Everful

Wholesale usb led lights

Factory-direct selection, vetted for quality and ready to order.

Sign Up
USB LED Lights

Find the perfect pieces: seasonal decorative candles, seasonal string lights, holiday wreaths & garlands and more

All products in usb led lights

filterShow Filters
Best Seller
New Arrivals
Price Drop
Free Shipping
Christmas LED Candle Holder Hollow Glass Ornament Warm Light Desktop Decorative Lamp For Holiday Home Party Atmosphere
Christmas LED Candle Holder Hollow Glass Ornament Warm Light Desktop Decorative Lamp For Holiday Home Party Atmosphere
like
Find Similar
Black cone Christmas tree lamp with golden forest deer cutout and festive lights - Black Cone
Black reindeer hollow-out Christmas tea light candle holder with snowflake patterns - Black Candle
Black Christmas lantern with gold reindeer patterns and 15cm height decoration - Black Cup
Christmas LED Candle Holder Hollow Glass Ornament Warm Light Desktop Decorative Lamp For Holiday Home Party Atmosphere
$8.07-16.71
No MOQ
 · 
15 views
Free Shipping
Christmas Luminous Resin House Miniatures LED Warm Light Desktop Ornaments Santa Claus Snowman Micro Landscape Decor
Christmas Luminous Resin House Miniatures LED Warm Light Desktop Ornaments Santa Claus Snowman Micro Landscape Decor
like
Find Similar
Lighted Christmas gingerbread house with Santa figurine and warm LED glow for table decor - Santa Claus with Bell Snow House
Lighted Christmas cottage with Santa Claus and snow-covered trees for holiday decor - Santa Claus with Gift Bag Snow House
LED lit miniature snow covered church with Santa Claus resin Christmas decoration - Santa Claus with Church Cottage
Luminous resin Christmas snowman and castle miniature landscape with warm LED lights - Snowman with Colorful Tower
Christmas Luminous Resin House Miniatures LED Warm Light Desktop Ornaments Santa Claus Snowman Micro Landscape Decor
-4%
$2.33
No MOQ
Christmas Telephone Booth Lantern LED Lighted Tabletop Decoration Santa Snowman Tree Figurine Retro Festive Ornament
Christmas Telephone Booth Lantern LED Lighted Tabletop Decoration Santa Snowman Tree Figurine Retro Festive Ornament
like
Find Similar
Christmas lantern shaped like a red telephone booth with a snowman and gift box inside - Red Phone Booth Snowman
Vintage red Christmas telephone booth lantern with miniature tree and LED lights - Red Phone Booth Christmas Tree
Red Christmas telephone booth snow globe with Santa Claus and LED glowing light - Red Phone Booth Santa Claus
Vintage bronze Christmas lantern with Santa Claus and tree, glowing warm holiday ornament - Bronze Brushed Santa Claus
+2
Christmas Telephone Booth Lantern LED Lighted Tabletop Decoration Santa Snowman Tree Figurine Retro Festive Ornament
-4%
$2.88
No MOQ
Christmas Music Box Snow House LED Light Rotating Village Scene Resin Desktop Decoration European Holiday Ornament
Christmas Music Box Snow House LED Light Rotating Village Scene Resin Desktop Decoration European Holiday Ornament
like
Find Similar
Christmas village snow house with LED lights and moving train scene decoration - Music Dual-Rotation Snow House (YL-21759)
Christmas Music Box Snow House LED Light Rotating Village Scene Resin Desktop Decoration European Holiday Ornament
-5%
$43.80
Mix MOQ : 2
Retro Red Christmas Lantern Snow Globe With Music LED Light Santa Claus Reindeer Gingerbread House Desktop Festive Decoration
Retro Red Christmas Lantern Snow Globe With Music LED Light Santa Claus Reindeer Gingerbread House Desktop Festive Decoration
like
Find Similar
Red vintage Christmas lantern snow globe with Santa Claus, tree and gifts inside - Santa Claus
Retro Red Christmas Lantern Snow Globe With Music LED Light Santa Claus Reindeer Gingerbread House Desktop Festive Decoration
-4%
$5.48
No MOQ
Christmas LED Lantern Glowing Decorative Hanging Wind Lamp Plastic Retro Star Cutout Santa Snowman Reindeer Ornament Home
Christmas LED Lantern Glowing Decorative Hanging Wind Lamp Plastic Retro Star Cutout Santa Snowman Reindeer Ornament Home
like
Find Similar
Detail of red Christmas LED lantern with Santa silhouette and warm glowing light - Santa Claus (Red)
Close-up of white LED Christmas lantern with snowman print on a wooden stand - Snowman (White)
Close-up of vintage bronze Christmas lantern with warm LED light and reindeer forest motif - Reindeer (Bronze)
Christmas LED Lantern Glowing Decorative Hanging Wind Lamp Plastic Retro Star Cutout Santa Snowman Reindeer Ornament Home
-5%
$1.31
No MOQ
LED Light Up Christmas Wooden House Hanging Ornaments Warm Glow Wood Carved Santa Snowman Reindeer Patterns Festive Decor
LED Light Up Christmas Wooden House Hanging Ornaments Warm Glow Wood Carved Santa Snowman Reindeer Patterns Festive Decor
like
Find Similar
Wooden Christmas house ornament with snowman and golden XMAS glitter text - Glitter Wood House LED Light Snowman
LED Light Up Christmas Wooden House Hanging Ornaments Warm Glow Wood Carved Santa Snowman Reindeer Patterns Festive Decor
$2.31
No MOQ
Electric Santa Claus DJ Music Doll Drumming Toy With Lights And Sound Christmas Ornament Desktop Decoration For Kids Gift
Electric Santa Claus DJ Music Doll Drumming Toy With Lights And Sound Christmas Ornament Desktop Decoration For Kids Gift
like
Find Similar
2 options
Electric Santa Claus DJ Music Doll Drumming Toy With Lights And Sound Christmas Ornament Desktop Decoration For Kids Gift
