Everful

Wholesale wall clocks, wall clocks, wall sticker clocks

Factory-direct selection, vetted for quality and ready to order.

Sign Up
Wall Clocks, Wall Clocks, Wall Sticker Clocks

Find the perfect pieces: alarm clocks, wall clocks & wall sticker clocks

filterShow Filters
Best Seller
New Arrivals
Price Drop
Free Shipping
Vintage Nautical Wood Wall Clock Silent Round Beach Sea Theme Decorative Timepiece For Living Room Home Office Decor
Vintage Nautical Wood Wall Clock Silent Round Beach Sea Theme Decorative Timepiece For Living Room Home Office Decor
like
Find Similar
Silent vintage nautical wall clock with anchor motif on ocean blue wood panels - Retro Blue Beige Anchor
12-inch vintage silent wall clock with multicolor distressed wood grain print design - Colored Wood Strips
Silent wooden wall clock featuring a vintage tropical beach ocean scenery design - Ocean Waves Beach
Silent wooden wall clock featuring a vintage tropical beach ocean scenery design - Tropical Palm Beach
+41
Vintage Nautical Wood Wall Clock Silent Round Beach Sea Theme Decorative Timepiece For Living Room Home Office Decor
-4%
$4.11
Mix MOQ : 2
 · 
52 sold recently
DIY Wall Clock Acrylic Frameless Luminous Silent Mirror 3D Surface Sticker Modern Home Decor For Living Room Office
DIY Wall Clock Acrylic Frameless Luminous Silent Mirror 3D Surface Sticker Modern Home Decor For Living Room Office
like
Find Similar
DIY black acrylic wall clock with 3D numbers and luminous silent movement for living room - Small 40cm / Black
Macro shot of DIY acrylic luminous wall clock numbers and hands on a clean white wall - Medium 50cm / Black
Minimalist DIY frameless wall clock with 3D black acrylic numbers and black hands set - Medium 3D 90cm / Black
Minimalist DIY frameless wall clock in black acrylic with luminous 3D large numbers - Large 3D 130cm / Black
+16
DIY Wall Clock Acrylic Frameless Luminous Silent Mirror 3D Surface Sticker Modern Home Decor For Living Room Office
-5%
$1.10-6.16
No MOQ
 · 
33 views
Black Line Art Feather Butterfly Clock Wall Sticker PVC Waterproof Self Adhesive Dreamcatcher Decal For Living Room Home Decor
Black Line Art Feather Butterfly Clock Wall Sticker PVC Waterproof Self Adhesive Dreamcatcher Decal For Living Room Home Decor
like
Find Similar
Black feather dreamcatcher wall sticker layout size 90x30cm and paste effect display - Black Line Feather Clock Style (SC372)
Black Line Art Feather Butterfly Clock Wall Sticker PVC Waterproof Self Adhesive Dreamcatcher Decal For Living Room Home Decor
$1.44
Mix MOQ : 4
Creative Cartoon Motivational Time Management Wall Sticker PVC Roman Numeral Clock Hourglass For Office Classroom Decor
Creative Cartoon Motivational Time Management Wall Sticker PVC Roman Numeral Clock Hourglass For Office Classroom Decor
like
Find Similar
1 option
Creative Cartoon Motivational Time Management Wall Sticker PVC Roman Numeral Clock Hourglass For Office Classroom Decor
$1.38
No MOQ
Watercolor Green Potted Plants Wall Stickers PVC Waterproof Clock Leaf Wall Decals For Living Room Bedroom Kids Room Home Decor
Watercolor Green Potted Plants Wall Stickers PVC Waterproof Clock Leaf Wall Decals For Living Room Bedroom Kids Room Home Decor
like
Find Similar
Layout details of hand-painted watercolor plant wall stickers with retro clock design - 30x90cm (2 Sheets)
Watercolor Green Potted Plants Wall Stickers PVC Waterproof Clock Leaf Wall Decals For Living Room Bedroom Kids Room Home Decor
-4%
$1.78
No MOQ
Christmas Countdown Wreath Clock Wall Sticker PVC Roman Numeral Gold Clock Face Garland Red Bow Festive Home Decoration
Christmas Countdown Wreath Clock Wall Sticker PVC Roman Numeral Gold Clock Face Garland Red Bow Festive Home Decoration
like
Find Similar
Christmas wreath wall sticker with vintage clock face design measuring 38x38cm - Christmas Clock Wreath (PH-QT9249)
NewChristmas Countdown Wreath Clock Wall Sticker PVC Roman Numeral Gold Clock Face Garland Red Bow Festive Home Decoration
$1.10
No MOQ
Motivational Wall Sticker Every Day Is A New Beginning Running Silhouette Clock PVC Removable Home Office Decal Black
Motivational Wall Sticker Every Day Is A New Beginning Running Silhouette Clock PVC Removable Home Office Decal Black
like
Find Similar
Detail view of PVC wall stickers with black clock patterns and motivational running silhouettes - 30*90CM*2PCS Layout
