - Pink
Detailed laser-cut gold wedding favor box with heart patterns and thank you tag - Gold
+2
Laser Cut Heart Hollow Wedding Candy Boxes Pearlescent Paper Gift Box With Ribbon Thank You Tag For Party Favor Packaging
$0.14
Mix MOQ : 50
Laser Cut Hollow Wedding Favor Candy Box Intricate Heart Wine Glass Pattern Pearl Paper Gift Boxes With Ribbon For Wedding Party
Laser Cut Hollow Wedding Favor Candy Box Intricate Heart Wine Glass Pattern Pearl Paper Gift Boxes With Ribbon For Wedding Party
like
Find Similar
White laser-cut wedding favor box with champagne flute design and organza ribbon bow - White
Laser cut white hollow favor box with champagne glass pattern and white ribbon - Ivory
Elegant gold laser-cut candy box with orange ribbon for weddings and festive parties - Reflective Gold
Macro shot of silver hollow gift box with blue ribbon bow for wedding celebrations - Reflective Silver
+6
Laser Cut Hollow Wedding Favor Candy Box Intricate Heart Wine Glass Pattern Pearl Paper Gift Boxes With Ribbon For Wedding Party
-7%
$0.12
Mix MOQ : 50
Laser Cut Hollow Out Floral Candy Box European Style Pearlescent Paper Gift Box With Ribbon For Wedding Party Favor Packaging
Laser Cut Hollow Out Floral Candy Box European Style Pearlescent Paper Gift Box With Ribbon For Wedding Party Favor Packaging
like
Find Similar
White laser-cut wedding favor box with floral patterns and ribbon on dark wood - White
Golden laser-cut wedding candy box with elegant floral pattern and ribbon - Gold
White laser-cut candy box with floral patterns and a white ribbon for wedding parties - Ivory
Laser-cut wedding favor box in light blue with floral patterns and a ribbon bow - Turquoise Blue
+6
Laser Cut Hollow Out Floral Candy Box European Style Pearlescent Paper Gift Box With Ribbon For Wedding Party Favor Packaging
$0.16
Mix MOQ : 50
Hollow Laser Cut Sun Pattern Candy Box With Ribbon House Shape Pearlescent Paper Gift Box For Wedding Party Favor Box
Hollow Laser Cut Sun Pattern Candy Box With Ribbon House Shape Pearlescent Paper Gift Box For Wedding Party Favor Box
like
Find Similar
Elegant white laser-cut hollow candy box with sun pattern and white organza ribbon bow - White
Detail of laser-cut sun pattern on white pearlescent paper gift box with organza ribbon - Ivory
Close-up of pink hollow house-shaped candy box with intricate laser-cut sun patterns - Pink
Macro detail of laser-cut sunburst pattern and blue ribbon on light blue gift box - Pearl Pale Blue
+6
Hollow Laser Cut Sun Pattern Candy Box With Ribbon House Shape Pearlescent Paper Gift Box For Wedding Party Favor Box
$0.13
Mix MOQ : 50
Laser Cut Musical Note Hollow Candy Box Pearlescent Paper Gift Box With Ribbon Bow For Wedding Music Theme Party Favor
Laser Cut Musical Note Hollow Candy Box Pearlescent Paper Gift Box With Ribbon Bow For Wedding Music Theme Party Favor
like
Find Similar
White laser-cut music note gift box with ribbon and gold foil chocolate inside - White
Light blue laser-cut candy box with musical notes pattern and a silk ribbon bow - Tiffany Blue
Laser-cut music note paper candy box in gold finish with yellow silk ribbon bow - Gold
Close-up of purple laser-cut musical note favor box with elegant satin ribbon bow - Dark Purple
+6
NewLaser Cut Musical Note Hollow Candy Box Pearlescent Paper Gift Box With Ribbon Bow For Wedding Music Theme Party Favor
$0.13
No MOQ
Laser Cut Rose Pattern Butterfly Buckle Candy Box Pearlescent Paper Wedding Favor Boxes Chocolate Gift Bag Party Decoration
Laser Cut Rose Pattern Butterfly Buckle Candy Box Pearlescent Paper Wedding Favor Boxes Chocolate Gift Bag Party Decoration