-5%
$8.21
Mix MOQ : 2
Christmas Snow Globe Lantern LED Light Plastic Acrylic Glitter Gift Box Shape Santa Claus Snowman Holiday Desktop Decor
Christmas Snow Globe Lantern LED Light Plastic Acrylic Glitter Gift Box Shape Santa Claus Snowman Holiday Desktop Decor
like
Find Similar
Detailed view of Santa Claus and Christmas tree inside a red glowing gift box lantern - Santa Claus
Macro view of luminous Christmas snow globe with snowman and sparkling glitter inside - Snowman
Detail of Christmas gift box water globe with glowing interior and festive tree - Christmas Tree
Detail of warm LED Christmas snowball lamp in red gift box shape with glitter - Little Boy Style
Christmas Snow Globe Lantern LED Light Plastic Acrylic Glitter Gift Box Shape Santa Claus Snowman Holiday Desktop Decor
$5.19
No MOQ
Wooden Christmas Tree LED Glowing Ornament Hollow Out Xmas Santa Snowman Reindeer Desktop Decor Holiday Atmosphere
Wooden Christmas Tree LED Glowing Ornament Hollow Out Xmas Santa Snowman Reindeer Desktop Decor Holiday Atmosphere
like
Find Similar
29cm Pyramid wooden Christmas tree ornament with laser-cut Merry Christmas carvings - Original Wood Pyramid Style (WTH-281Y)
Luminous wooden Christmas tree with Santa Claus and LED warm light XMAS ornament - Santa Claus Wooden Tree Style (XY17-72764)
Luminous wooden snowman and Christmas tree tabletop ornament with warm LED light - Snowman Wooden Tree Style (XY17-72764)
Wooden Christmas Tree LED Glowing Ornament Hollow Out Xmas Santa Snowman Reindeer Desktop Decor Holiday Atmosphere
$2.85
Mix MOQ : 2
Christmas Train LED Candle Light Desktop Decoration Santa Reindeer PVC Retro Holiday Festive Ornament
Christmas Train LED Candle Light Desktop Decoration Santa Reindeer PVC Retro Holiday Festive Ornament
like
Find Similar
Detail of red Christmas train lantern with warm light and Santa Claus silhouette - Red
Macro shot of white Christmas train lantern with reindeer scene and warm LED light - White
Christmas Train LED Candle Light Desktop Decoration Santa Reindeer PVC Retro Holiday Festive Ornament
$1.38
No MOQ
Christmas Wooden Advent Calendar With LED Lights Drawers Reindeer Forest House Shape Festive Countdown Decoration Gift Home
Christmas Wooden Advent Calendar With LED Lights Drawers Reindeer Forest House Shape Festive Countdown Decoration Gift Home
like
Find Similar
Wooden Christmas advent calendar house with 24 drawers and LED warm forest light scene - White House Shape (YG-1567)
Christmas Wooden Advent Calendar With LED Lights Drawers Reindeer Forest House Shape Festive Countdown Decoration Gift Home
$18.73
Mix MOQ : 50
Vintage Christmas Lantern Snow Globe Glitter Water Lamp Battery Operated LED Lighted Santa Snowman Cardinal Holiday Decor
Vintage Christmas Lantern Snow Globe Glitter Water Lamp Battery Operated LED Lighted Santa Snowman Cardinal Holiday Decor
like
Find Similar
Bronze Christmas lantern snow globe with Santa Claus and sparkling glitter effect - Santa Claus
Vintage bronze Christmas lantern music box with snowman scene and swirling glitter - Snowman
Vintage bronze Christmas lantern with cardinal birds and glittering snow music box effect - Red Bird Cardinal
Vintage Christmas Lantern Snow Globe Glitter Water Lamp Battery Operated LED Lighted Santa Snowman Cardinal Holiday Decor
$14.27
Mix MOQ : 2
 · 
10 views
Christmas Hanging Wooden House Ornament With LED Light Glow XMAS Decoration For Tree Tabletop Nordic Style Festive
Christmas Hanging Wooden House Ornament With LED Light Glow XMAS Decoration For Tree Tabletop Nordic Style Festive
like
Find Similar
Christmas wooden house ornament with purple LED light and carved angel pattern - Style A / LED Angel
LED wooden house Christmas tree ornament with snowman design and blue glow, 7x5x8cm - Style B / LED Snowman
Luminous Christmas wooden house ornament with red LED, Santa design and XMAS carving - Style C / LED Santa & Reindeer
Christmas Hanging Wooden House Ornament With LED Light Glow XMAS Decoration For Tree Tabletop Nordic Style Festive
-5%
$2.41
No MOQ
Glowing Santa Claus Snowman Crystal Ball Resin Desktop Decoration For Christmas Holiday Home Decor Children Gift
Glowing Santa Claus Snowman Crystal Ball Resin Desktop Decoration For Christmas Holiday Home Decor Children Gift
like
Find Similar
Mini glowing Christmas crystal ball set with Santa, Snowman and Reindeer on wood - Single Piece / Christmas Fun Style
Charming snowmen Christmas crystal balls set on snow wood base for festive decor - Single Piece / Christmas Smiley
Luminous Christmas crystal balls with Santa and Snowman in a festive snow scene - Single Piece / Santa Claus Hat Pattern
Miniature Santa Claus snow globe set with festive red resin base and golden accents - Single Piece / Christmas Deer
+1
Glowing Santa Claus Snowman Crystal Ball Resin Desktop Decoration For Christmas Holiday Home Decor Children Gift
$1.67-19.88
No MOQ
Christmas LED Glowing Brooch Pins Santa Claus Snowman Reindeer Bear Plush Fabric Festive Party Favor Holiday Gift Accessory
Christmas LED Glowing Brooch Pins Santa Claus Snowman Reindeer Bear Plush Fabric Festive Party Favor Holiday Gift Accessory
like
Find Similar
Christmas reindeer plush glowing brooch with white antlers and a red pom-pom nose - Red Glowing Reindeer
Luminous Santa Claus brooch made of soft felt with white snowflake patterns on red hat - Red Glowing Santa
