Everful

Wholesale transparent gift boxes

Factory-direct selection, vetted for quality and ready to order.

Sign Up
Transparent Gift Boxes

Find the perfect pieces: party gift bags, party favors, gift wrapping supplies and more

Popular collections in transparent gift boxes

All products in transparent gift boxes

filterShow Filters
Price Drop
Free Shipping
Best Seller
New Arrivals
Mini Hexagon Gift Boxes Cardboard Foldable Chocolate Candy Favor Containers For Wedding Party Stripe Polka Dot With Ribbon
Mini Hexagon Gift Boxes Cardboard Foldable Chocolate Candy Favor Containers For Wedding Party Stripe Polka Dot With Ribbon
like
Find Similar
Mini hexagonal gift box with black and white stripes, black lid, and gold bow detail - Black & White Stripes
Mini hexagonal chocolate gift box with elegant black and white polka dot pattern design - Black Polka Dot
Mini Hexagon Gift Boxes Cardboard Foldable Chocolate Candy Favor Containers For Wedding Party Stripe Polka Dot With Ribbon
$0.09
No MOQ
 · 
30 sold recently
Hollow Heart Moon Theme Wedding Favor Candy Box Pearlescent Paper Chocolate Gift Box For Birthday Party Celebration Decoration
Hollow Heart Moon Theme Wedding Favor Candy Box Pearlescent Paper Chocolate Gift Box For Birthday Party Celebration Decoration
like
Find Similar
16 options
Hollow Heart Moon Theme Wedding Favor Candy Box Pearlescent Paper Chocolate Gift Box For Birthday Party Celebration Decoration
$0.13
Mix MOQ : 50
Ice Cream Shaped Candy Box Paper Gift Packaging Drawer Type Portable Wedding Birthday Party Favors Creative Cute
Ice Cream Shaped Candy Box Paper Gift Packaging Drawer Type Portable Wedding Birthday Party Favors Creative Cute
like
Find Similar
Macro shot of colorful ice cream shaped paper candy boxes for creative gift packaging - Blue
European pink ice cream shaped paper candy gift box with drawer and stick detail - Pink
Ice Cream Shaped Candy Box Paper Gift Packaging Drawer Type Portable Wedding Birthday Party Favors Creative Cute
$0.11
Mix MOQ : 100
 · 
12 sold recently
Tropical Coconut Tree Candy Favor Holder Palm Tree Paper Gift Packaging For Summer Beach Party Wedding Birthday Decorations
Tropical Coconut Tree Candy Favor Holder Palm Tree Paper Gift Packaging For Summer Beach Party Wedding Birthday Decorations
like
Find Similar
Detailed view of three-piece tropical palm tree gift boxes made of layered cardstock - 3.5x3.5x10cm / Green
Tropical Coconut Tree Candy Favor Holder Palm Tree Paper Gift Packaging For Summer Beach Party Wedding Birthday Decorations
$0.08
Mix MOQ : 50
 · 
50 sold recently
Elegant Butterfly Candy Boxes Laser Cut Hollow Out Pearl Paper Gift Box With Ribbon For Wedding Party Birthday Favor
Elegant Butterfly Candy Boxes Laser Cut Hollow Out Pearl Paper Gift Box With Ribbon For Wedding Party Birthday Favor
like
Find Similar
Detail of laser-cut butterfly wedding favor box with cream paper and pink ribbon - Champagne
Detail of yellow laser-cut butterfly favor box with ribbon bow and hollow star patterns - Gold Yellow
Macro detail of laser-cut butterfly gift box in light blue with elegant white ribbon bow - Teal Blue
Elegant purple laser cut butterfly wedding favor box with a satin ribbon on white floral background - Deep purple
+8
Elegant Butterfly Candy Boxes Laser Cut Hollow Out Pearl Paper Gift Box With Ribbon For Wedding Party Birthday Favor
$0.13
Mix MOQ : 50
Hollow Bear Paper Candy Boxes Striped Ribbon Bow Gift Packaging For Wedding Birthday Party Baby Shower Favor
Hollow Bear Paper Candy Boxes Striped Ribbon Bow Gift Packaging For Wedding Birthday Party Baby Shower Favor
like
Find Similar
Pink striped bear hollow candy boxes with ribbons and heart patterns for party favors - Small / Pink
Detail of light blue baby bear gift box with hallow design and white ribbon handle - Small / Blue
Hollow Bear Paper Candy Boxes Striped Ribbon Bow Gift Packaging For Wedding Birthday Party Baby Shower Favor
$0.10
Mix MOQ : 100
 · 
62 sold recently
DIY Explosion Box Scrapbook Hexagon Photo Album Gift Paper Box For Valentine Day Birthday Proposal Romantic Surprise Gift
DIY Explosion Box Scrapbook Hexagon Photo Album Gift Paper Box For Valentine Day Birthday Proposal Romantic Surprise Gift
like
Find Similar
1 option
DIY Explosion Box Scrapbook Hexagon Photo Album Gift Paper Box For Valentine Day Birthday Proposal Romantic Surprise Gift
-9%
$2.80
No MOQ
 · 
48 views
Heart Laser Cut Wedding Candy Boxes Pearlescent Paper Gold Foil Inner Party Favor Gift Packaging Box Celebration Supplies
Heart Laser Cut Wedding Candy Boxes Pearlescent Paper Gold Foil Inner Party Favor Gift Packaging Box Celebration Supplies
like
Find Similar
Laser-cut heart pattern wedding candy box with white exterior and gold foil lining - White + Gold
Laser cut heart favor box in dark blue and gold for wedding candy packaging - Royal Blue + Gold
Elegant laser-cut heart candy box in black and gold finish for wedding favors - Black + Gold
Elegant red laser-cut wedding candy gift box with gold interior and heart patterns - Pearl Red + Gold
+2
Heart Laser Cut Wedding Candy Boxes Pearlescent Paper Gold Foil Inner Party Favor Gift Packaging Box Celebration Supplies
-4%
$0.21
Mix MOQ : 50
Thank You Gift Box Paper Candy Packaging Handbag Shape With Satin Ribbon Handle Metal Buckle For Wedding Party Favor
Thank You Gift Box Paper Candy Packaging Handbag Shape With Satin Ribbon Handle Metal Buckle For Wedding Party Favor
