Everful

Wholesale woven patches

Factory-direct selection, vetted for quality and ready to order.

Sign Up
Woven Patches

Find the perfect pieces: handbags, shoulder bags, crossbody bags and more

filterShow Filters
Best Seller
New Arrivals
Price Drop
Free Shipping
Handmade Woven Flower Patch Accessory With Real Fur And Glass Beads For DIY Headwear Clothing Decoration Winter Jewelry Women
Handmade Woven Flower Patch Accessory With Real Fur And Glass Beads For DIY Headwear Clothing Decoration Winter Jewelry Women
like
Find Similar
Close-up of handmade plush flower accessory with pink crystal beads for DIY jewelry - Pink Flower Beige Plush
Detailed close-up of handmade plush winter flower with crystal beads and soft white faux fur - Deep Purple Flower Beige Plush
Detailed view of handmade black fur flower patch with sparkling crystal beaded center - White Flower Black Plush
Handmade Woven Flower Patch Accessory With Real Fur And Glass Beads For DIY Headwear Clothing Decoration Winter Jewelry Women
-9%
$1.24
Mix MOQ : 10
Free Shipping
Woven Webbing Luggage Tag DIY Embroidery Patch Keychain Bag Charm Decorative Strap With Metal Buckle For Travel Suitcase
Woven Webbing Luggage Tag DIY Embroidery Patch Keychain Bag Charm Decorative Strap With Metal Buckle For Travel Suitcase
like
Find Similar
Orange woven cotton luggage strap keychain with yellow button and metal end caps - 01 Orange Folded Strap
Blue woven canvas strap with 2.5cm width and 40cm length featuring a snap button - 02 Blue Folded Strap
Purple canvas keyring strap with bronze metal tips and snap button, 40cm length - 03 Purple Folded Strap
DIY red cotton canvas luggage strap with snap button and metal tips, 2.5cm width - Red Folded Strap (04)
+14
Woven Webbing Luggage Tag DIY Embroidery Patch Keychain Bag Charm Decorative Strap With Metal Buckle For Travel Suitcase
$0.20-0.58
No MOQ
 · 
27 views
Free Shipping
Embroidered Patches Colorful Cartoon VSCO Summer Style Iron On For Clothing Bags DIY Decoration Sew On Decorative Badge
Embroidered Patches Colorful Cartoon VSCO Summer Style Iron On For Clothing Bags DIY Decoration Sew On Decorative Badge
like
Find Similar
Detailed flat lay of 20 summer beach theme iron-on embroidery patches with a mini sewing kit - Style 1 VSCO Patches Set 20Pcs
Cartoon embroidered patch featuring No Bad Vibes text with dimensions 6.7x6.3cm - Style 2 NO BAD VIBES Letter Patch
Detailed view of positive energy embroidered patch with 7.6cm width and 4.1cm height - Style 3 Positive Energy Letter Patch
Detail showing Hawaii sunrise license plate embroidery patch with 7.1x4cm size specs - Style 4 Hawaii Sunrise Rainbow Plate Patch
+17
Embroidered Patches Colorful Cartoon VSCO Summer Style Iron On For Clothing Bags DIY Decoration Sew On Decorative Badge
$0.16-5.00
No MOQ
 · 
706 sold recently
Top 3% Best Sellers
in Arts, Crafts & Sewing
Free Shipping
Western Cowgirl Embroidery Patches Pink Cowboy Boots Hat Cactus Iron On Applique For Clothing DIY Retro Style Embroidered Decor
Western Cowgirl Embroidery Patches Pink Cowboy Boots Hat Cactus Iron On Applique For Clothing DIY Retro Style Embroidered Decor
like
Find Similar
Coastal Cowgirl square embroidered patch with surfboard design 8cm x 8cm for DIY clothing - Coastal Cowgirl Surfboard Style (PE15428CT) / 8x8cm
Pink Howdy Darlin' embroidered patch with mint green border for denim jackets - Howdy Darlin Pink Letter Style (PE15458CT) / 8.7x5cm
Pink Cupid Cowgirl embroidered patch with heart and cowboy hat design for DIY clothing - Cupid Find Me A Cowboy Pink Style (PE15459CT) / 8x6.3cm
Pink cowgirl embroidery patch with Long Live Cowgirls text, size 7.5cm x 7.5cm - Long Live Cowgirls Square Pink Style (PE15461CT) / 7.5x7.5cm
+15
Western Cowgirl Embroidery Patches Pink Cowboy Boots Hat Cactus Iron On Applique For Clothing DIY Retro Style Embroidered Decor
$0.23-1.07
Mix MOQ : 10
 · 
134 sold recently
Top 10% Best Sellers
in Arts, Crafts & Sewing
Free Shipping
Cartoon Food Embroidery Patches Candy Popcorn Pizza Iron On Appliques For Clothes DIY Bags Hats Jackets Sweet Applique
Cartoon Food Embroidery Patches Candy Popcorn Pizza Iron On Appliques For Clothes DIY Bags Hats Jackets Sweet Applique
like
Find Similar
Cartoon food embroidery patch set with colorful pizza, popcorn, and candy designs - Complete Food Collection
Pink lollipop embroidered patch with white border, size 5.2x3cm for DIY clothing repair - Pink Lollipop (11682-A)
Popcorn patch embroidery with red stripes, diy garment decoration, 4.1x6.1cm size detail - Red and White Popcorn Bucket (11668)
Embroidered pizza patch for DIY clothing with 5.6cm by 3.4cm size specifications - Pepperoni Pizza (11675)
+20
Cartoon Food Embroidery Patches Candy Popcorn Pizza Iron On Appliques For Clothes DIY Bags Hats Jackets Sweet Applique
$0.09-3.58
Mix MOQ : 10
 · 
163 sold recently
Free Shipping
Colorful Embroidery Patches Iron On Sew On Appliques For Clothing Decoration Cartoon Wave Rainbow Decorative Motifs
Colorful Embroidery Patches Iron On Sew On Appliques For Clothing Decoration Cartoon Wave Rainbow Decorative Motifs
like
Find Similar
Daisy embroidery patch double-sided adhesive sheets CROWN #513L size 10x20cm - One Sheet Strong Adhesive 20*10CM
16-piece retro hippie embroidery patch set with colorful rainbow and flower designs - 16Pcs Set-B
Close-up of French Bulldog embroidery patch showing precise dimensions and stitching details - No.1 French Bulldog (X10HL-07-01)
Detailed size chart for the embroidered bicycle flower basket patch showing 6x6.5cm dimensions - No.3 Bicycle (X10HL-086-03)
+17
Colorful Embroidery Patches Iron On Sew On Appliques For Clothing Decoration Cartoon Wave Rainbow Decorative Motifs
$0.20-4.88
No MOQ
 · 
1K+ sold recently
Top 1% Best Sellers
in Arts, Crafts & Sewing
Free Shipping
Vintage Cassette Tape Embroidered Patches Colorful Music Theme Iron On Sew On Decorative Appliques For DIY Clothing
Vintage Cassette Tape Embroidered Patches Colorful Music Theme Iron On Sew On Decorative Appliques For DIY Clothing
like
Find Similar
Retro cassette embroidery patch with mountain scene on blue denim background - FINE BRAVE Mountain Cassette (E3L-B-1-8 Heat Melt)
Retro cassette embroidery patch with Rock Heart text for clothes, 4.5cm x 7cm size - ROCK-HEART Rocking Heart (E3L-B-1-10 Heat Melt)
Retro blue cassette tape embroidery patch with Good Lucky rainbow text for DIY clothing - GOOD LUCKY Style (E3L-B-2-7 Heat Melt)
Pink retro cassette hip hop embroidery patch, DIY iron-on badge for denim 7x4.5cm - HIP HOP Style (E3L-B-2-8 Heat Melt)
+4
Vintage Cassette Tape Embroidered Patches Colorful Music Theme Iron On Sew On Decorative Appliques For DIY Clothing
$0.25-2.86
No MOQ
 · 
95 sold recently
Top 10% Best Sellers
in Arts, Crafts & Sewing
Free Shipping
Cartoon Letter Slogan Embroidery Patch Humorous Sarcastic Badges DIY Iron-on Sew-on For Clothes Bags Hats Jackets Accessory