Cute plush snowman Christmas brooch with red hat and striped bow for holiday gifts - Red Glowing Snowman
Plush Christmas bear in blue plaid scarf and hat sitting on a festive red display box - Colorful Glowing Bear
+4
Christmas LED Glowing Brooch Pins Santa Claus Snowman Reindeer Bear Plush Fabric Festive Party Favor Holiday Gift Accessory
-5%
$0.47-0.52
No MOQ
 · 
11 views
Christmas Tree Topper LED Luminous Star Reindeer Iron Glitter Ornament Holiday Party Home Decoration Warm Light
Christmas Tree Topper LED Luminous Star Reindeer Iron Glitter Ornament Holiday Party Home Decoration Warm Light
like
Find Similar
Luminous golden iron Christmas tree topper with LED lights and glittery metal wire finish - 25CM Gold Straight Line Glitter Star
Silver mesh Christmas tree topper star with warm LED lights and a spiral base - 25CM Silver Straight Line Glitter Star
Golden hollow Christmas tree topper star with internal LED lights and glitter finish - 20CM Gold 18-Pointed Star
Lighted silver glitter Christmas tree star topper with LED lights for festive decor - 20CM Silver 18-Pointed Star
+9
Christmas Tree Topper LED Luminous Star Reindeer Iron Glitter Ornament Holiday Party Home Decoration Warm Light
$4.03-7.49
No MOQ
Artificial Christmas Tree With LED Light String Ornaments Tree Skirt Encrypted PE PVC Leaves Nordic Luxury Indoor Holiday Home Decor
Artificial Christmas Tree With LED Light String Ornaments Tree Skirt Encrypted PE PVC Leaves Nordic Luxury Indoor Holiday Home Decor
like
Find Similar
Lush 1.5m PE Christmas tree set with 42 festive ornaments and cozy white plush skirt - 1.5m (42pcs Accessories) / White Wood Color
2.1m deluxe artificial Christmas tree set with 94 accessories and warm LED lights - 2.1m (94pcs Accessories) / White Wood Color
Luxury 1.5m PE artificial Christmas tree set with 40 red and white ornaments and lights - 1.5m (40pcs Accessories) / Red & White
1.8m Christmas tree with red and white ornaments, 58-piece set and plush tree skirt - 1.8m (58pcs Accessories) / Red & White
+17
Artificial Christmas Tree With LED Light String Ornaments Tree Skirt Encrypted PE PVC Leaves Nordic Luxury Indoor Holiday Home Decor
-5%
$160.98-300.61
No MOQ
Vintage Christmas Snow Globe Lantern LED Lighted Musical Spinning Glitter Water Filled Bronze Retro Desktop Ornament Decor
Vintage Christmas Snow Globe Lantern LED Lighted Musical Spinning Glitter Water Filled Bronze Retro Desktop Ornament Decor
like
Find Similar
Vintage bronze Christmas lantern featuring snowmen and LED light with swirling glitter - Snowman
Vintage bronze Christmas lantern with lighted Santa scene and shimmering glitter effect - Santa Claus
Vintage bronze Christmas lantern with Santa scene, LED lights and swirling glitter - Christmas Tree
Bronze vintage Christmas lantern with Santa Claus sleigh and glittery snow globe - Reindeer and Sleigh
Vintage Christmas Snow Globe Lantern LED Lighted Musical Spinning Glitter Water Filled Bronze Retro Desktop Ornament Decor
-4%
$16.43
Mix MOQ : 2
 · 
14 views
Christmas Wooden Luminous House Ornament LED Glowing Tabletop Decor Santa Snowman Reindeer Patterns Star Cutout Roof Festive Gift
Christmas Wooden Luminous House Ornament LED Glowing Tabletop Decor Santa Snowman Reindeer Patterns Star Cutout Roof Festive Gift
like
Find Similar
Green wooden Christmas house ornament with Snow text and warm glowing LED light - Santa & Snowman With Letters - Green
DIY wooden Christmas house ornament in forest green with warm LED light and Santa carving - Santa With Gift & Deer - Green
Christmas wooden glowing house with snowman and Let It Snow text decor - Snowman Style - Natural Wood & Red
DIY Christmas wooden house with reindeer design and glowing warm interior lights - Reindeer Style - Natural Wood & Red
Christmas Wooden Luminous House Ornament LED Glowing Tabletop Decor Santa Snowman Reindeer Patterns Star Cutout Roof Festive Gift
-4%
$1.78
No MOQ
Christmas Luminous Music Village House Resin Miniature LED Light Up Desktop Ornament Festive Xmas Decoration Gift
Christmas Luminous Music Village House Resin Miniature LED Light Up Desktop Ornament Festive Xmas Decoration Gift
like
Find Similar
Lighted Christmas toy store miniature with nutcracker guards and snow-covered roof - Toy Store
Christmas Luminous Music Village House Resin Miniature LED Light Up Desktop Ornament Festive Xmas Decoration Gift
$12.25
Mix MOQ : 2
Christmas Miniature Village Toy Shop And Greenhouse Resin LED Light Up Snow Scene Desktop Holiday Decoration Gift
Christmas Miniature Village Toy Shop And Greenhouse Resin LED Light Up Snow Scene Desktop Holiday Decoration Gift
like
Find Similar
Luminous resin Christmas greenhouse cottage with warm LED lights and snow detail - Christmas Greenhouse (ABCZ99-4) / AAA Battery Required
Lighted resin Christmas toy shop miniature with Santa and snow base, 16.5x11.5x15cm - Christmas Toy Shop Music Box (ABCZ99-3) / AAA Battery Required
Christmas Miniature Village Toy Shop And Greenhouse Resin LED Light Up Snow Scene Desktop Holiday Decoration Gift
$28.53-32.54
No MOQ
Free Shipping
Christmas Snow Globe Lantern Vintage Bronze Music Box Led Light Swirling Glitter Holiday Desktop Ornament
Christmas Snow Globe Lantern Vintage Bronze Music Box Led Light Swirling Glitter Holiday Desktop Ornament
like
Find Similar
Bronze Christmas lantern snow globe with Santa Claus and cedar tree LED light decoration - Retro Gold Santa Claus