like
Find Similar
Elegant white trapezoid gift box with gold ribbon handle and Thank You gold stamping - White
Detail of black matte gift box with golden ribbon and embossed Thank You text - Black
Trapezoidal brown kraft paper gift box with gold Thank You text and ribbon handle - Kraft Color
Thank You Gift Box Paper Candy Packaging Handbag Shape With Satin Ribbon Handle Metal Buckle For Wedding Party Favor
-5%
$0.19
No MOQ
 · 
61 sold recently
Graduation Cap Shape Gift Boxes Paper Candy Treat Case With Tassel Congrats GRAD Print Party Favors DIY Novelty
Graduation Cap Shape Gift Boxes Paper Candy Treat Case With Tassel Congrats GRAD Print Party Favors DIY Novelty
like
Find Similar
Red graduation cap gift box with gold tassel and Congrats Grad text for party favors - Red
Purple Graduation Cap candy gift box with yellow tassel and Congrats GRAD text - Purple
Navy blue graduation cap candy box with yellow tassel and Congrats GRAD text - Blue
Doctoral cap gift box in black with gold Congrats Grad print and yellow silk tassel - Black
Graduation Cap Shape Gift Boxes Paper Candy Treat Case With Tassel Congrats GRAD Print Party Favors DIY Novelty
$0.13
Mix MOQ : 50
 · 
60 sold recently
Laser Cut Hollow Wedding Candy Box Pearl Paper Gift Packaging Box For Party Favors Chocolate Treat Box Elegant Decoration
Laser Cut Hollow Wedding Candy Box Pearl Paper Gift Packaging Box For Party Favors Chocolate Treat Box Elegant Decoration
like
Find Similar
9 options
Laser Cut Hollow Wedding Candy Box Pearl Paper Gift Packaging Box For Party Favors Chocolate Treat Box Elegant Decoration
$0.18
Mix MOQ : 50
Laser Cut Wedding Favor Box With Ribbon Bride Groom Silhouette Hollow Paper Candy Box Party Decoration Celebration Gift
Laser Cut Wedding Favor Box With Ribbon Bride Groom Silhouette Hollow Paper Candy Box Party Decoration Celebration Gift
like
Find Similar
White laser cut wedding favor box with romantic bride and groom silhouette and ribbon - 5*5*8CM / White
Detail of laser-cut white wedding favor box showing bride and groom silhouette with ribbon - 5*5*8CM / Ivory
Pink laser-cut wedding favor box featuring romantic couple silhouette and organza ribbon bow - 5*5*8CM / Pink
Detailed laser-cut light blue wedding candy box with ribbon and bride groom silhouette - 5*5*8CM / Pearl Pale Blue
+6
Laser Cut Wedding Favor Box With Ribbon Bride Groom Silhouette Hollow Paper Candy Box Party Decoration Celebration Gift
$0.13
Mix MOQ : 50
Elegant Laser Cut Hollow Cross Candy Box Wedding Baptism Party Gift Packaging Paper Favor Box With Ribbon
Elegant Laser Cut Hollow Cross Candy Box Wedding Baptism Party Gift Packaging Paper Favor Box With Ribbon
like
Find Similar
Hollow laser-cut gold wedding candy box with elegant floral patterns and yellow ribbon - Mirror Gold
Hollow cross laser cut candy box with iridescent finish and purple silk ribbon bow - Mirror Iridescent
Rose gold hollow cross candy box with white ribbon for wedding and party favors - Mirror Rose Gold
Detail of laser-cut cross hollow candy box with light blue silk bow for wedding - Mirror Silver
+6
Elegant Laser Cut Hollow Cross Candy Box Wedding Baptism Party Gift Packaging Paper Favor Box With Ribbon
$0.13
Mix MOQ : 50
Cone Shape Paper Candy Box Heart Cutout Favor Gift Boxes With Ribbon For Wedding Celebration Party Decor
Cone Shape Paper Candy Box Heart Cutout Favor Gift Boxes With Ribbon For Wedding Celebration Party Decor
like
Find Similar
Elegant purple cone-shaped wedding favor gift box with heart cutout and white ribbon bow - Deep purple
Lavender cone-shaped gift box with heart ornament and white ribbon for wedding party - Light Purple
Light blue heart-top cone gift box with white organza ribbon for wedding favors - Light Blue
European style red heart cone wedding favor box with white ribbon for party candies - Burgundy
+4
Cone Shape Paper Candy Box Heart Cutout Favor Gift Boxes With Ribbon For Wedding Celebration Party Decor
$0.07
Mix MOQ : 50
 · 
13 views
Eid Mubarak Gift Boxes Book Shaped Cardboard Candy Treat Box With Ribbon For Ramadan Islamic Festival Party
Eid Mubarak Gift Boxes Book Shaped Cardboard Candy Treat Box With Ribbon For Ramadan Islamic Festival Party
like
Find Similar
Detail of Eid Mubarak book-shaped gift boxes with mosque patterns and yellow ribbons - 12 Pcs Set / 4 Styles
Eid Mubarak Gift Boxes Book Shaped Cardboard Candy Treat Box With Ribbon For Ramadan Islamic Festival Party
$2.07
Mix MOQ : 2
 · 
10 sold recently
Laser Cut Elephant Ganesha Candy Box Wedding Party Favor Box Hollow Paper Chocolate Packaging Box With Ribbon Gift Supplies
Laser Cut Elephant Ganesha Candy Box Wedding Party Favor Box Hollow Paper Chocolate Packaging Box With Ribbon Gift Supplies
like
Find Similar
Macro detail of red laser-cut candy box featuring Ganesha motif and organza ribbon - Pearlescent Red
Detail of laser-cut black cardstock gift box with Ganesha motif and organza ribbon - Black
Detail of laser-cut Ganesha ivory favor box with white ribbon bow on elegant porcelain plate - Light Green
White laser cut Ganesha favor box with organza ribbon for weddings and candy packing - White
+7
Laser Cut Elephant Ganesha Candy Box Wedding Party Favor Box Hollow Paper Chocolate Packaging Box With Ribbon Gift Supplies
$0.13
Mix MOQ : 50
Heart Shaped Hollow Kraft Paper Gift Boxes With Hemp Rope Handle For Wedding Party Favors Candy Packaging Vintage Box