Cartoon Letter Slogan Embroidery Patch Humorous Sarcastic Badges DIY Iron-on Sew-on For Clothes Bags Hats Jackets Accessory
like
Find Similar
Embroidered floral patch with Kind Over Cool slogan and dimensions for clothing repair - Pink Kind Over Cool Style (PE10749CT)
Embroidered mountain patch with colorful landscape and trees, size 7.5cm x 4.5cm - Goggles Mountain Landscape Style (PE10781CT)
Detailed view of square cartoon coffee patch with COFFEE ME embroidery and dimensions - Sunglasses Coffee Cup Character Style (PE11417CT)
Embroidered 'Just a GIRL who LOVES Dance' patch with size guide 9x7cm for clothing decor - Oval Dance Text Style (PE11420CT)
+15
Cartoon Letter Slogan Embroidery Patch Humorous Sarcastic Badges DIY Iron-on Sew-on For Clothes Bags Hats Jackets Accessory
$0.20-0.72
Mix MOQ : 10
 · 
230 sold recently
Free Shipping
Western Cowboy Embroidered Patches Retro Graffiti Letter Travel Scenery Fabric Iron On Sew On Decorative Apparel Accessories
Western Cowboy Embroidered Patches Retro Graffiti Letter Travel Scenery Fabric Iron On Sew On Decorative Apparel Accessories
like
Find Similar
Detailed view of spicy marg QUEEN embroidered patch with precise size measurements - Style 1# spicy marg QUEEN
Pink Day Drinking embroidered patch with precise 7.9x4.5cm dimension measurements - Style 2# Day Drinking
Detail of embroidered patch showing 7.8cm size dimensions and western cowboy lyrics text - Style 3# MAMAS DON'T LET YOUR BABIES
Pink and red Howdy embroidered patch with gradient sunset letters and size measurements - Style 4# HOWDY HOWDY HOWDY
+47
Western Cowboy Embroidered Patches Retro Graffiti Letter Travel Scenery Fabric Iron On Sew On Decorative Apparel Accessories
$0.17-15.22
No MOQ
 · 
1K+ sold recently
Top 1% Best Sellers
in Arts, Crafts & Sewing
Free Shipping
Western Cowboy Embroidered Patches Fabric Iron On Sew On Appliques For Clothes DIY Decoration Repair Retro Style
Western Cowboy Embroidered Patches Fabric Iron On Sew On Appliques For Clothes DIY Decoration Repair Retro Style
like
Find Similar
Mint green MAMA embroidery patch, 9.5cm square iron-on Western cowboy style applique - No.1 (MAMA Mint Green)
Square Cowgirl Social Club embroidery patch with wild spirits theme 7.5cm size - No.2 (Cowgirl Social Club)
Detailed view of pink cowboy boot embroidered patch with 8x7cm size ruler indicators - No.3 (Sunflower Cowboy Boots)
Adhesive sheets for strawberry alphabet patches, application guide 20cm x 10cm - Strong Adhesive Sheet
+16
Western Cowboy Embroidered Patches Fabric Iron On Sew On Appliques For Clothes DIY Decoration Repair Retro Style
$0.17-7.01
No MOQ
 · 
877 sold recently
Top 3% Best Sellers
in Arts, Crafts & Sewing
Free Shipping
Embroidered Cartoon Animal Patches For Clothing DIY Outdoor Adventure Landscape Iron On Patch For Bags Hats Decorative Accessories
Embroidered Cartoon Animal Patches For Clothing DIY Outdoor Adventure Landscape Iron On Patch For Bags Hats Decorative Accessories
like
Find Similar
Square motivational patch with 'HUMBLE BUT I'M STILL that girl' text and pink stars - Humble Girl Slogan Style (PE15427CT)
Embroidered Mexican patch with cactus, guitar and cocktail, 7.5cm x 5.7cm iron-on badge - Mexico Elements Style (PE15473CT)
Embroidered iced coffee patch with text COFFEE IS THE WD-40 OF ADULTHOOD 8.3cm - Coffee Slogan Style (PE15477CT)
Pink Play Ball baseball embroidery patch with 8cm checkered design for DIY clothing - Baseball Sports Style (PE15480CT)
+11
Embroidered Cartoon Animal Patches For Clothing DIY Outdoor Adventure Landscape Iron On Patch For Bags Hats Decorative Accessories
$0.36-0.98
Mix MOQ : 10
 · 
35 sold recently
Chenille Embroidery Letter Patches Gold Glitter Border Iron On Self Adhesive For Clothing Bag Hat DIY Crafts
Chenille Embroidery Letter Patches Gold Glitter Border Iron On Self Adhesive For Clothing Bag Hat DIY Crafts
like
Find Similar
Golden chenille iron-on patches with A-Z letters and emoji shapes on white background - 49 Styles Combo * Letters Iron-on
Set of 26 white chenille letter patches A-Z with gold glitter border 5.5cm tall - 5.5cm White Chenille Alphabet Set 26pcs
Pink chenille 26 alphabet patches with gold glitter borders at 5.5cm height - 5.5cm Pink Chenille Alphabet Set 26pcs
5.5cm black chenille letter patches with gold glitter border A-Z embroidery set - 5.5cm Black Chenille Alphabet Set 26pcs
+31
Chenille Embroidery Letter Patches Gold Glitter Border Iron On Self Adhesive For Clothing Bag Hat DIY Crafts
$0.29-14.27
No MOQ
 · 
202 sold recently
Top 1% Best Sellers
in Arts, Crafts & Sewing
Free Shipping
Sequin Heart Star Patches Embroidered Appliques Iron On Sew On For DIY Clothing Bags Hats Decoration Shiny Laser Colorful
Sequin Heart Star Patches Embroidered Appliques Iron On Sew On For DIY Clothing Bags Hats Decoration Shiny Laser Colorful
like
Find Similar
Silver and black sequin star patch for DIY clothing decoration in two sizes - Silver Star*Large Size #37
Pink star-shaped sequin embroidered patch for DIY apparel and clothing decoration - Pink Star*Large Size #39
Purple sequin star embroidery patches in small and large sizes for DIY clothing - Purple Star*Large Size #41
Red sequin star patch for clothing DIY, available in two sizes with embroidery detail - Red Star*Large Size #43
+110
Sequin Heart Star Patches Embroidered Appliques Iron On Sew On For DIY Clothing Bags Hats Decoration Shiny Laser Colorful
-5%
$0.14-8.71
Mix MOQ : 10
 · 
556 sold recently
Top 3% Best Sellers
in Arts, Crafts & Sewing
Free Shipping
Cartoon Embroidery Patches For Clothing DIY Iron On Patch Cute Decorative Appliques Polyester Fabric For Shoes Hats Bags
Cartoon Embroidery Patches For Clothing DIY Iron On Patch Cute Decorative Appliques Polyester Fabric For Shoes Hats Bags
like
Find Similar
Pink flip-flop embroidery patch for shoes and hats with silver star detail, 4.5x4.0cm size - Pink Flip Flops (8)
Blue flip-flop cartoon embroidery patch with orange starfish, size 4.5x4.0cm, style 9 - Blue Starfish Flip Flops (9)
Pink flip-flop embroidery patch with yellow dots and daisy detail, size 6.0 x 2.5 cm - Pink Daisy Flip Flops (11)
Lollipop embroidered patch in red and purple with size dimensions 12.0cm x 6.7cm - Red Lollipop (6)
+15
Cartoon Embroidery Patches For Clothing DIY Iron On Patch Cute Decorative Appliques Polyester Fabric For Shoes Hats Bags
-6%
$0.14-0.19
No MOQ
 · 
82 sold recently
Comic Style Embroidered Patches Pop Art Iron On Appliques For Clothing DIY Decoration Badges WOW POW OMG Letter Patches
Comic Style Embroidered Patches Pop Art Iron On Appliques For Clothing DIY Decoration Badges WOW POW OMG Letter Patches
like
Find Similar
Comic style POW and WOW embroidered iron-on patches for DIY clothing decoration - Complete Collection 22 Pieces
Comic Style Embroidered Patches Pop Art Iron On Appliques For Clothing DIY Decoration Badges WOW POW OMG Letter Patches