Vintage Christmas lantern music box with snowman scene and warm glowing LED light - Antique Gold Snowman
Vintage bronze Christmas lantern with Santa and tree inside glowing in warm light - Vintage Gold Christmas Tree
Vintage bronze Christmas lantern with Santa's sleigh scene and warm LED lighting - Santa Claus on Sleigh with Reindeer
+1
Christmas Snow Globe Lantern Vintage Bronze Music Box Led Light Swirling Glitter Holiday Desktop Ornament
$20.17
Mix MOQ : 2
Christmas Snow Globe Lamp Handbag Shape LED Holiday Desktop Decoration Plastic Water Ball Santa Snowman Elk Sequins Glow
Christmas Snow Globe Lamp Handbag Shape LED Holiday Desktop Decoration Plastic Water Ball Santa Snowman Elk Sequins Glow
like
Find Similar
Green polka dot Christmas gift bag water globe with snowman and silver snowflakes - Small Gift Bag / Green - Snowman with Broom
Christmas water globe lantern in red handbag shape with Santa Claus and snowflakes - Small Gift Bag / Red - Santa and Tree
Christmas gift bag water globe with red polka dots and miniature festive car scene - Small Gift Bag / Red - Car and Tree
Christmas water globe lamp in red handbag shape with boy and tree scene and floating snow - Small Gift Bag / Red - Child and Tree
+2
Christmas Snow Globe Lamp Handbag Shape LED Holiday Desktop Decoration Plastic Water Ball Santa Snowman Elk Sequins Glow
-4%
$2.74
Mix MOQ : 2
Christmas Lantern LED Light Ornament PVC Retro Telephone Booth Desktop Holiday Decor Snowman Santa
Christmas Lantern LED Light Ornament PVC Retro Telephone Booth Desktop Holiday Decor Snowman Santa
like
Find Similar
Red vintage telephone booth Christmas lantern with Santa Claus and warm LED light - Santa Claus Telephone Booth Style
Vintage bronze Christmas lantern featuring Santa Claus and tree with warm glowing light - Santa Claus Wind Lamp Style
Vintage bronze Christmas lantern featuring a snowman scene and warm LED lights - Christmas Snowman Wind Lamp Style
Bronze Christmas lantern with miniature tree and LED lights on wooden surface - Christmas Tree Wind Lamp Style
+3
Christmas Lantern LED Light Ornament PVC Retro Telephone Booth Desktop Holiday Decor Snowman Santa
$2.02-2.88
No MOQ
Christmas LED Candle Bridge Arch Light Musical Snow Globe Ornament Vintage Bronze Resin Plastic Desktop Decor Santa Scene
Christmas LED Candle Bridge Arch Light Musical Snow Globe Ornament Vintage Bronze Resin Plastic Desktop Decor Santa Scene
like
Find Similar
Close-up of the vintage bronze 7-LED candle bridge with festive snow scene and warm lights - Santa Giving Gifts
Detail of vintage Christmas water lantern with seven LED candles and snow scene - Boy and Christmas Tree
Close-up of 7 warm LED candles and Santa sleigh scene inside a bronze music box lantern - House with Flying Reindeer
Christmas LED Candle Bridge Arch Light Musical Snow Globe Ornament Vintage Bronze Resin Plastic Desktop Decor Santa Scene
$28.24
No MOQ
Christmas Hanging Ornament Wooden LED Light Up Hollow Reindeer Forest Design Battery Operated Holiday Tree Decoration
Christmas Hanging Ornament Wooden LED Light Up Hollow Reindeer Forest Design Battery Operated Holiday Tree Decoration
like
Find Similar
Lighted wooden reindeer ornament with laser-cut forest landscape and silver glitter accents - Style D (Forest Reindeer Silhouette)
Lighted wooden reindeer ornament with glitter snowflakes and rustic beads for Christmas decor - Style E (Glitter Snowflake Reindeer)
Lighted wooden Christmas ornament featuring deer and snowy pine forest with beads - Style F (Snow Mountain & Fir Tree)
Lighted wooden Christmas ornament featuring deer in silver pine forest with warm glow - Style A (Double Reindeer & Moon)
+2
Christmas Hanging Ornament Wooden LED Light Up Hollow Reindeer Forest Design Battery Operated Holiday Tree Decoration
-4%
$2.03
Mix MOQ : 2
 · 
17 views
Christmas Pickup Truck Music Box Ornament With LED Light And Snow Globe Santa Claus For Desktop Festive Decor
Christmas Pickup Truck Music Box Ornament With LED Light And Snow Globe Santa Claus For Desktop Festive Decor
like
Find Similar
Vintage red Christmas truck music box featuring Santa Claus and a snowy dog inside a globe - Bear Truck
Vintage red Christmas truck music box with Santa snow globe and elves on green stool - Elf Truck
Christmas Pickup Truck Music Box Ornament With LED Light And Snow Globe Santa Claus For Desktop Festive Decor
-4%
$44.63
Mix MOQ : 6
Christmas Music Box LED Glowing Gift Box Ornament Plastic Santa Claus Snowman Desktop Decoration Holiday Festive Home Decor
Christmas Music Box LED Glowing Gift Box Ornament Plastic Santa Claus Snowman Desktop Decoration Holiday Festive Home Decor
like
Find Similar
Close-up of a glowing Christmas gift box ornament with Santa and warm LED lighting - Red Santa Claus Music Box
Close-up of glowing Christmas gift box with snowman, trees and colorful LED lighting - Green Snowman Music Box
Christmas Music Box LED Glowing Gift Box Ornament Plastic Santa Claus Snowman Desktop Decoration Holiday Festive Home Decor
$25.36
No MOQ
Vintage Gramophone Christmas Snow Globe Music Box LED Light Swirling Glitter PVC Resin Ornament Festival Home Decor
Vintage Gramophone Christmas Snow Globe Music Box LED Light Swirling Glitter PVC Resin Ornament Festival Home Decor
like
Find Similar