like
Find Similar
Ivory laser-cut wedding favor box with butterfly clasp and elegant rose patterns - White
Detailed laser-cut purple paper gift box with butterfly closure and floral patterns - Dark Purple
Close-up of pink laser-cut favor box with rose patterns and 3D butterfly closure - Pink
Detailed macro view of laser-cut rose patterns and butterfly clasp on kraft paper box - Beige Gold
+6
Laser Cut Rose Pattern Butterfly Buckle Candy Box Pearlescent Paper Wedding Favor Boxes Chocolate Gift Bag Party Decoration
$0.13
Mix MOQ : 50
Laser Cut Wedding Favor Boxes Hollow Heart Floral Candy Box With Ribbon Bow For Marriage Party Small Gift Packaging
Laser Cut Wedding Favor Boxes Hollow Heart Floral Candy Box With Ribbon Bow For Marriage Party Small Gift Packaging
like
Find Similar
Elegant laser-cut white favor box with floral patterns and white satin ribbon for weddings - White
Elegant pink laser-cut hollow gift box with floral heart patterns and a ribbon bow - Pink
Macro detail of laser-cut floral pattern and organza ribbon on ivory paper gift box - Ivory
Detail of laser-cut flower and butterfly patterns on yellow gift box with ribbon - Gold
+6
Laser Cut Wedding Favor Boxes Hollow Heart Floral Candy Box With Ribbon Bow For Marriage Party Small Gift Packaging
$0.12
Mix MOQ : 50
Christmas Gift Boxes Cardboard Foldable 3D Cartoon Santa Snowman Character Candy Cookie Packaging Party Favors Holiday Supplies
Christmas Gift Boxes Cardboard Foldable 3D Cartoon Santa Snowman Character Candy Cookie Packaging Party Favors Holiday Supplies
like
Find Similar
White Christmas gift box with 3D polar bear, Santa and reindeer cardboard characters - 10pcs/Pack / White
Forest green Christmas gift box with 3D pop-up Santa and Christmas tree figures - 10pcs/Pack / Green
Christmas Gift Boxes Cardboard Foldable 3D Cartoon Santa Snowman Character Candy Cookie Packaging Party Favors Holiday Supplies
$1.90
Mix MOQ : 2
Laser Cut Rose Hollow Wedding Favor Box Pearl Paper Candy Gift Box For Chocolate Party Decoration European Style Supplies
Laser Cut Rose Hollow Wedding Favor Box Pearl Paper Candy Gift Box For Chocolate Party Decoration European Style Supplies
like
Find Similar
Elegant gold laser-cut candy box with floral hollow design for wedding favors - Reflective Gold
Laser-cut floral hollow candy box with metallic silver and gold finish for weddings - Reflective Silver
Detailed view of laser-cut wedding candy box with elegant floral patterns on a gold base - White
Macro detail of laser-cut wedding favor box with elegant floral patterns on white and gold card - Ivory
+3
Laser Cut Rose Hollow Wedding Favor Box Pearl Paper Candy Gift Box For Chocolate Party Decoration European Style Supplies
$0.17
Mix MOQ : 50
Laser Cut Hollow Wedding Candy Boxes Pearl Paper Floral Favor Gift Box For Chocolate Party Decorations Banquet Supplies
Laser Cut Hollow Wedding Candy Boxes Pearl Paper Floral Favor Gift Box For Chocolate Party Decorations Banquet Supplies
like
Find Similar
Elegant hollow-out golden rectangular gift box for wedding candy and chocolate packaging - Reflective Gold
Elegant hollow-out silver laser cut wedding favor candy box with European scroll pattern - Reflective Silver
Hollow laser-cut white wedding candy box with elegant gold lining for party favors - White
Hollow laser-cut pink wedding favor box with gold foil accents and floral pattern - Pink
+3
Laser Cut Hollow Wedding Candy Boxes Pearl Paper Floral Favor Gift Box For Chocolate Party Decorations Banquet Supplies
$0.18
Mix MOQ : 50
Laser Cut Cross Hollow Glitter Paper Candy Box Wedding Favors Gift Box With Ribbon For Baptism Party Decorations