Motivational Wall Sticker Every Day Is A New Beginning Running Silhouette Clock PVC Removable Home Office Decal Black
-4%
$1.92
No MOQ
Vintage Retro Clock Book Floral Wall Stickers PVC Removable Self Adhesive Art Decal For Living Room Bedroom Home Decor
Vintage Retro Clock Book Floral Wall Stickers PVC Removable Self Adhesive Art Decal For Living Room Bedroom Home Decor
like
Find Similar
Vintage wall decals featuring clock, flowers and books with 37x37cm layout display - 40x40cm (13P0-D11) / Brown
Vintage Retro Clock Book Floral Wall Stickers PVC Removable Self Adhesive Art Decal For Living Room Bedroom Home Decor
$1.01
Mix MOQ : 3
Black Tree And Flying Birds Wall Sticker Modern PVC Silhouette Decal With Clock Decor For Living Room Bedroom Home Art
Black Tree And Flying Birds Wall Sticker Modern PVC Silhouette Decal With Clock Decor For Living Room Bedroom Home Art
like
Find Similar
Detail of tree and bird wall stickers showing sheet layout and final application size - 30*60cm
Black Tree And Flying Birds Wall Sticker Modern PVC Silhouette Decal With Clock Decor For Living Room Bedroom Home Art
$1.15
Mix MOQ : 2
Vintage Christmas Clock Pine Needle Toilet Sticker PVC Self Adhesive Wall Decal For Festive Bathroom Home Decor Supplies
Vintage Christmas Clock Pine Needle Toilet Sticker PVC Self Adhesive Wall Decal For Festive Bathroom Home Decor Supplies
like
Find Similar
Detailed size chart for Christmas bell wall sticker showing layout and finished dimensions - 24x24cm (HY-M478)
Vintage Christmas Clock Pine Needle Toilet Sticker PVC Self Adhesive Wall Decal For Festive Bathroom Home Decor Supplies
$0.58
No MOQ
3D Realistic Butterfly Wall Stickers 12Pcs Set PVC Waterproof DIY Art Decor For Home Living Room Wedding Fridge Magnet Safety Pin
3D Realistic Butterfly Wall Stickers 12Pcs Set PVC Waterproof DIY Art Decor For Home Living Room Wedding Fridge Magnet Safety Pin
like
Find Similar
Set of 13 pink and purple 3D PVC butterfly wall stickers on a clean white background - 12 Pieces/Pack (Magnet + Adhesive) / Pink
3D colorful PVC butterfly wall stickers in various sizes for home decor on white background - 12 Pieces/Pack (Magnet + Adhesive) / Rainbow
Set of 12 multi-size 3D butterfly wall stickers in white with colorful wing patterns - 12 Pieces/Pack (Magnet + Adhesive) / White
Set of 13 colorful waterproof 3D PVC butterfly wall stickers on white background - 12 Pieces/Pack (Magnet + Adhesive) / Realistic Series
+11
3D Realistic Butterfly Wall Stickers 12Pcs Set PVC Waterproof DIY Art Decor For Home Living Room Wedding Fridge Magnet Safety Pin
$0.48
Mix MOQ : 2
 · 
152 sold recently
Creative Coffee Time Wall Sticker Spanish Hora del Café Clock Design PVC Removable Decal for Cafe Kitchen Home Decor
Creative Coffee Time Wall Sticker Spanish Hora del Café Clock Design PVC Removable Decal for Cafe Kitchen Home Decor
like
Find Similar
1 option
Creative Coffee Time Wall Sticker Spanish Hora del Café Clock Design PVC Removable Decal for Cafe Kitchen Home Decor
$1.44
Mix MOQ : 2
Vintage Clock Flower Butterfly Wall Sticker Retro Steampunk PVC Self Adhesive Decorative Decal For Living Room Home Decor
Vintage Clock Flower Butterfly Wall Sticker Retro Steampunk PVC Self Adhesive Decorative Decal For Living Room Home Decor
like
Find Similar
Vintage butterfly floral clock wall stickers for living room decor with retro rose elements - 40x40cm / Brown
Vintage Clock Flower Butterfly Wall Sticker Retro Steampunk PVC Self Adhesive Decorative Decal For Living Room Home Decor
$0.72
Mix MOQ : 3
Inspirational Time Quote Wall Sticker Removable PVC Art Decal Home Decor For Living Room Bedroom Office Artistic Decal
Inspirational Time Quote Wall Sticker Removable PVC Art Decal Home Decor For Living Room Bedroom Office Artistic Decal
like
Find Similar
1 option
Inspirational Time Quote Wall Sticker Removable PVC Art Decal Home Decor For Living Room Bedroom Office Artistic Decal
-4%
$0.96
No MOQ
Vintage Floral Bird Wall Stickers Removable PVC Decals For Bedroom Bathroom Kitchen Cabinet Door Naturalist Home Decor
Vintage Floral Bird Wall Stickers Removable PVC Decals For Bedroom Bathroom Kitchen Cabinet Door Naturalist Home Decor
like
Find Similar
1 option
Vintage Floral Bird Wall Stickers Removable PVC Decals For Bedroom Bathroom Kitchen Cabinet Door Naturalist Home Decor
$1.21
No MOQ
European Faux Wood Grain Self Adhesive Wallpaper PVC Waterproof Wall Panel Grille Pattern Sticker For Living Room Home Decor