Vintage phonograph Christmas music box snow globe with festive Santa and LED lights - Vintage Gramophone House Santa
Vintage phonograph Christmas snow globe with Santa Claus and warm glowing LED lights - Vintage Gramophone House Tree
Vintage Gramophone Christmas Snow Globe Music Box LED Light Swirling Glitter PVC Resin Ornament Festival Home Decor
$20.17
Mix MOQ : 2
Christmas Snow Globe Music Box With LED Light Resin Glass Desktop Ornament Xmas Decoration Festive Holiday Gift
Christmas Snow Globe Music Box With LED Light Resin Glass Desktop Ornament Xmas Decoration Festive Holiday Gift
like
Find Similar
Set of 4 glowing Christmas snow globes with Santa and snowman on red gift box background - 65# Light Model / Santa Head Base - Large
Set of four Santa Claus crystal snow globes with glowing LED lights for Christmas decor - 45# Light Model / 86 Santa with Xmas Hat
Set of four Christmas glowing crystal balls with Santa, Snowman, and Reindeer figurines - 45# Light Model / 87 Christmas Chimney
Luminous Santa Claus and snowman crystal ball ornaments on red sleigh base - 45# Light Model / 88 Christmas Sleigh
+30
Christmas Snow Globe Music Box With LED Light Resin Glass Desktop Ornament Xmas Decoration Festive Holiday Gift
$1.86-7.01
Mix MOQ : 2
Christmas Snowman Resin Figurine LED Glowing Desktop Ornament Winter Holiday Decoration Cartoon Cute Gift
Christmas Snowman Resin Figurine LED Glowing Desktop Ornament Winter Holiday Decoration Cartoon Cute Gift
like
Find Similar
Christmas snowman resin figurine wearing a red and blue knitted scarf and black hat - Male Snowman
Cute female snowman Christmas ornament with red hat, green scarf, and resin knit texture - Female Snowman
Christmas Snowman Resin Figurine LED Glowing Desktop Ornament Winter Holiday Decoration Cartoon Cute Gift
-4%
$3.03
No MOQ
Christmas Wooden House Hanging Ornament LED Light Up Glowing Wood Cabin Xmas Tree Decor Hollow Out Santa Deer Pattern
Christmas Wooden House Hanging Ornament LED Light Up Glowing Wood Cabin Xmas Tree Decor Hollow Out Santa Deer Pattern
like
Find Similar
Lighted wooden house Christmas ornament with deer carving and warm LED glow - Mini Elk Head
Lighted wooden Christmas cabin ornament with reindeer cutout and warm LED glow - Mini Elk
Luminous Christmas wooden house with snowman cutout and warm LED light hanging ornament - Mini Snowman
Lighted wooden cabin Christmas tree ornament with 7cm height and reindeer engraving - Mini Snowflake
Christmas Wooden House Hanging Ornament LED Light Up Glowing Wood Cabin Xmas Tree Decor Hollow Out Santa Deer Pattern
$3.69
No MOQ
Free Shipping
Christmas Snow Globe Lantern Vintage LED Night Light Floating Glitter Festive Desktop Decoration Santa Snowman Style
Christmas Snow Globe Lantern Vintage LED Night Light Floating Glitter Festive Desktop Decoration Santa Snowman Style
like
Find Similar
Close-up of bronze vintage Christmas lantern with Santa Claus and sparkling snow scenery - Santa Claus
Detail of vintage bronze Christmas lantern with snowman and swirling glitter in snow scene - Snowman
Detail of Santa Claus snow globe lantern with bronze finish and sparkling glitter effect - Christmas Tree
Close-up of vintage bronze Christmas lantern with Santa scene and golden glitter snow - Boy Style
Christmas Snow Globe Lantern Vintage LED Night Light Floating Glitter Festive Desktop Decoration Santa Snowman Style
$4.32
No MOQ
Christmas Snow Globe House Lantern LED Night Light Swirling Glitter Santa Nutcracker Festive Desktop Ornament Home Decoration
Christmas Snow Globe House Lantern LED Night Light Swirling Glitter Santa Nutcracker Festive Desktop Ornament Home Decoration
like
Find Similar
Detail of Nutcracker and ballerina inside a glowing Christmas house lantern lamp - Nutcracker Style
Detail of a white European style Santa cottage lamp with red roof and glowing warm light - Santa Claus
Close-up of lighted Christmas house decoration with Santa Claus and sparkling glitters - Religious Scene Style
Christmas Snow Globe House Lantern LED Night Light Swirling Glitter Santa Nutcracker Festive Desktop Ornament Home Decoration
-5%
$8.21
Mix MOQ : 2
Christmas LED Electronic Candle Light Santa Snowman Shape Plastic Flameless Warm Night Light Desktop Holiday Decoration
Christmas LED Electronic Candle Light Santa Snowman Shape Plastic Flameless Warm Night Light Desktop Holiday Decoration
like
Find Similar
LED Christmas candle lamp featuring Santa Claus wooden cutout with warm glowing base - Santa Claus
Christmas tree LED candle lamp with warm yellow base and festive snowflake pattern - Christmas Tree
Snowman LED tea light candle with red scarf and starry hat, warm yellow glow, 8.5cm height - Snowman
Christmas LED candle light with bell wooden ornament and snowflake cutout design - Bell
+9
Christmas LED Electronic Candle Light Santa Snowman Shape Plastic Flameless Warm Night Light Desktop Holiday Decoration
-4%
$0.47-5.44
No MOQ
Christmas Luminous Brooch Plush Cloth Santa Snowman Reindeer Bear LED Glowing Pin Festive Party Accessories For Kids
Christmas Luminous Brooch Plush Cloth Santa Snowman Reindeer Bear LED Glowing Pin Festive Party Accessories For Kids
like
Find Similar
Cute snowman glowing brooch made of soft felt fabric for Christmas party decorations - Glowing Snowman Style
Handmade felt Santa Claus brooch with glowing light for Christmas gifts and DIY decor - Glowing Santa Style