Laser Cut Cross Hollow Glitter Paper Candy Box Wedding Favors Gift Box With Ribbon For Baptism Party Decorations
like
Find Similar
Golden laser-cut cross gift box with glitter finish and ribbon for weddings - Sparkling Gold
Sparkly purple hollow cross candy box with ribbon for wedding and church events - Glitter Purple
NewLaser Cut Cross Hollow Glitter Paper Candy Box Wedding Favors Gift Box With Ribbon For Baptism Party Decorations
$0.13
Mix MOQ : 50
Laser Cut Wedding Favor Boxes Hollow Heart Design Pearlescent Paper Candy Box With Ribbon For Wedding Party Souvenirs Gift Wrap
Laser Cut Wedding Favor Boxes Hollow Heart Design Pearlescent Paper Candy Box With Ribbon For Wedding Party Souvenirs Gift Wrap
like
Find Similar
Elegant white laser-cut favor box with heart patterns and silk ribbon for weddings - White
Close-up of white laser-cut wedding candy box with intricate heart pattern and satin bow - Ivory
Close-up of pink laser-cut favor box with floral patterns and a white organza ribbon bow - Pink
Detailed laser-cut floral pattern on light blue gift box with a white organza ribbon bow - Pearl Pale Blue
+6
Laser Cut Wedding Favor Boxes Hollow Heart Design Pearlescent Paper Candy Box With Ribbon For Wedding Party Souvenirs Gift Wrap
$0.16
Mix MOQ : 50
Laser Cut Hollow Heart Thank You Wedding Favor Box With Ribbon Elegant Cardstock Candy Gift Case For Party Celebration Banquet
Laser Cut Hollow Heart Thank You Wedding Favor Box With Ribbon Elegant Cardstock Candy Gift Case For Party Celebration Banquet
like
Find Similar
Laser-cut white heart gift box with Thank You text and ribbon for wedding favors - White
Detail of laser cut lace heart gift box with thank you text and white ribbon bow - Ivory
Pink laser cut heart lace thank you gift box with white organza ribbon for weddings - Pink
Golden laser-cut heart favor box with thank you text and sheer ribbon for weddings - Gold
+7
Laser Cut Hollow Heart Thank You Wedding Favor Box With Ribbon Elegant Cardstock Candy Gift Case For Party Celebration Banquet
$0.13
No MOQ
Pyramid Butterfly Hollow Candy Box Laser Cut Pearlescent Paper Wedding Favor Boxes With Ribbons For Chocolate Gift Packaging
Pyramid Butterfly Hollow Candy Box Laser Cut Pearlescent Paper Wedding Favor Boxes With Ribbons For Chocolate Gift Packaging
like
Find Similar
Elegant white pyramid candy box with butterfly laser-cut hollow design and silk ribbon - White
Pink pyramid candy box with butterfly laser-cut design and pink chiffon ribbon tie - Pink
Elegant gold pyramid candy box with hollow butterfly design and ribbon bow detail - Gold
Red pyramid wedding favor box with laser-cut butterfly design and matching silk ribbon - Pearlescent Red
+5
NewPyramid Butterfly Hollow Candy Box Laser Cut Pearlescent Paper Wedding Favor Boxes With Ribbons For Chocolate Gift Packaging
$0.14
Mix MOQ : 50
European Romantic Rose Laser Cut Pearl Paper Candy Boxes Elegant Ribbon Bow Wedding Party Gift Boxes Valentine Favor Holders
European Romantic Rose Laser Cut Pearl Paper Candy Boxes Elegant Ribbon Bow Wedding Party Gift Boxes Valentine Favor Holders
like
Find Similar
White laser-cut rose wedding favor box with a delicate organza ribbon bow on wood - White
Elegant white laser-cut rose hollow wedding favor box with a delicate white silk ribbon - Ivory
Laser cut rose gold wedding favor box with floral patterns and a white ribbon bow - Reflective Rose Gold
Burgundy laser-cut rose candy box with shimmering pearl paper and organza ribbon - Dark Red
+5
European Romantic Rose Laser Cut Pearl Paper Candy Boxes Elegant Ribbon Bow Wedding Party Gift Boxes Valentine Favor Holders