-4%
$3.81
No MOQ
 · 
10 sold recently
Free Shipping
Blue White Embroidered Patches For Clothing Inspirational English Slogans Iron On Sew On Daisy Butterfly Heart DIY Decor
Blue White Embroidered Patches For Clothing Inspirational English Slogans Iron On Sew On Daisy Butterfly Heart DIY Decor
like
Find Similar
Blue 'Trust Your Visions' embroidery patch with stars and butterfly motif, 6.9x5cm size - Positive Energy English Cloth Patch #1
Blue heart embroidery patch with YOU CAN DO BIG THINGS text and size measurements - Positive Energy English Cloth Patch #2
Embroidered daisy patch with Dream Big text and blue background for clothes and bags - Inspirational Slogan 3#-DREAM BIG NEVER GIVE UP
Inspirational embroidered patch Find The Good In Every Day blue cloud badge 7x5cm - Positive Energy English Cloth Patch #4
+12
Blue White Embroidered Patches For Clothing Inspirational English Slogans Iron On Sew On Daisy Butterfly Heart DIY Decor
$0.22-4.41
No MOQ
 · 
65 sold recently
Free Shipping
Cartoon Animal Food Embroidered Patches For Clothing Decoration Polyester Iron On Sew On DIY Applique Patches For Bags Jackets
Cartoon Animal Food Embroidered Patches For Clothing Decoration Polyester Iron On Sew On DIY Applique Patches For Bags Jackets
like
Find Similar
Embroidered fish patch in light blue silk thread, measuring 2.2 cm by 1.0 cm for DIY crafts - Blue Fish Style (1*)
Embroidered yellow wine bottle patch variant measuring 4.4 cm by 1.8 cm on white background - Yellow Bottle Style (2*)
Cat head embroidery patch in yellow and blue colors with size 2.8x2.4 cm - Blue Yellow Cat Head Style (3*)
Cartoon black cat head embroidered self-adhesive patch, size 2.1x2.4 cm, for clothing repair - Black Cat Head Style (4*)
+11
Cartoon Animal Food Embroidered Patches For Clothing Decoration Polyester Iron On Sew On DIY Applique Patches For Bags Jackets
-6%
$0.15
No MOQ
 · 
453 sold recently
Chenille Alphabet Letter Patches Glitter Embroidered Iron On Numbers For DIY Clothing Bags Hats Varsity Style
Chenille Alphabet Letter Patches Glitter Embroidered Iron On Numbers For DIY Clothing Bags Hats Varsity Style
like
Find Similar
Set of 26 white chenille letter patches with gold glitter borders 5.5cm tall - 5.5cm/White/Adhesive/Set of 26 Letters
Pink chenille letter patches with gold sequin borders for DIY clothing, 5.5cm height - 5.5cm/Pink/Adhesive/Set of 26 Letters
Set of 26 light blue chenille letter patches with gold glitter border, 5.5cm height - 5.5cm/Blue/Adhesive/Set of 26 Letters
Pink chenille embroidery A-Z letter patches with gold sequins and 5.5cm height - 5.5cm/Rose Red/Adhesive/Set of 26 Letters
+40
Chenille Alphabet Letter Patches Glitter Embroidered Iron On Numbers For DIY Clothing Bags Hats Varsity Style
$0.35-7.49
No MOQ
 · 
74 sold recently
Free Shipping
Punk Rock Flame Skull Embroidered Patch For Clothing DIY Iron On Applique Decorative Slogan Repair Embroidery Badge For Jackets
Punk Rock Flame Skull Embroidered Patch For Clothing DIY Iron On Applique Decorative Slogan Repair Embroidery Badge For Jackets
like
Find Similar
Detailed close-up of a red flame embroidery patch with white and yellow stitching detail - Flame Pattern (PE1806CT)
6.1x6.1cm red embroidered Empowered Women Feminist patch for DIY clothing and hats - Empowered Women Slogan (PE5519CT)
Punk skeleton hand holding purple heart broken embroidery patch 5.5x7.8cm for jackets - Broken Heart with Skeleton Hand (PE6787CT)
Hello speech bubble embroidery patch in black and white finish for DIY jackets, 5.3x3.8cm - Hello Speech Bubble (PE6802CT)
+8
Punk Rock Flame Skull Embroidered Patch For Clothing DIY Iron On Applique Decorative Slogan Repair Embroidery Badge For Jackets
-7%
$0.12-1.37
Mix MOQ : 10
 · 
132 sold recently
Free Shipping
Cartoon Cartoon Embroidered Patches For Clothing DIY Heart Animal Flower Applique Polyester Embroidery Sewing Supplies Patch
Cartoon Cartoon Embroidered Patches For Clothing DIY Heart Animal Flower Applique Polyester Embroidery Sewing Supplies Patch
like
Find Similar
Self-adhesive rose red heart patch with HUGS embroidery and premium stitched borders - Rose Red Heart-HUGS
Round floral embroidery patch with pink flowers and silver thread on white felt - Round Flower
Creative milk carton embroidery patch with blue thread and cow motif on white background - Blue Milk Box
Classic red heart embroidered patch with white LOVE text for clothing decoration - Red Heart-LOVE
+37
Cartoon Cartoon Embroidered Patches For Clothing DIY Heart Animal Flower Applique Polyester Embroidery Sewing Supplies Patch
-9%
$0.10-0.22
No MOQ
 · 
320 sold recently
Creative Cartoon Letter Embroidery Patch Funny Motivational Slogan Iron On Patches For Clothing Jacket Backpack DIY Decorative Applique
Creative Cartoon Letter Embroidery Patch Funny Motivational Slogan Iron On Patches For Clothing Jacket Backpack DIY Decorative Applique
like
Find Similar
Embroidered stickman patch with pink brain and 'HEY, YOU DROPPED THIS' text, 6.5x6cm size - You Dropped This Brain Style (PE10230CT)
7.5cm round orange embroidered patch featuring mushroom cloud and THE FUTURE IS BRIGHT - Bright Future Round Style (PE11962CT)
Macro detail of pink rectangular embroidery patch with white slogan and wavy edges - Pink Boys Do It Style (PE12380CT)
Cartoon embroidery patch with Bit Of A Mess But Doing My Best quote, 6.8cm x 6.5cm - Doing My Best Slogan Style (PE12385CT)
+13
Creative Cartoon Letter Embroidery Patch Funny Motivational Slogan Iron On Patches For Clothing Jacket Backpack DIY Decorative Applique
$0.29-0.72
Mix MOQ : 10
 · 
89 sold recently
Free Shipping
Cartoon Animal Flower Embroidery Patches DIY Clothing Accessories Polyester Sew On Iron On Embroidered Decorative Repair Patches
Cartoon Animal Flower Embroidery Patches DIY Clothing Accessories Polyester Sew On Iron On Embroidered Decorative Repair Patches
like
Find Similar
Cute blue rabbit embroidered patch variant 8 for DIY clothing, 5.8 CM height - Blue Rabbit (8)
Pink flamingo sequin embroidery patch for DIY clothing, size 7.1 cm by 4.3 cm - Flamingo (9)
Cartoon green dinosaur embroidery patch with size details for DIY clothing decor - Green Dinosaur (11)
Pink heart embroidered patch with yellow stitched border for DIY clothing 3.0x2.5cm - Pink Yellow Heart (6)
+34
Cartoon Animal Flower Embroidery Patches DIY Clothing Accessories Polyester Sew On Iron On Embroidered Decorative Repair Patches
-8%
$0.11-0.38
No MOQ
 · 
20 views
Free Shipping
Western Cowboy Embroidery Patches Iron On Sew On Decorative Fabric Applique For Clothing Jackets Backpacks Cactus Cow Skull
Western Cowboy Embroidery Patches Iron On Sew On Decorative Fabric Applique For Clothing Jackets Backpacks Cactus Cow Skull
like
Find Similar
Detailed view of western cowboy bull rider embroidery patch with size 7cm x 6cm dimensions - Cowboy Riding Bull