Luminous plush reindeer Christmas brooch with red antlers and glowing LED facial lights - Luminous Reindeer with Hands
Luminous plush bear Christmas brooch with blue knit hat and scarf on wooden desk - Luminous Bear with Hands
+4
Christmas Luminous Brooch Plush Cloth Santa Snowman Reindeer Bear LED Glowing Pin Festive Party Accessories For Kids
-14%
$0.42-0.47
Mix MOQ : 2
Christmas Snow Globe Water Lantern With Music LED Swirling Glitter Santa Snowman Tabletop Holiday Home Decor Gift
Christmas Snow Globe Water Lantern With Music LED Swirling Glitter Santa Snowman Tabletop Holiday Home Decor Gift
like
Find Similar
Christmas snow globe lantern with Santa in a sleigh and golden reindeers with warm LED light - Santa Claus Sleigh / Antique White
Christmas snowman family snow globe music box with tree and vintage embossed base - Snowman Family / Antique White
Christmas Snow Globe Water Lantern With Music LED Swirling Glitter Santa Snowman Tabletop Holiday Home Decor Gift
-4%
$35.59
Mix MOQ : 6
LED Light Up Christmas Ball Ornaments Transparent Plastic Landscape Baubles Xmas Tree Hanging Decoration Warm Glow Interior
LED Light Up Christmas Ball Ornaments Transparent Plastic Landscape Baubles Xmas Tree Hanging Decoration Warm Glow Interior
like
Find Similar
8cm glowing transparent Christmas ball with warm LED light and colorful laser filling - 8cm Warm White Light Ball
8cm clear Christmas ball ornament with colorful LED lights and white snowflake patterns - 8cm Multicolor Light Ball
LED Light Up Christmas Ball Ornaments Transparent Plastic Landscape Baubles Xmas Tree Hanging Decoration Warm Glow Interior
-4%
$1.59
No MOQ
Christmas LED Wind Lantern Retro Bronze Plastic Desktop Ornament Santa Snowman Elk Angel Hanging Decoration
Christmas LED Wind Lantern Retro Bronze Plastic Desktop Ornament Santa Snowman Elk Angel Hanging Decoration
like
Find Similar
2 options
Christmas LED Wind Lantern Retro Bronze Plastic Desktop Ornament Santa Snowman Elk Angel Hanging Decoration
$3.31-4.32
No MOQ
Christmas Tree Snow Globe Music Box With LED Light Resin Musical Holiday Tabletop Decor Water Lantern Santa Snowman Design
Christmas Tree Snow Globe Music Box With LED Light Resin Musical Holiday Tabletop Decor Water Lantern Santa Snowman Design
like
Find Similar
Detail view of a glowing Christmas tree water globe with snowman and squirrel miniatures - Snowman with Broom
Christmas Tree Snow Globe Music Box With LED Light Resin Musical Holiday Tabletop Decor Water Lantern Santa Snowman Design
$28.24
No MOQ
Christmas Snow Globe Music Box Luminous LED Musical Ornament Rotating Snowfall Fireplace Candy Shop Decor Resin Plastic Holiday Gift
Christmas Snow Globe Music Box Luminous LED Musical Ornament Rotating Snowfall Fireplace Candy Shop Decor Resin Plastic Holiday Gift
like
Find Similar
Christmas candy shop music box with Santa and LED lights, festive resin tabletop decor - White Candy House
Red brick fireplace Christmas music box featuring Santa and snow globe swirl effect - Red Fireplace
Christmas fireplace music box with Santa and snow scene, dual power with warm LED lights - White Fireplace
Christmas Snow Globe Music Box Luminous LED Musical Ornament Rotating Snowfall Fireplace Candy Shop Decor Resin Plastic Holiday Gift
-5%
$38.33
Mix MOQ : 6
 · 
11 views
Miniature Christmas Luminous Resin House Ornaments Snow Village LED Light Festive Desktop Decor Holiday Xmas Home Party
Miniature Christmas Luminous Resin House Ornaments Snow Village LED Light Festive Desktop Decor Holiday Xmas Home Party
like
Find Similar
Luminous resin Christmas house model with snow detail on a cozy festive tabletop - Style A (City Hall)
Cozy snow-covered resin Christmas house decoration featuring Rain Station tower on books - Style C (Train Station)
Detailed view of a miniature resin Christmas fire station with snow-covered roof and lights - Style B (Fire Station)
Detail of miniature snow-covered resin house with red door and festive Christmas trees - Style D (Church)
Miniature Christmas Luminous Resin House Ornaments Snow Village LED Light Festive Desktop Decor Holiday Xmas Home Party
-5%
$2.05
Mix MOQ : 2
Christmas Snow Globe Music Box Retro Lantern LED Light Up Sparkling Glitter Santa Snowman Scene Vintage Desktop Decoration
Christmas Snow Globe Music Box Retro Lantern LED Light Up Sparkling Glitter Santa Snowman Scene Vintage Desktop Decoration
like
Find Similar
3 options
Christmas Snow Globe Music Box Retro Lantern LED Light Up Sparkling Glitter Santa Snowman Scene Vintage Desktop Decoration
-5%
$24.64
Mix MOQ : 6
Christmas Snow Globe Lantern Retro Bronze LED Luminous Music Water Filled Decorative Lamp Desktop Holiday Gift Resin
Christmas Snow Globe Lantern Retro Bronze LED Luminous Music Water Filled Decorative Lamp Desktop Holiday Gift Resin
like
Find Similar
Close-up of vintage bronze Santa lantern on rustic wood slices with festive bokeh lights - Santa Claus
Close-up of vintage bronze snowman street lamp with warm LED lights and swirling glitter - Snowman
Close-up of a vintage bronze Christmas snow globe lamp featuring Santa and a tree - Christmas Tree
Detailed view of a vintage bronze Christmas water lantern with nativity scene and glitter - Nativity Scene Style
Christmas Snow Globe Lantern Retro Bronze LED Luminous Music Water Filled Decorative Lamp Desktop Holiday Gift Resin
$17.29
No MOQ