European Faux Wood Grain Self Adhesive Wallpaper PVC Waterproof Wall Panel Grille Pattern Sticker For Living Room Home Decor
like
Find Similar
Modern dark grey wood grain vertical slat wall sticker for interior home wall decoration - Dark Gray Wood Grille (CT26Y70026M) / 44*150cm*1 Sheet
Light grey wood grain self-adhesive PVC wallpaper with vertical 3D fluted stripe texture - Light Gray Wood Grille (CT26Y70025M) / 44*150cm*1 Sheet
Self-adhesive wood grain wall panel with dark vertical slat design and natural texture - Dark Coffee Wood Grille (CT26Y70024M) / 44*150cm*1 Sheet
Dark walnut wood slat wall panel with self-adhesive PVC backing for interior wall decor - Walnut Wood Grille (CT26Y70023M) / 44*150cm*1 Sheet
+4
NewEuropean Faux Wood Grain Self Adhesive Wallpaper PVC Waterproof Wall Panel Grille Pattern Sticker For Living Room Home Decor
$4.27-6.34
Mix MOQ : 2
 · 
20 views
Cartoon Yellow Pear Wall Stickers PVC Waterproof Fruit Pattern Wall Decals For Children Room Nursery Classroom Home Wall Decor
Cartoon Yellow Pear Wall Stickers PVC Waterproof Fruit Pattern Wall Decals For Children Room Nursery Classroom Home Wall Decor
like
Find Similar
Detailed dimension layout of pear wall stickers showing the 30cm by 60cm product sheet size - 30*60cm Layout
NewCartoon Yellow Pear Wall Stickers PVC Waterproof Fruit Pattern Wall Decals For Children Room Nursery Classroom Home Wall Decor
$1.21
No MOQ
Removable PVC Wall Sticker Family Quote DIY Art Decal Modern Casual Black Clock Layout Home Decor For Living Room Bedroom
Removable PVC Wall Sticker Family Quote DIY Art Decal Modern Casual Black Clock Layout Home Decor For Living Room Bedroom
like
Find Similar
Family Time inspirational wall sticker with clock hand design in black art font - Family Quote (30x120cm x 2 Sheets, Without Frame) / Black
Removable PVC Wall Sticker Family Quote DIY Art Decal Modern Casual Black Clock Layout Home Decor For Living Room Bedroom
$3.17
No MOQ
Creative Music Notes Stave Wall Stickers Removable PVC Art Decals For Living Room Bedroom Music Room Modern Minimalist Decor
Creative Music Notes Stave Wall Stickers Removable PVC Art Decals For Living Room Bedroom Music Room Modern Minimalist Decor
like
Find Similar
Abstract black music notes and staff PVC wall decal set for modern living room decor - 100x60cm / Black
Brown music notes and staff wall decals above yellow art vases in a minimalist living room - 100x60cm / Brown
Creative music notes and staff PVC wall sticker set with floral elements for home decor - 100x60cm / Light Gray
Creative Music Notes Stave Wall Stickers Removable PVC Art Decals For Living Room Bedroom Music Room Modern Minimalist Decor
-5%
$1.64
No MOQ
Coffee Time Wall Sticker Artistic Coffee Cup Heart Pattern Waterproof Removable PVC Decal For Kitchen Cafe Home Wall Art
Coffee Time Wall Sticker Artistic Coffee Cup Heart Pattern Waterproof Removable PVC Decal For Kitchen Cafe Home Wall Art
like
Find Similar
Detail of coffee time wall sticker showing hand-drawn cup, beans and heart-shaped patterns - 24*24cm (HY-F741)
Coffee Time Wall Sticker Artistic Coffee Cup Heart Pattern Waterproof Removable PVC Decal For Kitchen Cafe Home Wall Art
$0.86
No MOQ
Creative Mirror Acrylic Wall Sticker Cute Mice Pulling Cheese Design Corner Decal For Door Bedroom Home Decoration
Creative Mirror Acrylic Wall Sticker Cute Mice Pulling Cheese Design Corner Decal For Door Bedroom Home Decoration
like
Find Similar
Golden mirror acrylic wall stickers featuring cute mice carrying cheese on a cabinet edge - Gold
Mirror acrylic mouse and cheese wall sticker decor for door corner and wall edge - Silver
Black acrylic mirror wall stickers featuring playful mice and cheese for door corners - Black
Creative Mirror Acrylic Wall Sticker Cute Mice Pulling Cheese Design Corner Decal For Door Bedroom Home Decoration
-4%
$1.53
No MOQ
Fashion Shopping Girl Silhouette Wall Sticker Removable PVC Decorative Wall Decal For Bedroom Living Room Home Art Mural Black
Fashion Shopping Girl Silhouette Wall Sticker Removable PVC Decorative Wall Decal For Bedroom Living Room Home Art Mural Black
like
Find Similar
Detail view of black silhouette wall sticker featuring a woman shopping with bags - 58.7*42cm Layout
Fashion Shopping Girl Silhouette Wall Sticker Removable PVC Decorative Wall Decal For Bedroom Living Room Home Art Mural Black
-4%
$2.68
No MOQ