Detail of red cactus shield embroidered patch with dimensions 6cm by 6.5cm on white base - Red Shield Badge
Detailed dimensions of heart-shaped cow print embroidery patch for cowboy boots - Heart Cow Print
Detail view of cowboy on horse embroidery patch with precise 6cm size and 1.6g weight metrics - Cowboy Riding Horse
+18
Western Cowboy Embroidery Patches Iron On Sew On Decorative Fabric Applique For Clothing Jackets Backpacks Cactus Cow Skull
$0.23-7.78
No MOQ
 · 
828 sold recently
Top 3% Best Sellers
in Arts, Crafts & Sewing
Free Shipping
Cartoon Embroidered Patches Self Adhesive Iron On Patches For Clothing DIY Decoration Multi Shapes
Cartoon Embroidered Patches Self Adhesive Iron On Patches For Clothing DIY Decoration Multi Shapes
like
Find Similar
Pink seashell embroidery patch with blue stripes and size markers of 4.4 x 2.0 cm - Pink Conch
Pink and blue embroidered angel wings patch with size labels of 5.8cm by 1.5cm - Angel Wing
Blue palm tree embroidered patch variant 15 measuring 3.3x2.4 cm for clothes - Lake Blue Palm Tree
Tropical coconut tree embroidered patch style 16 in green, size 4.2 cm by 2.2 cm - Green Palm Tree
+15
Cartoon Embroidered Patches Self Adhesive Iron On Patches For Clothing DIY Decoration Multi Shapes
-7%
$0.09-0.42
No MOQ
 · 
745 sold recently
Top 10% Best Sellers
in Arts, Crafts & Sewing
Free Shipping
Embroidered Patch Iron On Applique Decorative Mushroom Butterfly Sun Heart Landscape For Jacket Bag Clothing Accessory
Embroidered Patch Iron On Applique Decorative Mushroom Butterfly Sun Heart Landscape For Jacket Bag Clothing Accessory
like
Find Similar
Tropical beach sunset embroidered patch with palm trees and rainbow design, 7.5cm diameter - Beach Sunset Style (PE9641CT)
Detail of embroidered patch showing colorful butterflies and Embrace Change text - Embrace Change Butterfly Style (PE9646CT)
Pink crystal ball embroidery patch with funny slogan for clothing 8.1x7cm size - Crystal Ball Slogan Style (PE9650CT)
Detail of round flower patch with Survive Out Of Spite text and 7cm diameter mark - Survive Flower Style (PE9674CT)
+2
Embroidered Patch Iron On Applique Decorative Mushroom Butterfly Sun Heart Landscape For Jacket Bag Clothing Accessory
-5%
$0.34-0.96
No MOQ
 · 
10 sold recently
Free Shipping
Western Cowboy Embroidery Patches For Clothing Polyester Fabric Iron On Decorative Appliques Jackets Hats DIY Crafting
Western Cowboy Embroidery Patches For Clothing Polyester Fabric Iron On Decorative Appliques Jackets Hats DIY Crafting
like
Find Similar
Daisy embroidery patch double-sided adhesive sheets CROWN #513L size 10x20cm - One Sheet Strong Adhesive 20*10CM
Detail view of 26-piece brown western cowboy embroidery patches with cactus and horse - Set of 26 Pieces Style A
Detail showing 26PCS brown western cowboy embroidery patches with boots and hats - Set of 26 Pieces Style B
Detail of 6.5x5.3cm western cowboy sunset embroidery patch with size annotations - No.1 Cowboy Horse Silhouette
+49
Western Cowboy Embroidery Patches For Clothing Polyester Fabric Iron On Decorative Appliques Jackets Hats DIY Crafting
$0.16-7.54
No MOQ
 · 
1K+ sold recently
Top 1% Best Sellers
in Arts, Crafts & Sewing
Free Shipping
Chenille Patches Heart Star Shape Embroidered Applique Iron On Self Adhesive For Clothing DIY Decoration Multi Color
Chenille Patches Heart Star Shape Embroidered Applique Iron On Self Adhesive For Clothing DIY Decoration Multi Color
like
Find Similar
Colorful chenille heart and star iron-on patches for DIY clothing decoration - Heart and Star Patch Set (Self-adhesive)
Purple heart-shaped chenille embroidery patch with fine white stitching for DIY apparel - Purple Heart (Iron-on)
Beige chenille heart patch with soft plush texture for DIY clothing embroidery decor - Cream White Heart (Iron-on)
Pink heart-shaped chenille embroidery patch with white border, 2.7x2.6cm size - Pink Heart (Iron-on)
+42
Chenille Patches Heart Star Shape Embroidered Applique Iron On Self Adhesive For Clothing DIY Decoration Multi Color
$0.09-2.75
No MOQ
 · 
476 sold recently
Top 10% Best Sellers
in Arts, Crafts & Sewing
Free Shipping
Pink Cartoon Inspirational Slogan Embroidery Patches Iron On Badges For Clothing Bag Hat DIY Decoration Flower Hearts Applique
Pink Cartoon Inspirational Slogan Embroidery Patches Iron On Badges For Clothing Bag Hat DIY Decoration Flower Hearts Applique
like
Find Similar
Pink embroidery patch with motivational stars quote and golden border on white background - Starry Quote Style (PE15404CT)
Pink FAITH Can Move Mountains embroidered patch with colorful mountain sunrise design - Mountain Faith Style (PE15407CT)
Embroidered yellow school bus patch with Hop In Bestie text for DIY bags - School Bus Bestie Style (PE15426CT)
Square White SUV Mom Social Club embroidered patch with pink bow and laurel leaves - White SUV Mom Style (PE15430CT)
+21
Pink Cartoon Inspirational Slogan Embroidery Patches Iron On Badges For Clothing Bag Hat DIY Decoration Flower Hearts Applique
$0.23-0.86
Mix MOQ : 10
 · 
183 sold recently
Free Shipping
Embroidered Book Patches Iron On Aesthetic Fabric Appliques For Clothing Jackets Book Lovers Pink Red Heart Bookworm DIY
Embroidered Book Patches Iron On Aesthetic Fabric Appliques For Clothing Jackets Book Lovers Pink Red Heart Bookworm DIY
like
Find Similar
Detailed view of pink heart embroidered Book Lover patch with precise dimensions - Style 1 (Book Lover)
Embroidered book patch with pink and red details, size 4.7cm x 6.1cm, for clothing decor - Style 2 (Stacked Books)
Detail view of heart embroidered book patch with pink center and size measurements - Style 3 (Books Heart)
Detailed size chart for Stay Bookish pink embroidered patch with 3x6.5cm dimensions - Style 4 (Stay Bookish)
+5
Embroidered Book Patches Iron On Aesthetic Fabric Appliques For Clothing Jackets Book Lovers Pink Red Heart Bookworm DIY
$0.23-2.59
No MOQ
 · 
702 sold recently
Top 3% Best Sellers
in Arts, Crafts & Sewing
Free Shipping
Pink Embroidered Patches For DIY Clothing Jackets Bags Cute Girl Power Hearts Stars Iron On Fabric Applique
Pink Embroidered Patches For DIY Clothing Jackets Bags Cute Girl Power Hearts Stars Iron On Fabric Applique
like
Find Similar
Daisy embroidery patch double-sided adhesive sheets CROWN #513L size 10x20cm - Strong Adhesive Sheet (One Sheet 20x10cm)
Detailed view of pink checkered heart embroidery patch with 5.5cm size dimensions - No.1-Plaid Heart
Pink checkered star embroidery patch measuring 5.5cm for jackets and bags decoration - No.2-Plaid Star
Macro detail of butterfly embroidery patch showing 8cm x 5cm size measurements - No.5-Pink Black Butterfly
+41
Pink Embroidered Patches For DIY Clothing Jackets Bags Cute Girl Power Hearts Stars Iron On Fabric Applique
$0.12-9.40
No MOQ
 · 
647 sold recently
Top 3% Best Sellers
in Arts, Crafts & Sewing
Free Shipping