Retro Christmas Snow Globe Lantern LED Light Water Filled Flying Snow Music Bronze Desktop Ornament Santa Claus Snowman
Retro Christmas Snow Globe Lantern LED Light Water Filled Flying Snow Music Bronze Desktop Ornament Santa Claus Snowman
like
Find Similar
Close-up of vintage bronze Christmas lantern with Santa scene and snowy light effects - Santa Claus
Vintage bronze Christmas lantern with a snowman scene and festive warm bokeh lighting - Snowman
Detailed view of bronze Christmas street lamp snow globe with Santa and glowing water - Christmas Tree
Macro detail of bronze Christmas lantern with Nativity scene and sparkling silver glitter - Nativity Scene Style
Retro Christmas Snow Globe Lantern LED Light Water Filled Flying Snow Music Bronze Desktop Ornament Santa Claus Snowman
$17.29
No MOQ
Christmas Wooden House Ornament Light Up LED Glowing Cabin With Faux Snow Pine Needles Berries Winter Tabletop Decor
Christmas Wooden House Ornament Light Up LED Glowing Cabin With Faux Snow Pine Needles Berries Winter Tabletop Decor
like
Find Similar
Luminous carbonized wood Christmas cabin with warm LED lights and cozy festive decor - B17021 (Luminous Wooden Cabin)
Christmas Wooden House Ornament Light Up LED Glowing Cabin With Faux Snow Pine Needles Berries Winter Tabletop Decor
$17.29
Mix MOQ : 2
Christmas Church Ornament LED Glowing Transparent Crystal Style Church Building Desktop Decoration Warm Light Holiday Home Decor
Christmas Church Ornament LED Glowing Transparent Crystal Style Church Building Desktop Decoration Warm Light Holiday Home Decor
like
Find Similar
Luminous crystal church figurine with warm LED light and snow base Christmas ornament - New Gold Dots Clear House
Christmas Church Ornament LED Glowing Transparent Crystal Style Church Building Desktop Decoration Warm Light Holiday Home Decor
$6.05
Mix MOQ : 2
Christmas LED Lantern Decorative Hanging Wind Lamp Warm Night Light For Holiday Home Table Party Santa Snowman Patterns
Christmas LED Lantern Decorative Hanging Wind Lamp Warm Night Light For Holiday Home Table Party Santa Snowman Patterns
like
Find Similar
White Christmas lantern featuring Santa Claus design with warm LED glowing effect - Santa Claus
White Christmas LED lantern with snowman print and warm candle light for holiday decor - Snowman
White LED Christmas lantern with reindeer illustration and warm electronic candle light - Elk
White Christmas LED lantern with vintage red truck and tree scene decoration - Christmas Truck
Christmas LED Lantern Decorative Hanging Wind Lamp Warm Night Light For Holiday Home Table Party Santa Snowman Patterns
$1.50
Mix MOQ : 2
Vintage Christmas Ceramic Figurines With LED Lights Hand Painted Santa Snowman Reindeer Mushroom Desktop Holiday Decor
Vintage Christmas Ceramic Figurines With LED Lights Hand Painted Santa Snowman Reindeer Mushroom Desktop Holiday Decor
like
Find Similar
6 options
Vintage Christmas Ceramic Figurines With LED Lights Hand Painted Santa Snowman Reindeer Mushroom Desktop Holiday Decor
-5%
$2.74-5.48
No MOQ
Flocked Christmas Tree Snowy Artificial LED Lights Ornaments Tree Skirt Holiday Home Indoor Decor Warm White
Flocked Christmas Tree Snowy Artificial LED Lights Ornaments Tree Skirt Holiday Home Indoor Decor Warm White
like
Find Similar
1.5m PE flocked white Christmas tree with gold ornaments and warm LED light string - Gold and White Set (Incl. Tree Skirt + Light String) / 1.5m
1.8m snow flocked Christmas tree with gold and white ornaments and LED lights set - Gold and White Set (Incl. Tree Skirt + Light String) / 1.8m
2.1m flocked white artificial Christmas tree with gold ornaments and warm LED lights - Gold and White Set (Incl. Tree Skirt + Light String) / 2.1 Meters
1.5m flocked artificial Christmas tree with red and white ornaments and warm lights - Red and White Set (Incl. Tree Skirt + Light String) / 1.5m
+17
Flocked Christmas Tree Snowy Artificial LED Lights Ornaments Tree Skirt Holiday Home Indoor Decor Warm White
-5%
$182.88-327.98
No MOQ
LED Glowing Wooden Christmas Hanging Ornaments Hollowed Reindeer Santa Snowman Holiday Tree Decor Pendant For Home
LED Glowing Wooden Christmas Hanging Ornaments Hollowed Reindeer Santa Snowman Holiday Tree Decor Pendant For Home
like
Find Similar
2 options
LED Glowing Wooden Christmas Hanging Ornaments Hollowed Reindeer Santa Snowman Holiday Tree Decor Pendant For Home
$2.07
Mix MOQ : 2
Wooden Christmas Advent Calendar With 24 Drawers LED Warm Light Winter Village Scene Xmas Holiday Countdown Decoration
Wooden Christmas Advent Calendar With 24 Drawers LED Warm Light Winter Village Scene Xmas Holiday Countdown Decoration
like
Find Similar
Wooden Christmas countdown calendar box with 24 drawers and LED lighted village scene - Wooden House Calendar Cabinet (Natural Wood)
Wooden Christmas Advent Calendar With 24 Drawers LED Warm Light Winter Village Scene Xmas Holiday Countdown Decoration
$15.97
No MOQ
Christmas LED Wind Lantern Retro Decorative Candle Light Hanging Night Lamp Holiday Desktop Ornament Santa Snowman Plastic
Christmas LED Wind Lantern Retro Decorative Candle Light Hanging Night Lamp Holiday Desktop Ornament Santa Snowman Plastic
like
Find Similar
Close-up of red Christmas lantern with Santa Claus pattern and warm LED candlelight - Red Santa Claus
White vintage Christmas lantern with reindeer print and warm glowing LED light - White Reindeer