Vintage Hand-drawn Flower Butterfly Clock Book Wall Sticker Removable PVC Self-adhesive Decal For Home Living Room Bedroom Decor
Vintage Hand-drawn Flower Butterfly Clock Book Wall Sticker Removable PVC Self-adhesive Decal For Home Living Room Bedroom Decor
like
Find Similar
Vintage flower and clock wall sticker with retro books and butterflies on white background - 13P0-D12 Style / Brown
Vintage Hand-drawn Flower Butterfly Clock Book Wall Sticker Removable PVC Self-adhesive Decal For Home Living Room Bedroom Decor
$0.72
Mix MOQ : 3
Summer Watermelon Hello Summer PVC Waterproof Wall Sticker For Living Room Kitchen Bathroom Home Decor Removable Decal
Summer Watermelon Hello Summer PVC Waterproof Wall Sticker For Living Room Kitchen Bathroom Home Decor Removable Decal
like
Find Similar
Waterproof Hello Summer watermelon wall sticker for living room, 40x60cm home decoration - Watermelon 40*60CM In Bag
Summer Watermelon Hello Summer PVC Waterproof Wall Sticker For Living Room Kitchen Bathroom Home Decor Removable Decal
-4%
$1.07
No MOQ
Modern Minimalist Black PVC Coffee Cup And Heart Wall Sticker Self Adhesive Removable Home Decor For Kitchen Coffee Shop
Modern Minimalist Black PVC Coffee Cup And Heart Wall Sticker Self Adhesive Removable Home Decor For Kitchen Coffee Shop
like
Find Similar
Detailed 27x60cm coffee cup and heart pattern vinyl wall sticker layout with text - 27*60cm
Modern Minimalist Black PVC Coffee Cup And Heart Wall Sticker Self Adhesive Removable Home Decor For Kitchen Coffee Shop
$0.72
No MOQ
Modern Cartoon Cat Letter Wall Tapestry Polyester Fabric Hanging Art Decor For Bedroom Living Room Home Aesthetic Decor
Modern Cartoon Cat Letter Wall Tapestry Polyester Fabric Hanging Art Decor For Bedroom Living Room Home Aesthetic Decor
like
Find Similar
Minimalist cat soda tapestry with retro headphone bottle print and Refill text for wall decor - 95x73cm Brushed Fabric / Soda Bottle Style (GT31-1)
Cartoon weirdo cat tapestry with heart gesture art on white light fabric background - Gt31-2 / 95X73 Brushed Fabric
White tapestry with artistic STAR girl lettering featuring stars and feathers design - Gt31-3 / 95X73 Brushed Fabric
Close-up of heart hand gesture and Just Me artistic lettering on purple wall tapestry - Gt31-4 / 95X73 Brushed Fabric
+204
Modern Cartoon Cat Letter Wall Tapestry Polyester Fabric Hanging Art Decor For Bedroom Living Room Home Aesthetic Decor
-5%
$2.16-7.10
Mix MOQ : 3
Make-Up Beauty Eyelashes Red Lips Wall Sticker Modern PVC Minimalist Face Line Decor For Bedroom Beauty Salon Home
Make-Up Beauty Eyelashes Red Lips Wall Sticker Modern PVC Minimalist Face Line Decor For Bedroom Beauty Salon Home
like
Find Similar
Detailed sheet of makeup wall decals featuring long eyelashes and red lips with size dimensions - Layout Specification (FX-B177)
NewMake-Up Beauty Eyelashes Red Lips Wall Sticker Modern PVC Minimalist Face Line Decor For Bedroom Beauty Salon Home
$1.21
No MOQ
French Quote Family Time Wall Sticker With Clock Roman Numerals Black PVC DIY Removable Home Living Room Wall Decor
French Quote Family Time Wall Sticker With Clock Roman Numerals Black PVC DIY Removable Home Living Room Wall Decor
like
Find Similar
French family quote wall sticker with clock design showing layout and finish sizes - French Quote Clock Style (HM-3393)
French Quote Family Time Wall Sticker With Clock Roman Numerals Black PVC DIY Removable Home Living Room Wall Decor
$1.38
Mix MOQ : 4
Have A Nice Day Wall Sticker Sun Face Smile Nordic Style PVC Removable Vinyl Wall Decals For Bedroom Living Room Home Decor
Have A Nice Day Wall Sticker Sun Face Smile Nordic Style PVC Removable Vinyl Wall Decals For Bedroom Living Room Home Decor
like
Find Similar
6 options
Have A Nice Day Wall Sticker Sun Face Smile Nordic Style PVC Removable Vinyl Wall Decals For Bedroom Living Room Home Decor
-5%
$0.55-1.37
No MOQ
3D Hollow Butterfly Wall Stickers Metallic Paper DIY Removable Wall Decals For Home Wedding Party Decor
3D Hollow Butterfly Wall Stickers Metallic Paper DIY Removable Wall Decals For Home Wedding Party Decor
like
Find Similar
3D hollow rose gold butterfly wall stickers set for home decor and wedding party - Style A / Rose Gold
Set of 11 silver hollow 3D butterfly wall stickers with elegant metallic texture - Style A / Silver
12-piece rose gold 3D hollow butterfly wall stickers for romantic wedding home decoration - Style B / Rose Gold