Bohemian Cartoon Embroidered Patches Polyester Flower Rainbow Butterfly Iron On Sew On Patches For Clothing DIY Decoration
Bohemian Cartoon Embroidered Patches Polyester Flower Rainbow Butterfly Iron On Sew On Patches For Clothing DIY Decoration
like
Find Similar
Rainbow Groovy flower embroidery patch, colorful iron-on badge for clothes, 6.9x6.2cm - Bohemian Style 1#
Bohemian embroidered roller skate patch with rainbow stripes and hearts for clothing - Bohemian Style 2#
Bohemian floral embroidery patch in orange and purple tones, measuring 7cm and weighing 2.6g - Bohemian Style 3#
Bohemian round embroidered patch with retro colorful waves and small daisy floral design - Bohemian Style 4#
+12
Bohemian Cartoon Embroidered Patches Polyester Flower Rainbow Butterfly Iron On Sew On Patches For Clothing DIY Decoration
$0.14-4.16
No MOQ
 · 
10 views
Free Shipping
Embroidered Alphabet Letter Patches Iron On Heat Seal Polyester Fabric For DIY Clothing Jacket Backpack Decor Varsity Style
Embroidered Alphabet Letter Patches Iron On Heat Seal Polyester Fabric For DIY Clothing Jacket Backpack Decor Varsity Style
like
Find Similar
Full set of 26 colorful 3D alphabet embroidery patches with black twill borders A-Z - Multi-color Alphabet*Set of 26 Letters
Set of 26 colorful A-Z alphabet embroidery patches with heat adhesive backing - Multi-color Letters*Set of 26 Letters
Silver glitter letter patches A-Z with black border and red heart embroidery - Sequin Alphabet*Set of 26 Letters
Set of 26 colorful varsity style embroidered iron-on letter patches for clothing - 3D Embroidery*Set of 26 Letters
+17
Embroidered Alphabet Letter Patches Iron On Heat Seal Polyester Fabric For DIY Clothing Jacket Backpack Decor Varsity Style
$1.42-12.45
No MOQ
 · 
581 sold recently
Top 1% Best Sellers
in Arts, Crafts & Sewing
Free Shipping
Cartoon Animal Chenille Embroidered Patches Iron On Teddy Bear Panda Lion Applique For Clothing Bag DIY Decoration
Cartoon Animal Chenille Embroidered Patches Iron On Teddy Bear Panda Lion Applique For Clothing Bag DIY Decoration
like
Find Similar
Daisy embroidery patch double-sided adhesive sheets CROWN #513L size 10x20cm - One Strong Adhesive Sheet (20*10CM)
Brown curly teddy bear embroidered towel patch with pink bow and dimensions - Teddy Bear with Pink Bow (#1)
Detail of curly teddy bear embroidery patch with size dimensions 6.5cm by 5.8cm - Style 2 (Teddy Bear with Gift Box)
Detail view of lion embroidery patch with orange fleece texture and 6.8cm size measurements - Style 3 (Cartoon Lion)
+12
Cartoon Animal Chenille Embroidered Patches Iron On Teddy Bear Panda Lion Applique For Clothing Bag DIY Decoration
$0.27-5.11
No MOQ
 · 
75% reordered
Top 3% Best Sellers
in Arts, Crafts & Sewing
Free Shipping
Embroidered Animal Patches Iron On Cloth Stickers Polyester For DIY Clothing Bag Hat Decoration Novelty Repairing
Embroidered Animal Patches Iron On Cloth Stickers Polyester For DIY Clothing Bag Hat Decoration Novelty Repairing
like
Find Similar
Cute yellow duck cartoon embroidery patch with adhesive backing for DIY clothes and caps - Yellow Little Duck
Cartoon spider embroidery patch in green and black color, 4.2x3cm iron-on animal badge - Green Spider
White polar bear cartoon animal embroidery patch for clothing DIY decoration with adhesive back - White Polar Bear
Pink and black spotted frog embroidery patch, 5.4cm x 3.8cm decorative badge for clothing - Pink Frog
+6
Embroidered Animal Patches Iron On Cloth Stickers Polyester For DIY Clothing Bag Hat Decoration Novelty Repairing
$0.07-0.14
No MOQ
 · 
1K+ sold recently
Free Shipping
Pink Retro Embroidered Iron On Patches For Clothing Bag Shoes DIY Decoration Pink Cowgirl Hat Heart Dice Game Controller Embroidery Patch Applique
Pink Retro Embroidered Iron On Patches For Clothing Bag Shoes DIY Decoration Pink Cowgirl Hat Heart Dice Game Controller Embroidery Patch Applique
like
Find Similar
Pink and purple cartoon dinosaur embroidered patch for DIY clothing, size 6.5x5.5cm - Pink Dinosaur / Pink Dinosaur (PE5336CT)
Pink circular embroidered feminist patch with black lettering and 7.1cm diameter size - Round Slogan / PE5513CT
Detailed embroidery of a pink game controller patch with FONY text and 7x5cm scale - FONY Game Controller / PE5958CT
Pink I Can Do Hard Things floral embroidery patch for cowgirl hats and denim jackets - I CAN DO HARD THINGS / PE6103CT
+12
Pink Retro Embroidered Iron On Patches For Clothing Bag Shoes DIY Decoration Pink Cowgirl Hat Heart Dice Game Controller Embroidery Patch Applique
$0.24-0.81
Mix MOQ : 10
 · 
31 sold recently
Butterfly Embroidery Patches Colorful Polyester Sew On Iron On Applique For Clothing DIY Decor
Butterfly Embroidery Patches Colorful Polyester Sew On Iron On Applique For Clothing DIY Decor
like
Find Similar
Pink and yellow butterfly embroidery patch, DIY garment applique measuring 5.2 x 6.0 cm - Style 3
Detailed butterfly embroidery patch in pink and gold tones for DIY clothing repair - Style 4
Exquisite blue butterfly embroidery patch for DIY clothing, size 6.2cm x 5.2cm - Style 5
Detailed butterfly embroidered patch in rose pink and blue for DIY clothing decoration - Style 6
+29
Butterfly Embroidery Patches Colorful Polyester Sew On Iron On Applique For Clothing DIY Decor
-5%
$0.18-0.32
No MOQ
 · 
220 sold recently
Pink Heart Cartoon Animal Embroidered Iron On Patches For Clothing DIY Decoration Slogan Cute Patches For Jackets Hats Bags
Pink Heart Cartoon Animal Embroidered Iron On Patches For Clothing DIY Decoration Slogan Cute Patches For Jackets Hats Bags
like
Find Similar
Pink embroidered patch with Friends Don't Lie text in a comic bubble design - Speech Bubble Slogan Style (PE5176CT)
Cartoon white rabbit with pink flowers embroidered iron-on patch, size 6.1x5.8cm - Rabbit Rose Style (PE6076CT)
Detail of pink embroidered 'It's Cool to Be Kind' patch for DIY clothing repair - It's Cool to Be Kind Slogan (PE6601CT)
Pink girls have super powers embroidered heart patch for DIY clothing decoration - Girls Super Power Style (PE6729CT)
+13
Pink Heart Cartoon Animal Embroidered Iron On Patches For Clothing DIY Decoration Slogan Cute Patches For Jackets Hats Bags
$0.20-0.86
Mix MOQ : 10
 · 
12 sold recently
Free Shipping
Skull Embroidered Patches Iron On Appliques Skeleton Sugar Skull Halloween DIY Decor For Jackets Jeans Punk Rock Style
Skull Embroidered Patches Iron On Appliques Skeleton Sugar Skull Halloween DIY Decor For Jackets Jeans Punk Rock Style
like
Find Similar
Skull skeleton embroidery patch with landscape design and detailed size measurements - 10633-Mount Fuji Landscape Skull
Embroidered skull patch with green laurel leaves measuring 5.7x6.3cm for DIY clothing - 10635-Laurel Leaf Skull
Rock hand skull embroidered patch for clothes with 8.5cm x 5.8cm size and weight details - 10645-Skull Bone Hand