Macro view of a bronze vintage Christmas lantern with Santa Claus and warm LED candle light - Brushed Gold Santa
Detail of vintage bronze Christmas lantern with snowman patterns and warm LED candle light - Brushed Gold Snowman
+8
Christmas LED Wind Lantern Retro Decorative Candle Light Hanging Night Lamp Holiday Desktop Ornament Santa Snowman Plastic
-4%
$0.96
No MOQ
 · 
82 sold recently
Christmas Lantern LED Night Light Plastic Vintage Santa Snowman Hanging Lamp Battery Operated Home Holiday Desktop Decor
Christmas Lantern LED Night Light Plastic Vintage Santa Snowman Hanging Lamp Battery Operated Home Holiday Desktop Decor
like
Find Similar
Brown Christmas lantern featuring a Santa Claus graphic and warm LED light in snow - Santa Claus / Red Santa Claus
Pink Christmas lantern with snowman scene and warm LED candle light for desk decoration - Snowman / White Snowman
Vintage LED Christmas lantern with reindeer snow scene and warm glowing light effect - Elk Style / Brushed Gold Deer
Christmas Lantern LED Night Light Plastic Vintage Santa Snowman Hanging Lamp Battery Operated Home Holiday Desktop Decor
$1.38
No MOQ
Christmas Snow Globe Music Box With LED Lights And Drifting Snow Resin Glass Festive Desktop Ornament Holiday Gift
Christmas Snow Globe Music Box With LED Lights And Drifting Snow Resin Glass Festive Desktop Ornament Holiday Gift
like
Find Similar
Christmas musical snow globe featuring Santa Claus and a festive red base with snowman - Christmas Tree Santa
Christmas musical snow globe featuring Santa and reindeer on a decorative red base - Xmas Tree Reindeer
Luminous Christmas snow globe music box with Santa Claus and a decorative red base - Christmas Tree
Pink Christmas snow globe with Santa Claus figure and golden Merry Christmas base - Pink Christmas Pentagram
+24
Christmas Snow Globe Music Box With LED Lights And Drifting Snow Resin Glass Festive Desktop Ornament Holiday Gift
$4.86-5.76
Mix MOQ : 2
Christmas LED Wishing Ball Curtain String Lights Plastic Multiple Modes Festive Indoor Window Decor Romantic Fairy Lamp
Christmas LED Wishing Ball Curtain String Lights Plastic Multiple Modes Festive Indoor Window Decor Romantic Fairy Lamp
like
Find Similar
Christmas LED wishing ball string lights in pink purple for room and window decoration - 12 Balls - 8 Modes / Warm White
Warm white LED wishing ball string light with transparent globe for Christmas decor - 12 Balls - 8 Modes / Warm White
Christmas LED Wishing Ball Curtain String Lights Plastic Multiple Modes Festive Indoor Window Decor Romantic Fairy Lamp
$10.95
No MOQ
 · 
17 views
Snow Globe Music Box Resin Glass Crystal Ball With Led Light And Music Desktop Ornament For Holiday Home Decoration
Snow Globe Music Box Resin Glass Crystal Ball With Led Light And Music Desktop Ornament For Holiday Home Decoration
like
Find Similar
Detailed view of the Christmas snow globe with a Santa figure and glowing red base - Santa Trailer with Gifts
Christmas crystal ball music box with red base, snowman on reindeer, and warm glow - Snowman Riding Reindeer
Christmas musical snow globe with red base, reindeer patterns and a snowman inside - Snowman with Scarf and Wreath
Macro detail of Christmas snow globe featuring Santa, sleigh, and candy house base - Candy House Santa with Gifts
+34
Snow Globe Music Box Resin Glass Crystal Ball With Led Light And Music Desktop Ornament For Holiday Home Decoration
-14%
$4.61-5.76
Mix MOQ : 2
Christmas Snow Globe Lantern Decorative LED Light Retro Bronze Plastic Glitter Liquid Desktop Ornament Vintage Holiday
Christmas Snow Globe Lantern Decorative LED Light Retro Bronze Plastic Glitter Liquid Desktop Ornament Vintage Holiday
like
Find Similar
Close-up of golden vintage Christmas lantern with Santa scene and shimmering glitter - Santa Claus Style (D4-3)
Close-up of a festive Christmas lantern with a snowman scene and warm internal lighting - Snowman Style (D4-3)
Detail of vintage Christmas lantern with green tree and festive bronze finish - Christmas Tree Style (D4-3)
Christmas Snow Globe Lantern Decorative LED Light Retro Bronze Plastic Glitter Liquid Desktop Ornament Vintage Holiday
$4.90
No MOQ
Luminous Wooden Christmas House Miniature Church LED Warm Light Flocked Snow Scene Desktop Festive Decoration
Luminous Wooden Christmas House Miniature Church LED Warm Light Flocked Snow Scene Desktop Festive Decoration
like
Find Similar
Luminous wooden Christmas house with faux snow and red berries, 21cm high warm LED decor - 3D Style No. 1
Luminous wooden Christmas house with snow effect and warm LED lights, size 21x9x25cm - 3D Style No. 2
Wooden lighted Christmas house ornament with snow detail and warm LED, size 19x8x35cm - 3D Style No. 3
32cm lighted wooden Christmas house with faux snow coating and pine branch accents - 3D Style No. 4
+3
Luminous Wooden Christmas House Miniature Church LED Warm Light Flocked Snow Scene Desktop Festive Decoration
-5%
$10.40-24.09
No MOQ
 · 
12 views
Go to

More in home & kitchen

Explore more in usb led lights

partyplasticbarshapeeyefestivalkidsmetalmagneticnatural
walldecorativestringroomwarmcopperholidaytreetoolhanging decoration

Ready to source like an insider

Get a direct line to the factory floor — no minimums, no middlemen, no guesswork.
iconReal factory pricing, no markup in betweeniconEvery order hand-inspected before it shipsicon5,000+ new products added daily
Get Inside Access