3D hollow butterfly wall stickers in silver metallic finish for home and wedding decor - Style B / Silver
+16
3D Hollow Butterfly Wall Stickers Metallic Paper DIY Removable Wall Decals For Home Wedding Party Decor
-4%
$0.44
Mix MOQ : 2
 · 
2K+ sold recently
Bohemian White Goose Wall Stickers For Kids Room Nursery Decor PVC Cute Duck Animal Wallpaper Removable DIY Art Decals
Bohemian White Goose Wall Stickers For Kids Room Nursery Decor PVC Cute Duck Animal Wallpaper Removable DIY Art Decals
like
Find Similar
Layout and dimensions of bohemian white goose wall decals set of 12 cartoon animal stickers - 20cm*30cm / Duck Wall Sticker
NewBohemian White Goose Wall Stickers For Kids Room Nursery Decor PVC Cute Duck Animal Wallpaper Removable DIY Art Decals
$1.73
Mix MOQ : 2
Creative Flamingo DIY Wall Stickers PVC Decorative Decals For Kids Bedroom Living Room Home Background Wall Modern Decor
Creative Flamingo DIY Wall Stickers PVC Decorative Decals For Kids Bedroom Living Room Home Background Wall Modern Decor
like
Find Similar
8 options
Creative Flamingo DIY Wall Stickers PVC Decorative Decals For Kids Bedroom Living Room Home Background Wall Modern Decor
$0.92-1.59
No MOQ
Vintage Style Wall Sticker Removable PVC Decal Featuring Retro Clock Suitcase And Globe Pattern For Home Decor Office Bedroom
Vintage Style Wall Sticker Removable PVC Decal Featuring Retro Clock Suitcase And Globe Pattern For Home Decor Office Bedroom
like
Find Similar
Vintage clock and globe PVC wall decals with suitcase art and layout dimensions - 40x40cm / Brown
Vintage Style Wall Sticker Removable PVC Decal Featuring Retro Clock Suitcase And Globe Pattern For Home Decor Office Bedroom
$1.01
Mix MOQ : 3
Birds On Tree Branch Silhouette Wall Stickers Creative Removable PVC Waterproof Mural For Living Room Bedroom Home Decor
Birds On Tree Branch Silhouette Wall Stickers Creative Removable PVC Waterproof Mural For Living Room Bedroom Home Decor
like
Find Similar
2 options
Birds On Tree Branch Silhouette Wall Stickers Creative Removable PVC Waterproof Mural For Living Room Bedroom Home Decor
$1.15
No MOQ
3D Hollow Laser Cut Glitter Butterfly Wall Stickers Romantic Rose Heart Pattern PET Decals For Valentine Wedding Home Decor
3D Hollow Laser Cut Glitter Butterfly Wall Stickers Romantic Rose Heart Pattern PET Decals For Valentine Wedding Home Decor
like
Find Similar
Set of 12 red glitter 3D butterfly wall stickers in three sizes for festive decoration - Red Rose Pattern Style (PJ4011-ZC)
Detailed view of 3D purple glitter butterflies with laser-cut rose hollow patterns - Purple Laser Rose Pattern Style (PJ4010-ZC)
Detailed size guide for red 3D glitter butterfly wall stickers with hollow rose patterns - Red Heart Pattern Style (PJ4012-ZC)
3D Hollow Laser Cut Glitter Butterfly Wall Stickers Romantic Rose Heart Pattern PET Decals For Valentine Wedding Home Decor
$1.01
Mix MOQ : 2
Modern Nordic London Landmark Architecture Wall Stickers PVC Waterproof Self Adhesive Big Ben London Eye Sea Waves Quotes
Modern Nordic London Landmark Architecture Wall Stickers PVC Waterproof Self Adhesive Big Ben London Eye Sea Waves Quotes
like
Find Similar
1 option
Modern Nordic London Landmark Architecture Wall Stickers PVC Waterproof Self Adhesive Big Ben London Eye Sea Waves Quotes
$1.44
No MOQ
Retro Dog Pattern Wall Sticker Self Adhesive PVC Wallpaper For Bedroom Living Room Decorative Removable Wall Decal
Retro Dog Pattern Wall Sticker Self Adhesive PVC Wallpaper For Bedroom Living Room Decorative Removable Wall Decal
like
Find Similar
Detailed dimensions of vintage dog pattern wall sticker showing 103cm by 40cm size - 40*103cm
NewRetro Dog Pattern Wall Sticker Self Adhesive PVC Wallpaper For Bedroom Living Room Decorative Removable Wall Decal
-4%
$1.37
No MOQ
Vintage Wood Grain Round PVC Wall Sticker Oil Painting Style Religious Art Food Desert Animal Self Adhesive Home Decor Decal
Vintage Wood Grain Round PVC Wall Sticker Oil Painting Style Religious Art Food Desert Animal Self Adhesive Home Decor Decal
like
Find Similar
Religious Virgin Mary and Child round wall sticker with wood grain background effect - Virgin Mary & Child (10Y44-D90) / 40x40cm
Self-adhesive round PVC wall sticker featuring rustic food bowls on wood texture, 37.3cm size - Three Bowls Food (10Y44-D91) / 40x40cm
Self-adhesive round wall sticker with camel caravan design in vintage wood grain style - Desert Camel Caravan (10Y44-D92) / 40x40cm