Blue Mexican sugar skull embroidery patch with red roses, size 5.4x7.3cm for DIY clothing - 10647-Blue Sugar Skull
+25
Skull Embroidered Patches Iron On Appliques Skeleton Sugar Skull Halloween DIY Decor For Jackets Jeans Punk Rock Style
-5%
$0.16-8.45
Mix MOQ : 10
 · 
198 sold recently
Free Shipping
Embroidered Patches Cartoon Cat Skull Pizza Design DIY Clothing Decoration Iron On Sew On Appliques For Jackets Backpacks
Embroidered Patches Cartoon Cat Skull Pizza Design DIY Clothing Decoration Iron On Sew On Appliques For Jackets Backpacks
like
Find Similar
Cute black cat embroidery patch with knife for DIY clothing decor, size 6x5.1cm - Black Cat with Knife A
Cartoon black cat embroidery patch with dagger, iron-on DIY applique for clothing 4.7x6.1cm - Black Cat with Knife B
Detail of black cat embroidery patch with daisy flowers and size info 4.4x6.5cm - Daisy Black Cat
Detail view of cartoon cat embroidery patch with measurements 4.6x6cm on white background - White Cat in Bag
+7
Embroidered Patches Cartoon Cat Skull Pizza Design DIY Clothing Decoration Iron On Sew On Appliques For Jackets Backpacks
-6%
$0.19-0.83
Mix MOQ : 10
 · 
75 sold recently
Free Shipping
Indian Henna Style Paisley Embroidered Patches For Clothing Ethnic Hollow Out Floral Iron On Applique Decorative Fabric Patch
Indian Henna Style Paisley Embroidered Patches For Clothing Ethnic Hollow Out Floral Iron On Applique Decorative Fabric Patch
like
Find Similar
Green paisley henna embroidery patch for clothing decoration measuring 12.8cm by 7.1cm - Paisley Patch 1# / Green
Black and white Paisley embroidery patch with precise dimensions 12.7cm by 7.1cm - Paisley Patch 2# / Black
Blue Paisley embroidered patch detail showing dimensions of 13.1cm height and 10cm width - Paisley Patch 3# / Cyan Blue
Red paisley embroidered patch with intricate white floral patterns for garment sewing - Paisley Patch 4# / Red
Indian Henna Style Paisley Embroidered Patches For Clothing Ethnic Hollow Out Floral Iron On Applique Decorative Fabric Patch
$0.58-0.72
No MOQ
 · 
20 sold recently
Musical Instrument Embroidery Patches Set Music Note Guitar Headphones Saxophone Cassette Iron On Patches For Clothing DIY Decoration Accessories
Musical Instrument Embroidery Patches Set Music Note Guitar Headphones Saxophone Cassette Iron On Patches For Clothing DIY Decoration Accessories
like
Find Similar
Red and blue trumpet musical instrument embroidered patch with dimensions 10cm x 3.3cm - Gz-2685* Minimum Order Of 10 Pieces Per Style. Thank You For Your Cooperation.
Yellow embroidered musical instrument patch with size markers for DIY clothing decor - Yellow Musical Instrument Shape (GZ-2684)
Blue headphone embroidered patch with red and yellow accents for DIY clothing decor - Blue Headphones Shape (GZ-2683)
Black guitar embroidered patch with golden patterns for DIY clothing decor - Gz-2686* Minimum Order Of 10 Pieces Per Style. Thank You For Your Cooperation.
+23
Musical Instrument Embroidery Patches Set Music Note Guitar Headphones Saxophone Cassette Iron On Patches For Clothing DIY Decoration Accessories
-8%
$0.10-7.51
Mix MOQ : 10
 · 
74 sold recently
Free Shipping
Floral Embroidery Patches Cherry Heart Bow DIY Clothing Applique Decorative Lace Crochet Sew On Iron On Accessories
Floral Embroidery Patches Cherry Heart Bow DIY Clothing Applique Decorative Lace Crochet Sew On Iron On Accessories
like
Find Similar
Handmade crochet cherry flower embroidery patch in beige with pink and red floral details - Oval Flower
Heart-shaped tulip embroidery patch in cream white, size 3.7x4.6cm for DIY apparel - Heart Tulip
Lace cherry embroidery heart patch with green leaves for DIY clothing accessories - Heart Shape Cherry
Lace bow applique with orange button 3.8x2.9cm for DIY hair accessories - Bow
+6
Floral Embroidery Patches Cherry Heart Bow DIY Clothing Applique Decorative Lace Crochet Sew On Iron On Accessories
$0.03-0.35
Mix MOQ : 20
 · 
203 sold recently
Free Shipping
Heart Embroidered Patches Polyester Fabric Iron On Self Adhesive DIY Decorative Appliques For Clothing Bags Hats
Heart Embroidered Patches Polyester Fabric Iron On Self Adhesive DIY Decorative Appliques For Clothing Bags Hats
like
Find Similar
Colorful heart embroidery patches for DIY clothing decoration and accessory repair - Multicolor 20pcs Set * Iron-on
Pink heart embroidered patch 2.6x2cm decorative applique for clothes and accessories - Hot Melt Adhesive / Rose Pink
Yellow heart embroidered self-adhesive patch, 2.6cm x 2cm size for DIY clothing accessories - Hot Melt Adhesive / Light Yellow
Purple heart embroidered patch 2.6cm x 2cm size with dense twill stitching detail - Hot Melt Adhesive / Deep purple
+38
Heart Embroidered Patches Polyester Fabric Iron On Self Adhesive DIY Decorative Appliques For Clothing Bags Hats
$0.04-1.44
No MOQ
 · 
1K+ sold recently
Top 5% Best Sellers
in Arts, Crafts & Sewing
Free Shipping
90s Retro Embroidery Patches Vintage Slogan Iron On Sewing Applique For Clothing Bags Jackets DIY Decorative
90s Retro Embroidery Patches Vintage Slogan Iron On Sewing Applique For Clothing Bags Jackets DIY Decorative
like
Find Similar
Macro view of retro 90s style embroidery patch showing size 8.5x4.7cm on white background - BACK TO 90'S Popup
DIY retro poker Q and K embroidery patches with crown symbols and 90s style letter designs - Poker Q&K
Rectangular 90s style I HAVE SUPER POWERS embroidered patch in black and rainbow colors - I HAVE SUPER POWERS
Life is Beautiful embroidered black patch with white text for 90s DIY fashion - Life is Beautiful
+5
90s Retro Embroidery Patches Vintage Slogan Iron On Sewing Applique For Clothing Bags Jackets DIY Decorative
-6%
$0.27-0.55
No MOQ
 · 
207 sold recently
Top 10% Best Sellers
in Arts, Crafts & Sewing
Free Shipping
Embroidered Patches Iron On Moon Mushroom Skull Punk Style DIY Decorative Applique For Clothing Jackets Jeans Backpacks
Embroidered Patches Iron On Moon Mushroom Skull Punk Style DIY Decorative Applique For Clothing Jackets Jeans Backpacks
like
Find Similar
Close-up of star and yellow crescent moon embroidered patch with green vine details - Pentagram Crescent Vine
Pink crescent moon and purple mushroom embroidered iron-on patch, 6.4x7.5cm DIY sewing patch - Pink Moon Purple Mushrooms
Detailed view of Magic Mushrooms embroidered patch on black background measuring 5.4x8.1cm - Magic Mushrooms Slogan
Pink crescent moon face embroidery patch with white flower and stars, 6.5x7.2cm - Pink Moon Face
+5
Embroidered Patches Iron On Moon Mushroom Skull Punk Style DIY Decorative Applique For Clothing Jackets Jeans Backpacks
-5%
$0.62-1.23
Mix MOQ : 10
 · 
132 sold recently
Free Shipping
Embroidery Patches Iron On Cloth Cartoon VSCO Style Beach Outdoor Retro For Clothing Backpack Decoration Accessories
Embroidery Patches Iron On Cloth Cartoon VSCO Style Beach Outdoor Retro For Clothing Backpack Decoration Accessories