Heart Shaped Hollow Kraft Paper Gift Boxes With Hemp Rope Handle For Wedding Party Favors Candy Packaging Vintage Box
like
Find Similar
Square brown kraft paper wedding favor box with heart embossing and jute rope handle - Kraft Outer Box + Kraft Inner Box + Grey Rope
Square kraft favor box with heart cutouts and white rope handle for weddings - White Outer Box + Kraft Inner Box + White Rope
White heart cutout kraft paper gift box with rustic jute twine handle for weddings - White Outer Box + Kraft Inner Box + Grey Rope
Brown kraft paper gift box with hollow heart design and a white loop handle - Kraft Outer Box + White Inner Box + White Rope
+4
Heart Shaped Hollow Kraft Paper Gift Boxes With Hemp Rope Handle For Wedding Party Favors Candy Packaging Vintage Box
$0.10
Mix MOQ : 50
 · 
235 sold recently
House Shaped Gift Box Creative Cardboard Paper Bakery Packaging For Candy Cookie French Patisserie Style Decorative Red Roof
House Shaped Gift Box Creative Cardboard Paper Bakery Packaging For Candy Cookie French Patisserie Style Decorative Red Roof
like
Find Similar
Minimalist white house-shaped gift box with a red roof and French pâtisserie illustration - Red Roof Villa (11*9*11.5cm)
House Shaped Gift Box Creative Cardboard Paper Bakery Packaging For Candy Cookie French Patisserie Style Decorative Red Roof
-9%
$0.19
No MOQ
Transparent Window Gift Bag Handheld Cardboard Packaging For Flowers Dolls Bouquets Mothers Day Valentine Party
Transparent Window Gift Bag Handheld Cardboard Packaging For Flowers Dolls Bouquets Mothers Day Valentine Party
like
Find Similar
Mini white square gift bag with transparent window and rope handles, size 10x10x10cm - 10x10x10cm with Window White
White gift bag with clear window and rope handle, dimensions 14x8.5x28cm for flowers - Type A 14x8.5x28cm
Pink gift bag with clear window and white handle for flowers and dolls 36x12x8cm - Wine Bag Single Pink (12.5x8.5x36cm)
White gift bag with clear PVC window and handle for wine or flowers 36x12.5x8.5cm - Wine Bag Single White (12.5x8.5x36cm)
+45
Transparent Window Gift Bag Handheld Cardboard Packaging For Flowers Dolls Bouquets Mothers Day Valentine Party
-21%
$0.21-1.04
Mix MOQ : 10
 · 
140 sold recently
Graduation Cap Shaped Gift Boxes Mortarboard Candy Box With Tassels Striped Graduation Party Favors Congrats Grad Treat Boxes
Graduation Cap Shaped Gift Boxes Mortarboard Candy Box With Tassels Striped Graduation Party Favors Congrats Grad Treat Boxes
like
Find Similar
Green graduation cap favor box with stripes, white tassel, and Congrats GRAD text design - Green
Orange and black striped graduation cap gift box with tassel and Grad lettering - Orange
Striped graduation cap gift box with purple tassel and GRAD lettering for party favors - Purple
Red graduation cap gift box with blue stripes and tassel for party favors and candies - Red
+1
Graduation Cap Shaped Gift Boxes Mortarboard Candy Box With Tassels Striped Graduation Party Favors Congrats Grad Treat Boxes
$0.13
Mix MOQ : 50
Pillow Favor Boxes Paper Cardboard European Baroque Vine Pattern With Ribbon For Wedding Party Candy Gift Packaging Elegant
Pillow Favor Boxes Paper Cardboard European Baroque Vine Pattern With Ribbon For Wedding Party Candy Gift Packaging Elegant
like
Find Similar
Patterned pillow gift box with silver ribbon for elegant wedding party favors - Ribbon Style / Silver Pattern + Silver Ribbon
White and gold floral pillow candy box for European weddings and gift packaging - Basic Style / Gold Pattern (No Ribbon)
Baroque floral white pillow candy box with silver scroll pattern for wedding favors - Basic Style / Silver Pattern (No Ribbon)
Elegant white pillow gift box with golden vine patterns and a decorative silk bow - Ribbon Style / Gold Pattern + Gold Ribbon
Pillow Favor Boxes Paper Cardboard European Baroque Vine Pattern With Ribbon For Wedding Party Candy Gift Packaging Elegant
$0.03-0.04
Mix MOQ : 50
 · 
20 sold recently
Hollow Laser Cut Wedding Favor Boxes Pearl Paper Candy Gift Box With Ribbon And Thank You Tag For Valentine Party Decor
Hollow Laser Cut Wedding Favor Boxes Pearl Paper Candy Gift Box With Ribbon And Thank You Tag For Valentine Party Decor
like
Find Similar
White laser-cut wedding favor box with heart patterns and gold thank you tag with ribbon - White
White laser-cut wedding candy box with Love lettering and thank you tag on a plate - Ivory
Pink laser-cut wedding favor box with Love heart design and Thank You hanging tag - Pink
Golden laser-cut hollow wedding gift box with ribbon and Thank You card - Gold
+5
Hollow Laser Cut Wedding Favor Boxes Pearl Paper Candy Gift Box With Ribbon And Thank You Tag For Valentine Party Decor
$0.13
Mix MOQ : 50
Laser Cut Wedding Candy Box Hollow Floral Gift Box With Ribbon For Party Favor Chocolate Sugar Packaging Case
Laser Cut Wedding Candy Box Hollow Floral Gift Box With Ribbon For Party Favor Chocolate Sugar Packaging Case
like
Find Similar
Detailed laser-cut red wedding favor box with elegant floral hollows and ribbon bow - Pearlescent Red
Close-up of light blue laser-cut candy box with elegant ribbon and heart detail - Tiffany Blue
Macro view of silver laser-cut wedding candy box with floral patterns and blue ribbon - Reflective Silver
Close-up of white laser-cut floral wedding candy box with ribbon bow and heart detail - White
+6
Laser Cut Wedding Candy Box Hollow Floral Gift Box With Ribbon For Party Favor Chocolate Sugar Packaging Case