$0.13
Mix MOQ : 50
Laser Cut Hollow Paper Candy Boxes With Ribbon Elegant European Style Wedding Party Gift Packaging Chocolate Treat Favor Boxes
Laser Cut Hollow Paper Candy Boxes With Ribbon Elegant European Style Wedding Party Gift Packaging Chocolate Treat Favor Boxes
like
Find Similar
White laser-cut hollow gift box for wedding favors with a white organza ribbon bow - White
Detailed view of silver laser-cut candy box with blue ribbon bow and jewel accent - Reflective Silver
Detailed laser-cut pink gift box with satin ribbon and geometric patterns on pearlescent paper - Pink
Detail of laser-cut gold wedding favor box with circular patterns and sheer ribbon bow - Gold
+5
Laser Cut Hollow Paper Candy Boxes With Ribbon Elegant European Style Wedding Party Gift Packaging Chocolate Treat Favor Boxes
$0.12
Mix MOQ : 50
It's A Girl Laser Cut Baby Shower Favor Box With Ribbon Heart Stroller Pattern Pearlescent Paper Candy Packaging For Newborn Party
It's A Girl Laser Cut Baby Shower Favor Box With Ribbon Heart Stroller Pattern Pearlescent Paper Candy Packaging For Newborn Party
like
Find Similar
White laser-cut baby shower candy box with It's A Girl text and ribbon bow - White
Pink laser-cut baby shower candy box with It's A Girl text and organza ribbon - Pink
Golden laser-cut baby shower candy box with It's A Girl text and stroller pattern - Gold
Purple laser-cut baby shower candy box with It's A Girl text and ribbon bow - Dark Purple
+5
It's A Girl Laser Cut Baby Shower Favor Box With Ribbon Heart Stroller Pattern Pearlescent Paper Candy Packaging For Newborn Party
$0.13
Mix MOQ : 50
Laser Cut Rose Candy Box With Ribbon For Valentine's Day Wedding Party Favors Hollow Pearlescent Paper Gift Boxes Packaging
Laser Cut Rose Candy Box With Ribbon For Valentine's Day Wedding Party Favors Hollow Pearlescent Paper Gift Boxes Packaging
like
Find Similar
Elegant white laser-cut rose wedding favor box with a matching white organza ribbon bow - White
Detailed laser-cut rose patterns on white wedding favor box with a silk ribbon bow - Ivory
Pink laser-cut rose hollow candy box with ribbon for weddings and Valentine parties - Pink
Light blue laser-cut rose candy box with ribbon for wedding and Valentine gift packaging - Tiffany Blue
+5
Laser Cut Rose Candy Box With Ribbon For Valentine's Day Wedding Party Favors Hollow Pearlescent Paper Gift Boxes Packaging
$0.13
Mix MOQ : 50
Laser Cut Paper Candy Box With Ribbon Bow Hollow Floral Design LOVE YOU Wedding Favor Valentine's Day Gift Packaging Box
Laser Cut Paper Candy Box With Ribbon Bow Hollow Floral Design LOVE YOU Wedding Favor Valentine's Day Gift Packaging Box
like
Find Similar
White laser-cut Love You wedding favor box with floral patterns and a ribbon tie - White
Pink laser-cut Love You wedding favor box with floral patterns and organza ribbon bow - Pink
Detailed view of a gold hollow-out wedding candy box with Love You engraving and ribbon - Gold
Elegant purple laser cut candy gift box with Love You text and violet ribbon bow - Dark Purple
+4
Laser Cut Paper Candy Box With Ribbon Bow Hollow Floral Design LOVE YOU Wedding Favor Valentine's Day Gift Packaging Box
$0.13
Mix MOQ : 50
Elegant Laser Cut Leaf Pattern Candy Boxes Pearlescent Paper Gift Boxes With Ribbons For Wedding Party Celebration Favors
Elegant Laser Cut Leaf Pattern Candy Boxes Pearlescent Paper Gift Boxes With Ribbons For Wedding Party Celebration Favors
like
Find Similar
Elegant red laser-cut leaf pattern gift box featuring a matching red silk ribbon bow - Pearlescent Red