like
Find Similar
Rainbow cloud embroidery patch with Be Live text, dimensions 5.8cm x 3.2cm, 0.9g weight - VSCO Patch 3# (Rainbow Cloud)
Detailed close-up of 17 colorful cartoon iron-on embroidery patches with neat stitching - VSCO Style Patch Set (17Pcs)
Detail showing rainbow PEACE & LOVE embroidery patch dimensions 5.9x5.5cm and 2.5g weight - VSCO Patch 5# (Peace Symbol)
Detailed view of water bottle shaped embroidered patch with cactus and desert motif - VSCO Patch 4# (Outdoor Canteen)
+14
Embroidery Patches Iron On Cloth Cartoon VSCO Style Beach Outdoor Retro For Clothing Backpack Decoration Accessories
$0.17-5.44
No MOQ
 · 
778 sold recently
Top 3% Best Sellers
in Arts, Crafts & Sewing
Free Shipping
Cartoon Fruit Embroidery Patches Iron On Sew On Watermelon Cherry Appliques For DIY Clothing Backpack Decoration Accessories
Cartoon Fruit Embroidery Patches Iron On Sew On Watermelon Cherry Appliques For DIY Clothing Backpack Decoration Accessories
like
Find Similar
Watermelon slice embroidered patch with size dimensions 7.8cm width and 3.6cm height - Watermelon 1
Vibrant watermelon slice embroidery patch measuring 4.5 cm by 4.7 cm with dense stitching - Watermelon 2
Pink and purple double cherry embroidered patch with green leaves, size 4.5cm x 4.5cm - Cherry 1
Watermelon slice embroidered patch with iron-on backing, dimensions 5.2 cm by 2.8 cm - Watermelon 3
+21
Cartoon Fruit Embroidery Patches Iron On Sew On Watermelon Cherry Appliques For DIY Clothing Backpack Decoration Accessories
-9%
$0.10-0.33
No MOQ
 · 
118 sold recently
Top 10% Best Sellers
in Arts, Crafts & Sewing
Floral Embroidered Letter Patches For Clothing Alphabet Fabric Appliques Self Adhesive DIY Patch Decoration For Hats Bags
Floral Embroidered Letter Patches For Clothing Alphabet Fabric Appliques Self Adhesive DIY Patch Decoration For Hats Bags
like
Find Similar
Detailed grid view of 26 pink floral embroidery letter patches for DIY clothing and bags - Size 5cm Self-Adhesive / Rose Red
Detail of 26 alphabet floral embroidery patches with orange borders and floral patterns - Size 5cm Self-Adhesive / Orange
Detailed close-up showing all 26 floral alphabet embroidery patches with blue borders - Size 5cm Self-Adhesive / Blue
Floral Embroidered Letter Patches For Clothing Alphabet Fabric Appliques Self Adhesive DIY Patch Decoration For Hats Bags
$0.20
Mix MOQ : 2
 · 
390 sold recently
Free Shipping
Colorful Embroidery Patches Iron On Butterfly Flower Hippie Style Fabric Badges For Clothes Bags DIY Decor
Colorful Embroidery Patches Iron On Butterfly Flower Hippie Style Fabric Badges For Clothes Bags DIY Decor
like
Find Similar
Detailed embroidery texture of pink cartoon bus iron-on patch with size measurements - Style 1 (Pink Bus)
Detail view of 5cm flower embroidery patch with colorful threads and precise dimensions - Style 2 (Multicolor Flower)
Pink and yellow floral embroidered patch with 4.8cm size measurement on white background - Style 5 (Pink Peace Flower)
Detail view of pink lip and daisy embroidery patch with 5.5cm measurement scale - Style 7 (Pink Lips Daisy)
+18
Colorful Embroidery Patches Iron On Butterfly Flower Hippie Style Fabric Badges For Clothes Bags DIY Decor
$0.20-4.99
No MOQ
 · 
158 sold recently
Top 10% Best Sellers
in Arts, Crafts & Sewing
Free Shipping
Tropical Hawaii Embroidered Patches Iron On Sew On Decorative Cloth Stickers Summer Beach Style For Clothes Bags DIY
Tropical Hawaii Embroidered Patches Iron On Sew On Decorative Cloth Stickers Summer Beach Style For Clothes Bags DIY
like
Find Similar
Detailed parrot embroidery patch with tropical leaves and hibiscus flower dimensions - Hawaiian Patch 1# (Parrot)
Detail view of pineapple embroidery patch showing stitching and 7x3.2cm dimensions - Hawaiian Patch 2# (Pineapple)
Detail showing Tiki mask embroidery patch with size dimensions and precise stitching - Hawaiian Patch 3# (Tiki Mask)
Detail view of tropical guitar embroidery patch with precise dimensions and weight specs - Hawaiian Patch 4# (Totem)
+29
Tropical Hawaii Embroidered Patches Iron On Sew On Decorative Cloth Stickers Summer Beach Style For Clothes Bags DIY
$0.17-9.22
No MOQ
 · 
548 sold recently
Top 3% Best Sellers
in Arts, Crafts & Sewing
Free Shipping
Star Bow Embroidered Fabric Patches Colorful Self Adhesive Iron On Appliques For Clothes Backpacks DIY Accessories
Star Bow Embroidered Fabric Patches Colorful Self Adhesive Iron On Appliques For Clothes Backpacks DIY Accessories
like
Find Similar
Pink embroidered bow patch with detailed stitching for clothing decoration and DIY crafts - Bow / Pink
Pink embroidered bow patch for clothing with white borders and high-density texture - Bow / Light Pink
Orange star embroidered patch with silver edge on a notebook background - Star / Orange
Lavender purple star embroidery patch with silver border for DIY clothing - Star / Purple
+8
Star Bow Embroidered Fabric Patches Colorful Self Adhesive Iron On Appliques For Clothes Backpacks DIY Accessories
$0.10-1.19
No MOQ
 · 
400 sold recently
Free Shipping
Mexican Fiesta Embroidered Patches Iron On Appliques For Clothing Decor Taco Sombrero Guitar Avocado DIY Sewing Patch
Mexican Fiesta Embroidered Patches Iron On Appliques For Clothing Decor Taco Sombrero Guitar Avocado DIY Sewing Patch
like
Find Similar
Daisy embroidery patch double-sided adhesive sheets CROWN #513L size 10x20cm - Adhesive Sheet / Large Size
Mexican Fiesta embroidery patch set featuring taco, sombrero, guitar and cactus icons - Mexican Theme Series Collection
Detail view showing dimensions of Mexican gnome patch with guitar and sombrero embroidery - Gnome Playing Guitar
Mexican taco embroidered patch with size markers on white background for DIY party decor - Taco Patch
+8
Mexican Fiesta Embroidered Patches Iron On Appliques For Clothing Decor Taco Sombrero Guitar Avocado DIY Sewing Patch
$0.22-3.12
No MOQ
 · 
77% reordered
Top 10% Best Sellers
in Arts, Crafts & Sewing
Free Shipping
Star Embroidery Patches Iron On Five Pointed Star Shape Colorful Fabric Applique For Clothing Repair DIY Decoration Hat Bag Accessories
Star Embroidery Patches Iron On Five Pointed Star Shape Colorful Fabric Applique For Clothing Repair DIY Decoration Hat Bag Accessories
like
Find Similar
Yellow embroidered star patch for clothing with 4.3cm dimension and 0.5g weight - Yellow Five-Pointed Star (G1L-A-1-4 Iron-On)
White five-pointed star embroidered patch, 4.3cm minimalist applique for clothes and hats - White 4.3cm (G1L-A-2-3 Hot Melt Adhesive)
Black embroidered star patch for clothing with 4.3cm size detail and textured finish - Black Five-Pointed Star (G1L-A-2-5 Iron-On)
Silver embroidered star patch 4.3cm for clothes and hats with 0.5g lightweight texture - Silver Gray Five-Pointed Star (G1L-A-2-10 Iron-On)
+37