$0.12
Mix MOQ : 50
Halloween Gift Boxes White Cardboard Pumpkin Ghost Candy Packaging With Ribbon For Party Favor Trick Or Treat
Halloween Gift Boxes White Cardboard Pumpkin Ghost Candy Packaging With Ribbon For Party Favor Trick Or Treat
like
Find Similar
Black Halloween gift bag with orange ribbon, pumpkin graphic and Happy Halloween text - Black Pumpkin (With Ribbon)
Orange Halloween pumpkin gift box with green ribbon and Happy Halloween print - Orange Pumpkin (With Ribbon)
Purple Halloween gift bag with ghost design and orange satin ribbon Trick or Treat - Purple Ghost (With Ribbon)
Halloween Gift Boxes White Cardboard Pumpkin Ghost Candy Packaging With Ribbon For Party Favor Trick Or Treat
-7%
$0.12
No MOQ
Laser Cut Hollow Pearl Paper Candy Box Cross Pattern Rectangular Favor Gift Box For Wedding Baptism Celebration Party Decoration
Laser Cut Hollow Pearl Paper Candy Box Cross Pattern Rectangular Favor Gift Box For Wedding Baptism Celebration Party Decoration
like
Find Similar
Macro detail of laser-cut cross pattern on gold candy box for wedding events - Reflective Gold
Silver laser-cut hollow cross candy box for wedding and baptism on elegant plate - Reflective Silver
Detailed laser-cut white and gold cross gift box on a decorative plate with chocolate - White
Detailed laser-cut hollow pink gift box with gold interior for wedding and party favors - Pink
+4
Laser Cut Hollow Pearl Paper Candy Box Cross Pattern Rectangular Favor Gift Box For Wedding Baptism Celebration Party Decoration
-5%
$0.16
Mix MOQ : 50
European Creative Wedding Candy Box With Leather Handle Metal Flower Embossed Sweet Time Favor Box Champagne Wine Red Party Gift Box
European Creative Wedding Candy Box With Leather Handle Metal Flower Embossed Sweet Time Favor Box Champagne Wine Red Party Gift Box
like
Find Similar
Elegant burgundy wedding candy bags featuring golden handles and gold flower charms - Small / Wine Red Box + Leather Handle + Flower Plate
Elegant burgundy European wedding candy gift boxes with gold embossed Sweet Present text - Small / Wine Red Box + Flower Handle
Elegant burgundy wedding candy gift bag with gold leather handle and gold script text - Small / Wine Red Box + Leather Handle
Elegant burgundy wedding candy gift box with gold handle and embossed text - Small / Wine Red Box + Gold Handle
+6
European Creative Wedding Candy Box With Leather Handle Metal Flower Embossed Sweet Time Favor Box Champagne Wine Red Party Gift Box
$1.59-1.99
No MOQ
 · 
151 sold recently
Square Glitter Paper Candy Boxes With Ribbon Handle For Wedding Party Favor Gift Packaging
Square Glitter Paper Candy Boxes With Ribbon Handle For Wedding Party Favor Gift Packaging
like
Find Similar
Macro detail of white wedding candy box with colorful glitter lid and satin ribbon - Colorful
Sparkly glitter square gift box with silver and black lid plus white satin ribbon handle - Silver
European square candy gift box with golden glitter finish and white ribbon handle - Gold
Square Glitter Paper Candy Boxes With Ribbon Handle For Wedding Party Favor Gift Packaging
$0.20
Mix MOQ : 50
 · 
14 views
Valentine's Day Gift Boxes Cartoon Animal Paper Candy Favor Bags With Ribbon Bow Decorative Packaging
Valentine's Day Gift Boxes Cartoon Animal Paper Candy Favor Bags With Ribbon Bow Decorative Packaging
like
Find Similar
Valentine's Day alpaca candy gift box with yellow ribbon and heart graphics - Little Sheep
Blue Valentine candy box featuring cute owl designs and a matching satin ribbon bow - Owl
Purple Valentine gift box with cute cartoon giraffes and matching satin ribbon bow - Giraffe
Green trapezoid Valentine candy box with bird illustration and I Love You ribbon - Bird
+2
Valentine's Day Gift Boxes Cartoon Animal Paper Candy Favor Bags With Ribbon Bow Decorative Packaging
-35%
$0.09
Mix MOQ : 50
Halloween Pumpkin Laser Cut Candy Box Hollow Out Paper Gift Box With Ribbon For Wedding Party Pumpkin Chocolate Boxes
Halloween Pumpkin Laser Cut Candy Box Hollow Out Paper Gift Box With Ribbon For Wedding Party Pumpkin Chocolate Boxes
like
Find Similar
Orange Halloween pumpkin laser-cut candy gift box with white ribbon for festive treats - 5*5*8CM / Orange Red
Red Halloween pumpkin hollow-out paper gift box with ribbon for candy packaging - 5*5*8CM / Pearlescent Red
Golden Halloween pumpkin laser cut favor box with orange ribbon for candy gifts - 5*5*8CM / Reflective Gold
Laser-cut black Halloween pumpkin candy box with ribbon handle and hollow-out design - 5*5*8CM / Black
Halloween Pumpkin Laser Cut Candy Box Hollow Out Paper Gift Box With Ribbon For Wedding Party Pumpkin Chocolate Boxes
$0.13
Mix MOQ : 50
Christmas Snowflake Hollow Candy Box Laser Cut Pearl Paper Mini Chocolate Gift Box Holiday Party Favor Wedding Decoration
Christmas Snowflake Hollow Candy Box Laser Cut Pearl Paper Mini Chocolate Gift Box Holiday Party Favor Wedding Decoration
like
Find Similar
White Christmas gift box with laser-cut snowflake design and gold foil lettering - White
Hollow white snowflake Christmas candy gift box with gold metallic finish and drawer design - Reflective Gold
Laser-cut Christmas snowflake gift box in silver and white for wedding candies - Reflective Silver
Laser-cut gold Christmas candy box with snowflake design and Christmas text - Beige Gold
NewChristmas Snowflake Hollow Candy Box Laser Cut Pearl Paper Mini Chocolate Gift Box Holiday Party Favor Wedding Decoration