Light blue laser-cut leaf pattern candy box with a matching ribbon bow for party favors - Tiffany Blue
Elegant white laser-cut leaf pattern candy box with a delicate organza ribbon bow - White
Pink laser-cut leaf pattern candy gift box with a soft silk ribbon bow for parties - Pink
+4
Elegant Laser Cut Leaf Pattern Candy Boxes Pearlescent Paper Gift Boxes With Ribbons For Wedding Party Celebration Favors
$0.13
Mix MOQ : 50
Laser Cut Cross Hollow Out Candy Box Pearl Paper Chocolate Gift Box Wedding Baptism Communion Party Decoration Favor Box
Laser Cut Cross Hollow Out Candy Box Pearl Paper Chocolate Gift Box Wedding Baptism Communion Party Decoration Favor Box
like
Find Similar
Golden laser-cut cross favor box with intricate floral hollow patterns on white plate - Reflective Gold
Laser-cut silver and gold cross favor box on a decorative plate for religious events - Reflective Silver
Elegant laser-cut white wedding favor box with gold cross design for chocolate gifts - White
Laser-cut pearl white hollow gift box with golden lining and cross pattern - Ivory
+4
Laser Cut Cross Hollow Out Candy Box Pearl Paper Chocolate Gift Box Wedding Baptism Communion Party Decoration Favor Box
$0.17
Mix MOQ : 50
Heart Shape Laser Cut Wedding Favor Candy Boxes With Ribbons Pearl Paper Hollow Out Gift Boxes Valentine Party Decorations
Heart Shape Laser Cut Wedding Favor Candy Boxes With Ribbons Pearl Paper Hollow Out Gift Boxes Valentine Party Decorations
like
Find Similar
Detail of pink laser-cut heart favor box with floral patterns and soft ribbon bow - Pink
Laser cut white heart candy box with pearl paper floral patterns and white ribbon bow - White
Laser-cut hollow heart-shaped gold mirror gift box with elegant ribbon and floral pattern - Reflective Gold
Close-up of heart-shaped laser-cut silver gift box with white satin ribbon and floral pattern - Reflective Silver
+4
Heart Shape Laser Cut Wedding Favor Candy Boxes With Ribbons Pearl Paper Hollow Out Gift Boxes Valentine Party Decorations
$0.13
Mix MOQ : 50
European Laser Cut Hollow Floral Candy Box With Ribbon Bow Elegant Wedding Favor Gift Boxes For Party Celebration
European Laser Cut Hollow Floral Candy Box With Ribbon Bow Elegant Wedding Favor Gift Boxes For Party Celebration
like
Find Similar
Elegant white laser-cut wedding favor box with floral patterns and a satin ribbon bow - White
Detail view of light blue laser-cut wedding candy box with elegant floral hollow pattern - Pearl Pale Blue
Laser-cut light blue wedding favor box with floral patterns and matching ribbon bow - Pearl Turquoise Blue
Macro view of laser-cut floral patterns on pink pearlescent wedding favor box with ribbon - Pink
+4
European Laser Cut Hollow Floral Candy Box With Ribbon Bow Elegant Wedding Favor Gift Boxes For Party Celebration
$0.13
Mix MOQ : 50
European Laser Cut Hollow Cross Candy Box With Ribbon For Wedding Baptism Christening Religious Party Favor Wrapping
European Laser Cut Hollow Cross Candy Box With Ribbon For Wedding Baptism Christening Religious Party Favor Wrapping
like
Find Similar
Laser cut white cross favor box with sheer ribbon for weddings and religious parties - White
Detail of white laser-cut wedding favor box featuring an elegant hollow cross design - Ivory
Pink laser-cut candy box with cross hollow pattern and ribbon for wedding favors - Pink
Purple hollow-out wedding candy box with laser-cut cross design and satin ribbon bow - Dark Purple
+4
European Laser Cut Hollow Cross Candy Box With Ribbon For Wedding Baptism Christening Religious Party Favor Wrapping
-7%
$0.12
Mix MOQ : 50