Rural sheep oil painting wall sticker with circular paste effect and 40cm layout size - Farm Three Sheep (10Y44-D93) / 40x40cm
Vintage Wood Grain Round PVC Wall Sticker Oil Painting Style Religious Art Food Desert Animal Self Adhesive Home Decor Decal
$1.01
Mix MOQ : 3
Coffee Time Wall Sticker PVC Waterproof DIY Art Decal For Kitchen Cafe Dining Room Minimalist Home Decor Coffee Bean Pattern
Coffee Time Wall Sticker PVC Waterproof DIY Art Decal For Kitchen Cafe Dining Room Minimalist Home Decor Coffee Bean Pattern
like
Find Similar
2 options
NewCoffee Time Wall Sticker PVC Waterproof DIY Art Decal For Kitchen Cafe Dining Room Minimalist Home Decor Coffee Bean Pattern
-4%
$0.96
No MOQ
Summer Fresh Sunflower PVC Wall Stickers Self Adhesive Floral Bee Butterfly Decals For Living Room Bedroom Wall Decor
Summer Fresh Sunflower PVC Wall Stickers Self Adhesive Floral Bee Butterfly Decals For Living Room Bedroom Wall Decor
like
Find Similar
Self-adhesive sunflower and butterfly PVC wall stickers with 46 decorative decals - 90*30cm / Sunflower Pattern (UV24Y12152T_R)
NewSummer Fresh Sunflower PVC Wall Stickers Self Adhesive Floral Bee Butterfly Decals For Living Room Bedroom Wall Decor
$1.87
Mix MOQ : 2
Labrador Dog With Glasses And Tie Wall Sticker PVC Motivational English Quote Time Is Money Decal For Home Office Decor
Labrador Dog With Glasses And Tie Wall Sticker PVC Motivational English Quote Time Is Money Decal For Home Office Decor
like
Find Similar
Detail view of Labrador wall sticker showing layout and finished dimensions of 38x60cm - 40cmx50cm(HY-F276)
NewLabrador Dog With Glasses And Tie Wall Sticker PVC Motivational English Quote Time Is Money Decal For Home Office Decor
$1.30
No MOQ
Watercolor Dreamy Pink Purple Castle Wall Stickers For Kids Girls Bedroom Nursery DIY PVC Cloud Star Removable Home Decor
Watercolor Dreamy Pink Purple Castle Wall Stickers For Kids Girls Bedroom Nursery DIY PVC Cloud Star Removable Home Decor
like
Find Similar
Detail view of cartoon dream castle wall sticker with sheet and finish size dimensions - 30*90cm*2pcs
Watercolor Dreamy Pink Purple Castle Wall Stickers For Kids Girls Bedroom Nursery DIY PVC Cloud Star Removable Home Decor
$2.02
No MOQ
Cartoon Owl Family Swing Wall Sticker PVC Self Adhesive Black Silhouette Moon Stars Decor For Kids Bedroom Reading Corner
Cartoon Owl Family Swing Wall Sticker PVC Self Adhesive Black Silhouette Moon Stars Decor For Kids Bedroom Reading Corner
like
Find Similar
Black silhouette cartoon owl swing wall sticker with moon and stars layout size specs - Owl Family (KS462) / 42*57cm
NewCartoon Owl Family Swing Wall Sticker PVC Self Adhesive Black Silhouette Moon Stars Decor For Kids Bedroom Reading Corner
$1.30
Mix MOQ : 3
Cartoon Cat Lemon Bicycle Wall Sticker Have A Nice Day PVC Waterproof Removable Decal For Kids Room Living Room Bedroom Decor
Cartoon Cat Lemon Bicycle Wall Sticker Have A Nice Day PVC Waterproof Removable Decal For Kids Room Living Room Bedroom Decor
like
Find Similar
1 option
Cartoon Cat Lemon Bicycle Wall Sticker Have A Nice Day PVC Waterproof Removable Decal For Kids Room Living Room Bedroom Decor
$1.12
No MOQ
Watercolor Cartoon Rabbit Wall Stickers PVC Removable Animal Decals For Kids Nursery Baby Room Bedroom Background Wall Decor
Watercolor Cartoon Rabbit Wall Stickers PVC Removable Animal Decals For Kids Nursery Baby Room Bedroom Background Wall Decor
like
Find Similar
Detailed view of watercolor bunny wall sticker in ballet tutu on cloud with rainbow icons - Ballet Rabbit on Cloud A (TBW9574-UV-A)
Macro view of cute cartoon rabbits in pink umbrella wall sticker set with heart motifs - Two Rabbits with Pink Umbrella (JBW9434)
Detailed watercolor bunny sticker with pink umbrella and heart patterns, 34x31cm size - Dressed Rabbits with Umbrella (TBW9350)
Detail view of watercolor bunny wall sticker with size dimensions 31x33cm for nursery decor - Ballet Rabbit and Stars (TBW9349)
+9
Watercolor Cartoon Rabbit Wall Stickers PVC Removable Animal Decals For Kids Nursery Baby Room Bedroom Background Wall Decor
-4%
$1.75
Mix MOQ : 2
Realistic Wolf King Wall Sticker PVC Decorative Decal For Bedroom Living Room Background Wall DIY Home Decor MG-E018
Realistic Wolf King Wall Sticker PVC Decorative Decal For Bedroom Living Room Background Wall DIY Home Decor MG-E018
like
Find Similar