$0.16
Mix MOQ : 100
Laser Cut Glitter Paper Easter Candy Boxes With Bunny And Egg Patterns Happy Easter Gift Box For Holiday Party Decoration
Laser Cut Glitter Paper Easter Candy Boxes With Bunny And Egg Patterns Happy Easter Gift Box For Holiday Party Decoration
like
Find Similar
Glittery Happy Easter gift boxes with hollow egg patterns in pink blue purple and green - Easter Egg Style (L-00235-1)
Easter glitter gift boxes in pink blue purple green with bunny and egg cutouts - Bunny Style (L-00235-2)
Laser Cut Glitter Paper Easter Candy Boxes With Bunny And Egg Patterns Happy Easter Gift Box For Holiday Party Decoration
-4%
$2.22
Mix MOQ : 5
Back To School Gift Boxes Cartoon Stationery Paper Candy Treat Box With Handle For Student Classroom Party Favors Ceremony
Back To School Gift Boxes Cartoon Stationery Paper Candy Treat Box With Handle For Student Classroom Party Favors Ceremony
like
Find Similar
Pink Back to School favor box with colorful stationery illustrations and sturdy handle - Pink Style (747# Red Candy Box)
Blue Back to School gift box with handle featuring hand-drawn school icons and text - Blue Style (747# Blue Candy Box)
Back To School Gift Boxes Cartoon Stationery Paper Candy Treat Box With Handle For Student Classroom Party Favors Ceremony
$0.14
Mix MOQ : 2
Graduation Candy Boxes Doctoral Hat Shape Cardboard Gift Box With Tassel For Graduate Ceremony Celebration Party Favor
Graduation Candy Boxes Doctoral Hat Shape Cardboard Gift Box With Tassel For Graduate Ceremony Celebration Party Favor
like
Find Similar
Detail of black graduation cap gift box with gold tassel and gold foil lettering - Black
Close-up of blue doctoral hat graduation gift box with gold lettering and yellow tassel - Blue
Graduation Candy Boxes Doctoral Hat Shape Cardboard Gift Box With Tassel For Graduate Ceremony Celebration Party Favor
$0.11
No MOQ
 · 
150 sold recently
Mermaid Tail Candy Boxes Paper Gift Favor Box With Glitter Fish Scale Pattern And Ribbon For Birthday Party Wedding
Mermaid Tail Candy Boxes Paper Gift Favor Box With Glitter Fish Scale Pattern And Ribbon For Birthday Party Wedding
like
Find Similar
Detail of five mermaid tail candy boxes with glitter fins and purple ribbon bows - Starry Sky Mermaid (New Style)
Mermaid party favor boxes with iridescent scales and teal tails for birthday celebrations - Colorful Fish Scale Mermaid (New Style)
Mermaid Tail Candy Boxes Paper Gift Favor Box With Glitter Fish Scale Pattern And Ribbon For Birthday Party Wedding
$0.12
No MOQ
Kraft Paper Pillow Boxes DIY Candy Gift Packaging Cases For Wedding Party Favors With Hemp Rope Ribbons
Kraft Paper Pillow Boxes DIY Candy Gift Packaging Cases For Wedding Party Favors With Hemp Rope Ribbons
like
Find Similar
Six white kraft paper pillow boxes for wedding favors and small gift packaging - White Plain Box
European style white kraft paper pillow candy boxes with jute twine bows on white background - White + White Jute Rope
Brown kraft paper pillow candy boxes set with shiny gold ribbon bows for wedding favors - Kraft Color + Gold Ribbon
Set of 6 white pillow boxes with silver satin ribbons for wedding party favors - White + Silver Ribbon
+3
Kraft Paper Pillow Boxes DIY Candy Gift Packaging Cases For Wedding Party Favors With Hemp Rope Ribbons
$0.03-0.06
Mix MOQ : 50
 · 
1K+ sold recently
Square Gift Paper Bag With Clear Window And Handle Portable Flower Packaging Box For Wedding Birthday Party Favors
Square Gift Paper Bag With Clear Window And Handle Portable Flower Packaging Box For Wedding Birthday Party Favors
like
Find Similar
White gift bags with square clear windows and rope handles in four various sizes - 20*20*20cm / White
Three sizes of red gift bags with clear PVC windows and matching handles for flowers - 15*15*15cm / Red
Pink gift bag set with transparent window and ribbon handles in four various sizes - 15*15*15cm / Pink
Brown kraft gift bags with square PVC window and fabric handles in four assorted sizes - 15*15*15cm / Kraft Color
+12
Square Gift Paper Bag With Clear Window And Handle Portable Flower Packaging Box For Wedding Birthday Party Favors
$0.35-0.86
No MOQ
 · 
695 sold recently
Laser Cut Bird Pattern Candy Box Wedding Favor Gift Box With Ribbon Pearlescent Paper Hollow Chocolate Case Party Decor
Laser Cut Bird Pattern Candy Box Wedding Favor Gift Box With Ribbon Pearlescent Paper Hollow Chocolate Case Party Decor
like
Find Similar
White laser-cut wedding favor box with bird patterns and a white organza ribbon bow - White
Detail of pink laser-cut bird candy box with pearl paper texture and white ribbon bow - Pink
Detailed laser-cut cream wedding favor box with bird pattern and a white ribbon bow - Cream Beige
Sky blue laser-cut bird gift box with ribbon for wedding party favors and candies - Tiffany Blue
+6
Laser Cut Bird Pattern Candy Box Wedding Favor Gift Box With Ribbon Pearlescent Paper Hollow Chocolate Case Party Decor
$0.13
Mix MOQ : 50
Laser Cut Butterfly Happy Birthday Candy Box Paper Gift Box Wedding Party Decoration Favor Bag For Treats And Chocolates
Laser Cut Butterfly Happy Birthday Candy Box Paper Gift Box Wedding Party Decoration Favor Bag For Treats And Chocolates
like
Find Similar
Macro shot of laser-cut butterfly gift box with Happy Birthday镂空 design on white card - 6*6*10CM / White
Detail of white 3D butterfly laser cut candy box with Happy Birthday text - 6*6*10CM / Ivory