Laser Cut Hollow Rose Wedding Favor Boxes Pearl Paper Candy Box With Ribbon And Thank You Tags For Party Gift Packaging
Laser Cut Hollow Rose Wedding Favor Boxes Pearl Paper Candy Box With Ribbon And Thank You Tags For Party Gift Packaging
like
Find Similar
Elegant white laser-cut rose gift box with white organza ribbon and Thank You tag - White
Detailed view of white laser-cut favor box with ribbon and gold Thank You tag on a plate - Ivory
Pink laser-cut rose hollow favor box with white ribbon and Thank You tag for weddings - Pink
Detail of laser-cut gold gift box with lace pattern and thank you tag on a ceramic plate - Gold
+1
Laser Cut Hollow Rose Wedding Favor Boxes Pearl Paper Candy Box With Ribbon And Thank You Tags For Party Gift Packaging
$0.14
Mix MOQ : 50
Laser Cut Wedding Candy Box Hollow Love Couple Pearlescent Paper Gift Box With Satin Ribbon For Valentine Party Favor Decor
Laser Cut Wedding Candy Box Hollow Love Couple Pearlescent Paper Gift Box With Satin Ribbon For Valentine Party Favor Decor
like
Find Similar
Elegant white laser-cut wedding favor box with Love motif and sheer ribbon bow - White
Elegant hollow paper candy box with Love motif and pink ribbon for wedding party favors - Pink
Detail view of purple laser cut wedding favor box with Love motif and ribbon bow - Dark Purple
Laser-cut light blue wedding candy box with silhouette and ribbon for party favors - Tiffany Blue
+6
Laser Cut Wedding Candy Box Hollow Love Couple Pearlescent Paper Gift Box With Satin Ribbon For Valentine Party Favor Decor
$0.13
Mix MOQ : 50
Laser Cut Flower Candy Box European Wedding Party Favor Gift Box With Ribbon Pearlescent Paper Hollow Chocolate Packaging Case
Laser Cut Flower Candy Box European Wedding Party Favor Gift Box With Ribbon Pearlescent Paper Hollow Chocolate Packaging Case
like
Find Similar
Elegant white laser-cut wedding favor box with floral patterns and a sheer ribbon bow - White
Ivory laser-cut wedding favor box with intricate floral patterns and ribbon bow - Ivory
Detailed macro view of laser-cut pink wedding favor box with a satin ribbon and floral patterns - Pink
Detail of teal laser-cut candy box featuring hollow floral patterns and a sheer ribbon bow - Tiffany Blue
+6
Laser Cut Flower Candy Box European Wedding Party Favor Gift Box With Ribbon Pearlescent Paper Hollow Chocolate Packaging Case
-7%
$0.12
Mix MOQ : 50
European Laser Cut Hollow Out Cross Candy Box Elegant Paper Favor Box With Ribbon For Wedding Party Baptism Religious Event
European Laser Cut Hollow Out Cross Candy Box Elegant Paper Favor Box With Ribbon For Wedding Party Baptism Religious Event
like
Find Similar
White laser-cut candy box with hollow floral patterns, cross design, and ribbon bow tie - White
Laser cut white cross wedding favor box with floral patterns and a chiffon ribbon tie - Ivory
Pink laser-cut hollow candy box with light pink ribbon for weddings and elegant parties - Pink
Elegant gold hollow laser cut wedding candy gift box with a sheer ribbon bow decoration - Reflective Gold
+6
European Laser Cut Hollow Out Cross Candy Box Elegant Paper Favor Box With Ribbon For Wedding Party Baptism Religious Event
-7%
$0.12
Mix MOQ : 50
Go to

More in party supplies

Explore more in favor boxes

partygoldartificialdecorativeheartstoragehandmadestorage boxtagsdecoration accessories
hollowshapesquarewindowsmalltasselwrappingflippackaging baggift wrapping

Ready to source like an insider

Get a direct line to the factory floor — no minimums, no middlemen, no guesswork.
iconReal factory pricing, no markup in betweeniconEvery order hand-inspected before it shipsicon5,000+ new products added daily
Get Inside Access