Detail view showing a 60x40cm sheet with realistic wolf family wall stickers and dimensions - 40x60cm / Realistic Dual Wolves (MG-E018)
Realistic Wolf King Wall Sticker PVC Decorative Decal For Bedroom Living Room Background Wall DIY Home Decor MG-E018
$1.44
No MOQ
Minimalist Hand Drawn Heart Wall Stickers PVC Waterproof Decorative Decals For Living Room Bedroom Office Home Decor
Minimalist Hand Drawn Heart Wall Stickers PVC Waterproof Decorative Decals For Living Room Bedroom Office Home Decor
like
Find Similar
Detail view of heart wall decals showing sheet size and finish size dimensions - 20x29cm Transparent
Minimalist Hand Drawn Heart Wall Stickers PVC Waterproof Decorative Decals For Living Room Bedroom Office Home Decor
$0.81
No MOQ
Dreamcatcher Moon Feather Wall Stickers Removable Blue Gold PVC Decals For Bedroom Living Room Fridge Bathroom Decor
Dreamcatcher Moon Feather Wall Stickers Removable Blue Gold PVC Decals For Bedroom Living Room Fridge Bathroom Decor
like
Find Similar
Blue feather dreamcatcher wall sticker with crescent moon and gold accents layout size - Dreamcatcher Feather (PB1111)
Dreamcatcher Moon Feather Wall Stickers Removable Blue Gold PVC Decals For Bedroom Living Room Fridge Bathroom Decor
$0.98
Mix MOQ : 4
Watercolor Orange Fruit Citrus Green Leaf Wall Sticker Waterproof PVC Self Adhesive Decal For Home Living Room Bedroom Decoration
Watercolor Orange Fruit Citrus Green Leaf Wall Sticker Waterproof PVC Self Adhesive Decal For Home Living Room Bedroom Decoration
like
Find Similar
Detail of hand-painted watercolor orange and leaf wall stickers with dimension markings - 42x57cm
NewWatercolor Orange Fruit Citrus Green Leaf Wall Sticker Waterproof PVC Self Adhesive Decal For Home Living Room Bedroom Decoration
-5%
$1.31
No MOQ
Cartoon Sun Cloud Umbrella PVC Wall Stickers Waterproof Removable Decals For Kids Room Nursery Bathroom Toilet Home Decor
Cartoon Sun Cloud Umbrella PVC Wall Stickers Waterproof Removable Decals For Kids Room Nursery Bathroom Toilet Home Decor
like
Find Similar
1 option
NewCartoon Sun Cloud Umbrella PVC Wall Stickers Waterproof Removable Decals For Kids Room Nursery Bathroom Toilet Home Decor
$1.01
No MOQ
Watercolor Floral Wall Stickers PVC Self Adhesive Flower Birds Butterflies Mural For Living Room Bedroom Bathroom Home Decoration
Watercolor Floral Wall Stickers PVC Self Adhesive Flower Birds Butterflies Mural For Living Room Bedroom Bathroom Home Decoration
like
Find Similar
Self-adhesive floral wall sticker with orange flowers and navy leaves, 40x30cm sheet size - 30*40cm
Detail view of bird and leaf wall sticker with 30x60cm dimensions and self-adhesive PVC - Bird and Hanging Branch Style (M20601) / 30*60cm
Detailed dimension guide for watercolor floral PVC wall decals measuring 40x30cm - 30*40cm
Detail showing dimensions of watercolor red rose wall stickers with colorful butterflies - Red Rose and Butterfly Style (M20614) / 30*40cm
+5
Watercolor Floral Wall Stickers PVC Self Adhesive Flower Birds Butterflies Mural For Living Room Bedroom Bathroom Home Decoration
$0.95-1.18
Mix MOQ : 2
Watercolor World Landmarks Wall Stickers Colorful Splash Architecture PVC Removable Decals Artistic Skyline Home Office Decor
Watercolor World Landmarks Wall Stickers Colorful Splash Architecture PVC Removable Decals Artistic Skyline Home Office Decor
like
Find Similar
Macro detail of watercolor wall sticker showing world landmarks like Eiffel Tower and Statue of Liberty - 45*60cm*2pcs
Watercolor World Landmarks Wall Stickers Colorful Splash Architecture PVC Removable Decals Artistic Skyline Home Office Decor
-4%
$1.92
No MOQ
Watercolor Two Tigers Wall Sticker PVC Self Adhesive Removable Decal For Living Room Bedroom Bathroom Nursery Home Decor
Watercolor Two Tigers Wall Sticker PVC Self Adhesive Removable Decal For Living Room Bedroom Bathroom Nursery Home Decor
like
Find Similar
Tiger wall decals for bedroom with paste effect and layout size measurements - Two Tigers (SC278) / 30x30
Watercolor Two Tigers Wall Sticker PVC Self Adhesive Removable Decal For Living Room Bedroom Bathroom Nursery Home Decor
$0.92
Mix MOQ : 4
Vintage Daisy Floral Wall Stickers Waterproof PVC Self-Adhesive Wall Decals For Living Room Bathroom Home Decor
Vintage Daisy Floral Wall Stickers Waterproof PVC Self-Adhesive Wall Decals For Living Room Bathroom Home Decor
like
Find Similar
8-color daisy flower wall decals set with dimension markings for home decor - Colorful Large Daisy (CT20874T_T) / 91cm*71cm