Pink laser-cut butterfly gift box with Happy Birthday hollow-out design and floral patterns - 6*6*10CM / Pink
Macro detail of laser-cut Happy Birthday text and 3D butterfly on light blue gift box - 6*6*10CM / Pearl Pale Blue
+6
Laser Cut Butterfly Happy Birthday Candy Box Paper Gift Box Wedding Party Decoration Favor Bag For Treats And Chocolates
$0.16
No MOQ
Easter Rabbit Hollow Cardboard Gift Boxes Happy Easter Egg Pattern Candy Treat Packaging Boxes For Party Favor Supplies
Easter Rabbit Hollow Cardboard Gift Boxes Happy Easter Egg Pattern Candy Treat Packaging Boxes For Party Favor Supplies
like
Find Similar
Easter gift box set with bunny cutout window and colorful festive patterns on blue wood - Easter Mixed Color Set (S791)
Easter Rabbit Hollow Cardboard Gift Boxes Happy Easter Egg Pattern Candy Treat Packaging Boxes For Party Favor Supplies
-5%
$2.05
No MOQ
Hanukkah Hollow Star Of David Candy Gift Box With Ribbon Laser Cut Favor Boxes For Wedding Party Jewish Holiday Celebration
Hanukkah Hollow Star Of David Candy Gift Box With Ribbon Laser Cut Favor Boxes For Wedding Party Jewish Holiday Celebration
like
Find Similar
Elegant white laser cut Hanukkah favor box with Star of David and white ribbon bow - White
Close-up of laser-cut hexagonal star patterns on white pearlescent gift candy box - Ivory
Close-up of pink house-shaped paper gift box with hollow geometric cutout and white ribbon bow - Pink
Elegant gold laser cut Hanukkah gift box with hexagonal pattern and silk ribbon - Gold
+6
Hanukkah Hollow Star Of David Candy Gift Box With Ribbon Laser Cut Favor Boxes For Wedding Party Jewish Holiday Celebration
$0.13
Mix MOQ : 50
Halloween Candy Boxes Laser Cut Paper Hollow Out Spider Web Ghost Pattern Gift Packaging Boxes Party Favor Decoration
Halloween Candy Boxes Laser Cut Paper Hollow Out Spider Web Ghost Pattern Gift Packaging Boxes Party Favor Decoration
like
Find Similar
Laser cut Halloween spider web candy box in black paper with an elegant ribbon bow - Black
Golden Halloween laser-cut candy box with spider web motifs and orange organza ribbon - Gold
Mirror silver Halloween gift box with laser-cut spider web and ghost patterns with blue ribbon - Silver
Halloween Candy Boxes Laser Cut Paper Hollow Out Spider Web Ghost Pattern Gift Packaging Boxes Party Favor Decoration
$0.13
Mix MOQ : 50
Laser Cut Tree Of Life Candy Box Elegant Paper Favor Box With Ribbon For Wedding Party Thanksgiving Celebration Gift Box
Laser Cut Tree Of Life Candy Box Elegant Paper Favor Box With Ribbon For Wedding Party Thanksgiving Celebration Gift Box
like
Find Similar
Elegant white laser-cut Tree of Life candy box with white ribbon on wooden surface - White
Macro shot of laser-cut tree of life pattern on white wedding favor candy box with ribbon - Ivory
Pink pearl paper gift box with laser-cut Tree of Life design and white ribbon bow - Pink
Close-up of golden hollow tree gift box with laser-cut details and organza ribbon - Gold
+7
Laser Cut Tree Of Life Candy Box Elegant Paper Favor Box With Ribbon For Wedding Party Thanksgiving Celebration Gift Box
$0.13
Mix MOQ : 50
Tropical Palm Tree Shape Candy Box Creative 3D Foldable Paper Gift Box For Wedding Birthday Summer Party Favor Decoration
Tropical Palm Tree Shape Candy Box Creative 3D Foldable Paper Gift Box For Wedding Birthday Summer Party Favor Decoration
like
Find Similar
Flat lay of 3D palm tree candy boxes packed in transparent OPP bags for parties - Coconut Tree Shape (HB0023-椰枣树) / 5x5x10cm
Tropical Palm Tree Shape Candy Box Creative 3D Foldable Paper Gift Box For Wedding Birthday Summer Party Favor Decoration
-4%
$1.18
No MOQ
Easter Bunny Shaped Cardboard Candy Gift Packaging With Transparent Egg Window Folding DIY Party Favor Decoration
Easter Bunny Shaped Cardboard Candy Gift Packaging With Transparent Egg Window Folding DIY Party Favor Decoration
like
Find Similar
Easter egg rabbit gift box with transparent window and decorative blue bow knot - Blue Rabbit / 10pcs/Pack
Easter egg rabbit foldable candy box with window and pink bow for DIY gifts - Pink Rabbit / 10pcs/Pack
Easter Bunny Shaped Cardboard Candy Gift Packaging With Transparent Egg Window Folding DIY Party Favor Decoration
$1.82
No MOQ
 · 
33 views
European Laser Cut Swan Heart Candy Box Wedding Party Favor Gift Box With Ribbon And Thank You Tag Pearl Paper Packaging
European Laser Cut Swan Heart Candy Box Wedding Party Favor Gift Box With Ribbon And Thank You Tag Pearl Paper Packaging
like
Find Similar
White laser-cut swan heart wedding favor box with white ribbon and thank you tag - White
Macro shot of laser-cut swan heart candy box with white organza ribbon and thank you tag - Ivory
Close-up of pink hollow swan candy box with white ribbon and a gold thank you tag - Pink
Laser-cut swan heart wedding favor box in light blue with ribbon and thank you tag - Tiffany Blue
+5
European Laser Cut Swan Heart Candy Box Wedding Party Favor Gift Box With Ribbon And Thank You Tag Pearl Paper Packaging
$0.14
Mix MOQ : 50
Hexagonal Bee Theme Candy Box Yellow Honeycomb Design Paper Gift Box For Baby Shower Birthday Party Wedding Return Favor
Hexagonal Bee Theme Candy Box Yellow Honeycomb Design Paper Gift Box For Baby Shower Birthday Party Wedding Return Favor
like
Find Similar
Hexagonal yellow bee candy box with honeycomb patterns and cute cartoon character - Yellow Bee Box