Star Embroidery Patches Iron On Five Pointed Star Shape Colorful Fabric Applique For Clothing Repair DIY Decoration Hat Bag Accessories
$0.04-3.54
No MOQ
 · 
453 sold recently
Top 10% Best Sellers
in Arts, Crafts & Sewing
Free Shipping
Punk Gorilla Embroidery Patch Crown Skull Dog Bear Embroidered Patches For Clothing Bag Hat DIY Decoration Accessory
Punk Gorilla Embroidery Patch Crown Skull Dog Bear Embroidered Patches For Clothing Bag Hat DIY Decoration Accessory
like
Find Similar
Punk gorilla embroidery patch wearing camo helmet and cigar, size 8.2x6.5cm - Pe5536ct
Detailed embroidery of a bulldog patch with golden crown and spiked collar, 6.5x8.7cm - Crown Collar Bulldog (PE5537CT)
Punk gorilla embroidery patch with sunglasses and cigar, 6.7x8.7cm clothing applique - Pe5538ct
Punk gorilla embroidery patch with cigar and bandana design, size 7x8.7cm - Pe5542ct
+5
Punk Gorilla Embroidery Patch Crown Skull Dog Bear Embroidered Patches For Clothing Bag Hat DIY Decoration Accessory
-6%
$0.55-1.43
Mix MOQ : 10
 · 
16 sold recently
Free Shipping
Forest Fresh Green Embroidery Cloth Patches Iron On Appliques For Clothes Bag DIY Decoration Cartoon Flower Plant Patches
Forest Fresh Green Embroidery Cloth Patches Iron On Appliques For Clothes Bag DIY Decoration Cartoon Flower Plant Patches
like
Find Similar
Green gradient rainbow embroidery patch for clothing with dimensions and weight info - Rainbow (Cartoon Forest Patch 1#)
Green cactus embroidered iron-on patch with orange flower detail and 6.3cm size measurements - Cactus (Cartoon Forest Patch 2#)
Green leaf embroidered patch 6.5x3cm for clothes, fairy style floral decorative iron on - Green Leaf (Cartoon Forest Patch 3#)
Embroidered stacked books patch in green and pink with iron-on backing, 6.3x6cm size - Stacked Books (Cartoon Forest Patch 4#)
+20
Forest Fresh Green Embroidery Cloth Patches Iron On Appliques For Clothes Bag DIY Decoration Cartoon Flower Plant Patches
$0.20-6.31
No MOQ
 · 
310 sold recently
Free Shipping
Embroidered Patches Floral Cartoon Bear Heart Appliques DIY Clothing Bag Decoration Iron On Sew On Embroidered Fabric
Embroidered Patches Floral Cartoon Bear Heart Appliques DIY Clothing Bag Decoration Iron On Sew On Embroidered Fabric
like
Find Similar
Pink tulip flower embroidered patch on lilac base for DIY hair accessories 6.1x4.5cm - Pink Tulip on Lavender Base
Orange tulip embroidered patch with green stem for DIY hair accessories and brooch - Orange Tulip Bud
Handmade crochet beige flower patch with yellow blossoms and green leaves for DIY crafts - Beige Yellow Double Flowers
Crochet floral patch in beige with pink and dark red flowers, size 5.9cm x 4.4cm - Beige Red and Pink Flowers
+14
Embroidered Patches Floral Cartoon Bear Heart Appliques DIY Clothing Bag Decoration Iron On Sew On Embroidered Fabric
$0.33
No MOQ
 · 
42 sold recently
Free Shipping
Cartoon Slogan Embroidery Cloth Patches Creative Animal Letter Iron On Sew On Appliques For DIY Clothes Bags Decoration
Cartoon Slogan Embroidery Cloth Patches Creative Animal Letter Iron On Sew On Appliques For DIY Clothes Bags Decoration
like
Find Similar
Camera embroidered iron on patch with pink heart detail measuring 5.7x3.9cm - Camera Style (PE0688CT)
Detail of embroidered patch showing purple ribbon with text You Are Safe With Me - Purple Pin Slogan Style (PE5145CT)
7cm round embroidered patch featuring Have Courage & Be Kind quote with floral details - Round Inspirational Quote Style (PE5460CT)
Macro view of She Is Fierce heart embroidery patch with gold border, size 6.3x6cm - Gold Edged Heart Slogan Style (PE6463CT)
+4
Cartoon Slogan Embroidery Cloth Patches Creative Animal Letter Iron On Sew On Appliques For DIY Clothes Bags Decoration
-5%
$0.21-0.62
No MOQ
 · 
56 sold recently
Free Shipping
Sun Flower Embroidery Patches Chenille Iron On Appliques For DIY Clothing Bag Decor Colorful 3D Fabric Accessories
Sun Flower Embroidery Patches Chenille Iron On Appliques For DIY Clothing Bag Decor Colorful 3D Fabric Accessories
like
Find Similar
Light blue flower towel embroidery patch 5.1cm sunflower DIY sewing applique - Hot Melt Adhesive / Light Blue
Vibrant rose pink sunflower towel embroidery patch with yellow core for DIY apparel - Hot Melt Adhesive / Rose Red
Yellow sunflower towel embroidered patch for clothing DIY crafts, 5.1cm size - Hot Melt Adhesive / Yellow
Plush white sunflower embroidery patch with yellow center, 5.2cm DIY craft applique - Hot Melt Adhesive / White
+2
Sun Flower Embroidery Patches Chenille Iron On Appliques For DIY Clothing Bag Decor Colorful 3D Fabric Accessories
$0.16
No MOQ
 · 
145 sold recently
Free Shipping
Punk Rock Letter Embroidery Patches Iron On Heat Adhesive DIY Applique For Jackets Bags Clothing Decoration
Punk Rock Letter Embroidery Patches Iron On Heat Adhesive DIY Applique For Jackets Bags Clothing Decoration
like
Find Similar
Punks Not Dead embroidered iron-on patch with red anarchy symbol, 6.6cm round badge - PUNKS NOT DEAD/Dia 6.6cm
Hello speech bubble embroidery patch in black and white finish for DIY jackets, 5.3x3.8cm - HELLO Bubble/5.3x3.8cm
Detailed embroidery texture of round patch featuring blue YOU LOOK SUS text on black base - YOU LOOK SUS/Dia 6.5cm
Socially Awkward punk letter embroidery patch in pink and yellow on black, 7.3x3.1cm size - SOCIALLY AWKWARD/7.3x3.1cm
+7
Punk Rock Letter Embroidery Patches Iron On Heat Adhesive DIY Applique For Jackets Bags Clothing Decoration
-6%
$0.12-0.96
Mix MOQ : 10
 · 
220 sold recently
Free Shipping
Round Outdoor Adventure Embroidered Patches For Clothing Backpack Iron On Sew On Decorative Hiking Camping Badge Applique
Round Outdoor Adventure Embroidered Patches For Clothing Backpack Iron On Sew On Decorative Hiking Camping Badge Applique
like
Find Similar
Round embroidered animal paw patch with brown footprints and green grass detail - Animal Tracks Style (AZ2507E5-2-1#)
Outdoor Warriors campfire round embroidery patch 4.4x4.3cm for clothing accessories - Campfire Outdoor Warriors Style (AZ2507E5-2-2#)
Round expert troublemaker patch with slingshot embroidery and turquoise border - Slingshot Expert Style (AZ2507E5-2-3#)
Embroidered round patch featuring a rowing expert theme for outdoor apparel - Rowing Expert Style (AZ2507E5-2-4#)
+21
Round Outdoor Adventure Embroidered Patches For Clothing Backpack Iron On Sew On Decorative Hiking Camping Badge Applique
$0.22-5.19
No MOQ
 · 
900 sold recently
Free Shipping
Go to

More in bags

Explore more in woven patches

shoulderbag large capacitystyletravelwidegirlssimpleshoulder bag handbaghandparty
straplettercolorheartartificialhandmadehollowmobile phonestarunderarm

Ready to source like an insider

Get a direct line to the factory floor — no minimums, no middlemen, no guesswork.
iconReal factory pricing, no markup in betweeniconEvery order hand-inspected before it shipsicon5,000+ new products added daily
Get Inside Access