Daisy wall stickers set with 16 pieces in 8 colors on 36x23cm sheets for decor - Morandi Flower (CT20875T_T) / 91cm*71cm
8-color set of purple and pink vintage daisy PVC wall stickers with 16 flower pieces - Purple Pink Simple Flower (CT20876T_T) / 91cm*71cm
Daisy wall stickers set in 8 colors for home decor waterproof PVC floral decals - White Yellow Daisy (CT20873T_T) / 91cm*71cm
+4
Vintage Daisy Floral Wall Stickers Waterproof PVC Self-Adhesive Wall Decals For Living Room Bathroom Home Decor
$3.62-6.92
No MOQ
UV DTF Rub On Transfer Sticker For Glass Cups Waterproof Floral Heart Coffee Pattern Decorative Decal For Mother's Day Gift
UV DTF Rub On Transfer Sticker For Glass Cups Waterproof Floral Heart Coffee Pattern Decorative Decal For Mother's Day Gift
like
Find Similar
Close-up of clear 16oz glass can with pink concha heart pattern, bamboo lid and glass straw - Pink Heart Concha Style (QT742-2)
Detail of coffee themed UV DTF transfer on glass cup with bamboo lid and straw - Coffee Theme Badge And Illustration Style (QT742-3)
Detail of 16oz glass can cup with Coffee and Sarcasm text, bamboo lid and glass straw - Colorful Cartoon Coffee Cups Wrap Style (QT742-4)
Detail of 16oz can glass with bamboo lid and I Love You A Latte coffee theme decal - I Love You A Latte Coffee Cup Style (QT742-5)
UV DTF Rub On Transfer Sticker For Glass Cups Waterproof Floral Heart Coffee Pattern Decorative Decal For Mother's Day Gift
$0.72
Mix MOQ : 2
 · 
10 sold recently
Free Shipping
Watercolor Eiffel Tower Pink Bicycle Wall Stickers PVC Self-Adhesive Parisian Theme Decor For Living Room Bedroom Hallway
Watercolor Eiffel Tower Pink Bicycle Wall Stickers PVC Self-Adhesive Parisian Theme Decor For Living Room Bedroom Hallway
like
Find Similar
Detailed sheet size 40x60cm and finish size 37x54cm for Eiffel Tower wall decals - Eiffel Tower Bicycle Style
Watercolor Eiffel Tower Pink Bicycle Wall Stickers PVC Self-Adhesive Parisian Theme Decor For Living Room Bedroom Hallway
$1.59
No MOQ
Coffee Time Cup Coffee Beans Heart Wall Sticker PVC Waterproof Removable DIY Mural Art Decal For Kitchen Cafe Home Decor
Coffee Time Cup Coffee Beans Heart Wall Sticker PVC Waterproof Removable DIY Mural Art Decal For Kitchen Cafe Home Decor
like
Find Similar
Detailed wall sticker layout showing coffee cup and beans dimensions 30x39cm - 30x39cm (fun-f415)
Coffee Time Cup Coffee Beans Heart Wall Sticker PVC Waterproof Removable DIY Mural Art Decal For Kitchen Cafe Home Decor
$1.01
No MOQ
Creative Cartoon Peeking Dog Switch Sticker PVC Removable Heart Puppy Wall Decal For Light Switch Socket Home Decor
Creative Cartoon Peeking Dog Switch Sticker PVC Removable Heart Puppy Wall Decal For Light Switch Socket Home Decor
like
Find Similar
Cartoon dog wall sticker dimensions and paste effect for home decor in two sizes - HM03122 / 10*13cm
Creative Cartoon Peeking Dog Switch Sticker PVC Removable Heart Puppy Wall Decal For Light Switch Socket Home Decor
$0.35
Mix MOQ : 5
But First Coffee Wall Sticker Self Adhesive PVC Kitchen Art Decal Removable Heart Beans Decor For Cafe Home Office
But First Coffee Wall Sticker Self Adhesive PVC Kitchen Art Decal Removable Heart Beans Decor For Cafe Home Office
like
Find Similar
Detail view of Coffee wall sticker with cups and text, measuring 30x40cm size - 30x40cm (FX-F488)
NewBut First Coffee Wall Sticker Self Adhesive PVC Kitchen Art Decal Removable Heart Beans Decor For Cafe Home Office
$0.92
No MOQ
Removable PVC Wall Sticker Minimalist Black Line Art Couple Keep Early Hours Quote Decal For Bedroom Dormitory Home Decor
Removable PVC Wall Sticker Minimalist Black Line Art Couple Keep Early Hours Quote Decal For Bedroom Dormitory Home Decor
like
Find Similar
1 option
Removable PVC Wall Sticker Minimalist Black Line Art Couple Keep Early Hours Quote Decal For Bedroom Dormitory Home Decor
$1.44
No MOQ
Go to

More in home & kitchen

Explore more in wall clocks, wall clocks, wall sticker clocks

wallplasticmetalkidsstyleglass mirrorsimplesteelgoldtree
roundliving room bedroomframe glasscoverdesigndisplayhandsplatedsquarepvc wall sticker

Ready to source like an insider

Get a direct line to the factory floor — no minimums, no middlemen, no guesswork.
iconReal factory pricing, no markup in betweeniconEvery order hand-inspected before it shipsicon5,000+ new products added daily
Get Inside Access