NewHexagonal Bee Theme Candy Box Yellow Honeycomb Design Paper Gift Box For Baby Shower Birthday Party Wedding Return Favor
$0.10
Mix MOQ : 50
Graduation Cap Gift Box Doctoral Hat Paper Candy Box With Tassels Stickers For Graduation Party Favors Celebration Decor
Graduation Cap Gift Box Doctoral Hat Paper Candy Box With Tassels Stickers For Graduation Party Favors Celebration Decor
like
Find Similar
Black graduation cap gift boxes with gold tassels and Class of 2023 decorative stickers - Black (With Stickers)
Navy graduation cap candy boxes with gold tassels and Class of 2026 stickers set - Blue (With Stickers)
Detail of DIY graduation cap favor box with black matte finish and yellow tassel - Black (Without Stickers)
Detail view of navy blue graduation cap candy box with a yellow silk tassel on a white plate - Blue (Without Stickers)
Graduation Cap Gift Box Doctoral Hat Paper Candy Box With Tassels Stickers For Graduation Party Favors Celebration Decor
-9%
$0.09-0.10
No MOQ
Laser Cut Halloween Pumpkin Cat Skull Candy Box Pearlescent Paper Gift Box With Ribbon For Halloween Party Decorations
Laser Cut Halloween Pumpkin Cat Skull Candy Box Pearlescent Paper Gift Box With Ribbon For Halloween Party Decorations
like
Find Similar
Hollow laser cut black Halloween candy box with pumpkin and cat motifs with ribbon - Black
Dark cyan Halloween laser-cut gift box with hollow pumpkin, cat and skull patterns - Pearlescent Dark Green
Golden Halloween hollow gift box with pumpkin and cat motifs and a satin ribbon bow - Gold
Laser Cut Halloween Pumpkin Cat Skull Candy Box Pearlescent Paper Gift Box With Ribbon For Halloween Party Decorations
$0.13
Mix MOQ : 50
Crown Shape Paper Gift Box Bronzing European Style Wedding Candy Packaging With Ribbon Bow Pendants
Crown Shape Paper Gift Box Bronzing European Style Wedding Candy Packaging With Ribbon Bow Pendants
like
Find Similar
European crown gift box with gold foil vintage patterns for wedding favors - 8.5*5*9.5cm / Beige Crown
Pink European style gift box with gold crown closure and elegant baroque pattern - 8.5*5*9.5cm / Pink Crown
Elegant green crown gift box with gold foil patterns for perfume and candy packaging - 8.5*5*9.5cm / Green Crown
Crown Shape Paper Gift Box Bronzing European Style Wedding Candy Packaging With Ribbon Bow Pendants
$0.25
No MOQ
 · 
200 sold recently
European Style House Shape Gift Box Cardboard Cartoon Villa Candy Box With Ribbon For Wedding Party Baking Packaging
European Style House Shape Gift Box Cardboard Cartoon Villa Candy Box With Ribbon For Wedding Party Baking Packaging
like
Find Similar
European cartoon house shaped gift box in light blue with brown roof and red handle - Villa / 6.7*6.7*7.5cm / Light Blue
European Style House Shape Gift Box Cardboard Cartoon Villa Candy Box With Ribbon For Wedding Party Baking Packaging
-5%
$0.16
No MOQ
 · 
101 sold recently
Superhero Comic Theme Kraft Paper Gift Box With Handle Cartoon City Silhouette Candy Pastry Birthday Party Favor Box
Superhero Comic Theme Kraft Paper Gift Box With Handle Cartoon City Silhouette Candy Pastry Birthday Party Favor Box
like
Find Similar
Purple superhero-themed gift box with urban skyline and comic-style BOOM and POW print - Purple Stone Texture (A027-4) / 16*9*9cm
Comic style yellow cake box with city silhouette and BOOM ZAP patterns for birthday party - Yellow-Green Scale (A027-6) / 16*9*9cm
Green dinosaur theme cake box with superhero comic print and portable handle - Green Leather Texture (A027-1) / 16*9*9cm
Spider superhero theme paper gift box with comic style graphics and integrated handle - Red Spider Web (A027-5) / 16*9*9cm
+2
NewSuperhero Comic Theme Kraft Paper Gift Box With Handle Cartoon City Silhouette Candy Pastry Birthday Party Favor Box
$0.19
Mix MOQ : 12
Laser Cut Butterfly Pearlescent Paper Candy Box With Ribbon Thank You Tags For Wedding Party Favor Packaging Gift Box
Laser Cut Butterfly Pearlescent Paper Candy Box With Ribbon Thank You Tags For Wedding Party Favor Packaging Gift Box
like
Find Similar
Elegant black laser-cut butterfly gift box with black ribbon and Thank You tag - Black
Close-up of laser-cut lavender butterfly favor box with ribbon and thank you tag - Light Purple
Laser-cut butterfly white gift box with silk ribbon and golden Thank You tag for weddings - White
Detailed laser-cut butterfly wedding favor box with white ribbon and thank you tag - Ivory
+4
Laser Cut Butterfly Pearlescent Paper Candy Box With Ribbon Thank You Tags For Wedding Party Favor Packaging Gift Box
$0.14
Mix MOQ : 50
Laser Cut Hollow Out Cross Candy Box Pearl Paper Wedding Favor Gift Boxes With Ribbons For Baptism Religious Party Favor
Laser Cut Hollow Out Cross Candy Box Pearl Paper Wedding Favor Gift Boxes With Ribbons For Baptism Religious Party Favor
like
Find Similar
Detail of laser-cut white cross favor box with delicate patterns and organza ribbon - White
Macro shot of white laser-cut cross favor box with organza ribbon on porcelain plate - Ivory
Pink laser-cut cross gift box with pearlescent finish and white organza ribbon - Pink
Detail of light blue laser-cut gift box with hollow cross design and ribbon bow - Tiffany Blue
+7
Laser Cut Hollow Out Cross Candy Box Pearl Paper Wedding Favor Gift Boxes With Ribbons For Baptism Religious Party Favor
$0.13
Mix MOQ : 50
Graduation Cap Candy Box Mini Mortarboard Gift Box With Tassel Pearl Paper DIY Graduation Party Favor Packaging Supplies
Graduation Cap Candy Box Mini Mortarboard Gift Box With Tassel Pearl Paper DIY Graduation Party Favor Packaging Supplies
like
Find Similar
Black graduation cap favor box with golden tassel and yellow bead on white surface - Black / 6*6*6cm
Graduation Cap Candy Box Mini Mortarboard Gift Box With Tassel Pearl Paper DIY Graduation Party Favor Packaging Supplies
$0.17
Mix MOQ : 50
European Style Striped Paper Candy Gift Boxes With Ribbon Bow For Wedding Party Favor Celebration Decorative DIY Folding Box
European Style Striped Paper Candy Gift Boxes With Ribbon Bow For Wedding Party Favor Celebration Decorative DIY Folding Box
like
Find Similar
Teal green petal-shaped gift boxes with satin ribbons and 50pcs flat shipping sheets - Teal Blue + Teal Blue Ribbon
50pcs red and white striped gift boxes with heart top and ribbon for candy favors - Red and White Stripe + Red Ribbon
Two red striped gift boxes with ribbon bows for Christmas and New Year candy packaging - Solid Wine Red + Red Ribbon
Detailed view of 50pcs pink tulip-shaped gift boxes with ribbons and flat-packed cardboard - Solid Pink + Pink Ribbon
+1
European Style Striped Paper Candy Gift Boxes With Ribbon Bow For Wedding Party Favor Celebration Decorative DIY Folding Box
$0.07
Mix MOQ : 100
 · 
20 views
Gift Packaging Bag Black Cardboard Folding Box With Ribbon Bow Merci Print For Valentine Wedding Party Minimalist
Gift Packaging Bag Black Cardboard Folding Box With Ribbon Bow Merci Print For Valentine Wedding Party Minimalist
like
Find Similar
Elegant black paper gift bag with grey satin bow on a premium wood background - 8x5.5x16.5cm / Black
Gift Packaging Bag Black Cardboard Folding Box With Ribbon Bow Merci Print For Valentine Wedding Party Minimalist
-14%
$0.12
No MOQ
Laser Cut Pumpkin Maple Leaf Pearl Paper Candy Box With Ribbon Halloween Thanksgiving Wedding Party Favor Gift Box
Laser Cut Pumpkin Maple Leaf Pearl Paper Candy Box With Ribbon Halloween Thanksgiving Wedding Party Favor Gift Box
like
Find Similar
Golden laser-cut pumpkin favor box with an orange ribbon for Thanksgiving party - 5*5*8CM / Reflective Gold
Golden laser-cut pumpkin favor box with orange ribbon for Thanksgiving and parties - 5*5*8CM / Gold
Orange laser-cut pumpkin gift box with white silk ribbon for Thanksgiving party favors - 5*5*8CM / Orange Red
Black laser-cut pumpkin and maple leaf candy box with elegant organza ribbon - 5*5*8CM / Black
Laser Cut Pumpkin Maple Leaf Pearl Paper Candy Box With Ribbon Halloween Thanksgiving Wedding Party Favor Gift Box
$0.13
Mix MOQ : 50
Laser Cut Cross Dove Hollow Candy Boxes With Ribbons For Wedding Baptism Communion Party Favor Gift Packaging Box 50Pcs
Laser Cut Cross Dove Hollow Candy Boxes With Ribbons For Wedding Baptism Communion Party Favor Gift Packaging Box 50Pcs
like
Find Similar
Detailed laser-cut white cross and dove pattern on Tiffany blue party favor candy box - Tiffany Blue
Macro view of red laser-cut candy box featuring hollow cross and dove patterns - Pearlescent Red
Detailed laser-cut white favor box with cross, peace doves, and elegant ribbon bow - White (With Tag)
Macro shot of silver glitter gift box with laser-cut cross, dove motifs and black bow - Silver Charcoal
+5
Laser Cut Cross Dove Hollow Candy Boxes With Ribbons For Wedding Baptism Communion Party Favor Gift Packaging Box 50Pcs
$0.13
Mix MOQ : 50
Laser Cut Proposal Silhouette Wedding Favor Boxes With Satin Ribbon And Thank You Tags Candy Gift Boxes For Party Decorations
Laser Cut Proposal Silhouette Wedding Favor Boxes With Satin Ribbon And Thank You Tags Candy Gift Boxes For Party Decorations
like
Find Similar
Detail of purple laser-cut wedding candy box with blue ribbon and Thank You tag - Sapphire Blue
Golden laser-cut wedding gift box with Mr & Mrs silhouette and thank you tag - Reflective Gold
White laser-cut wedding favor box with heart silhouette and thank you tag decoration - White
Detail of white laser-cut wedding favor box with Love engraving and ribbon bow - Ivory
+6
Laser Cut Proposal Silhouette Wedding Favor Boxes With Satin Ribbon And Thank You Tags Candy Gift Boxes For Party Decorations
$0.14
Mix MOQ : 50
Laser Cut Teddy Bear Baby Bottle Favor Boxes For Baby Shower Birthday Party Hollow Paper Candy Gift Box Ribbon Packaging
Laser Cut Teddy Bear Baby Bottle Favor Boxes For Baby Shower Birthday Party Hollow Paper Candy Gift Box Ribbon Packaging
like
Find Similar
Laser-cut white baby shower favor box with bear and bottle patterns on wood background - White
Close-up of pink laser-cut baby shower candy box with bear and milk bottle patterns - Pink
Detailed laser-cut yellow paper gift box with bear hollow design and gold ribbon bow - Gold
Laser cut light blue baby shower favor box with bear pattern and blue silk ribbon - Pearl Pale Blue
+6
Laser Cut Teddy Bear Baby Bottle Favor Boxes For Baby Shower Birthday Party Hollow Paper Candy Gift Box Ribbon Packaging
$0.13
Mix MOQ : 50
Go to

More in party supplies

Explore more in transparent gift boxes

partyplasticgoldartificialdiycakecardpetdisplaysmall
holidaystoragehomesanta clauskidsstorage boxtreesolid colorstylestar

Ready to source like an insider

Get a direct line to the factory floor — no minimums, no middlemen, no guesswork.
iconReal factory pricing, no markup in betweeniconEvery order hand-inspected before it shipsicon5,000+ new products added daily
Get Inside Access