Everful

Wholesale transparent gift boxes

Factory-direct selection, vetted for quality and ready to order.

Sign Up
Transparent Gift Boxes

Find the perfect pieces: party gift bags, party favors, gift wrapping supplies and more

Popular collections in transparent gift boxes

All products in transparent gift boxes

filterShow Filters
Price Drop
Free Shipping
Best Seller
New Arrivals
Elegant Gold Foil Star Moon Gift Box With Satin Ribbon Bow Luxury Hard Cardboard Gift Wrapping Box For Ramadan Eid Party Wedding
Elegant Gold Foil Star Moon Gift Box With Satin Ribbon Bow Luxury Hard Cardboard Gift Wrapping Box For Ramadan Eid Party Wedding
like
Find Similar
Dark grey gift envelope with gold moon and star foil design and champagne satin bow - Black
Elegant white gift box with gold foil moon star patterns and a gold satin ribbon bow - White
Elegant Gold Foil Star Moon Gift Box With Satin Ribbon Bow Luxury Hard Cardboard Gift Wrapping Box For Ramadan Eid Party Wedding
$0.42
Mix MOQ : 2
Graduation Party Transparent PVC Candy Container Congrats GRAD Bachelor Uniform Gift Packaging Decoration For Students
Graduation Party Transparent PVC Candy Container Congrats GRAD Bachelor Uniform Gift Packaging Decoration For Students
like
Find Similar
Transparent PVC graduation candy boxes with Congrats Grad motifs and academic cap designs - Male Style / Male Graduate Transparent Box
Set of 5 transparent graduation candy boxes with cartoon girl and Congrats GRAD text - Female Style / Female Graduate Transparent Box
Graduation Party Transparent PVC Candy Container Congrats GRAD Bachelor Uniform Gift Packaging Decoration For Students
$0.19
Mix MOQ : 50
 · 
360 sold recently
Blue and White Floral Paper Gift Box Portable Cardboard Packaging Box For Birthday Wedding Party Baking Candy Cupcake Boxes
Blue and White Floral Paper Gift Box Portable Cardboard Packaging Box For Birthday Wedding Party Baking Candy Cupcake Boxes
like
Find Similar
Elegant vintage French floral paper gift box with handle for wedding favors and baking - French Vintage Floral Style (A025-1) / 16*9*9cm
Elegant floral gift box with blue pattern and integrated handle for wedding favors - French Pastoral Floral Style (A025-3) / 16*9*9cm
Elegant white gift box with blue floral Toile de Jouy pattern and die-cut handle - Vintage Pattern Style (A025-4) / 16*9*9cm
Blue and white floral porcelain style paper gift box with handle for cakes and wedding favors - Chinoiserie Classical Floral Style (A025-2) / 16*9*9cm
Blue and White Floral Paper Gift Box Portable Cardboard Packaging Box For Birthday Wedding Party Baking Candy Cupcake Boxes
$0.19
Mix MOQ : 12
Christmas Paper Gift Box Folding Apple Candy Box With Satin Ribbon Bow Santa Claus Snowman Gingerbread Man Pattern Holiday Party Favor Packaging Box
Christmas Paper Gift Box Folding Apple Candy Box With Satin Ribbon Bow Santa Claus Snowman Gingerbread Man Pattern Holiday Party Favor Packaging Box
like
Find Similar
Pink Christmas gift box with snowman and tree illustrations and a red ribbon bow - Pink
Red Christmas apple gift box with cartoon gingerbread man and festive ribbon bow - Red
Green Christmas gift box with Santa and snowman patterns and decorative green ribbon bow - Green
Orange Christmas gift box with Santa illustration, snowflakes and yellow silk ribbon - Orange Yellow
Christmas Paper Gift Box Folding Apple Candy Box With Satin Ribbon Bow Santa Claus Snowman Gingerbread Man Pattern Holiday Party Favor Packaging Box
$0.16
Mix MOQ : 50
Modern Rectangular Drawer Gift Box With Abstract Art Print Gold Stamping Merci Text White Cardboard Packing Box For Socks Chocolate Flower Tea
Modern Rectangular Drawer Gift Box With Abstract Art Print Gold Stamping Merci Text White Cardboard Packing Box For Socks Chocolate Flower Tea
like
Find Similar
Macro shot of rectangular drawer gift box featuring abstract oil painting patterns - Abstract Charm (Light Color)
Artistic rectangular gift box with hand-painted patterns and merci BEAUCOUP label - Abstract Charm (Dark Color)
Top view of rectangular gift box with artistic monstera leaf pattern and merci text - Abstract Charm (Monstera Leaf)
Modern Rectangular Drawer Gift Box With Abstract Art Print Gold Stamping Merci Text White Cardboard Packing Box For Socks Chocolate Flower Tea
-5%
$0.54
No MOQ
Ramadan Eid Mubarak Gift Box Islamic Book Shape Gold Foil Paper Candy Box With Satin Ribbon For Party Favor Wedding Packaging
Ramadan Eid Mubarak Gift Box Islamic Book Shape Gold Foil Paper Candy Box With Satin Ribbon For Party Favor Wedding Packaging
like
Find Similar
Set of 12 Ramadan gift boxes in dark green and white with gold mosque patterns and ribbons - Book Box / Green
Book-shaped purple Eid moon party gift boxes with gold foil and silk ribbon - Book Box / Purple
Eid Mubarak book shaped gift boxes with gold foil patterns and yellow ribbons for sweets - Book Box / Black
Blue and gold Ramadan Moon Festival castle gift box set with yellow ribbon bows - Book Box / Blue
NewRamadan Eid Mubarak Gift Box Islamic Book Shape Gold Foil Paper Candy Box With Satin Ribbon For Party Favor Wedding Packaging
$0.17
Mix MOQ : 50
Long Strip Cardboard Gift Boxes With Ribbon Bows And Stickers For Biscuit Candy Packaging Korean Style Fresh Design
Long Strip Cardboard Gift Boxes With Ribbon Bows And Stickers For Biscuit Candy Packaging Korean Style Fresh Design
like
Find Similar
Detail of Korean style paper cookie box with colorful teardrop pattern and orange ribbon - Long Strip Box / Water Drop Pattern
Detailed view of white paper pillow gift boxes with pink dots and ribbon decoration - Pillow Box / Candy Polka Dots
Polka dot cookie packaging boxes with red satin bows and Korean style stickers - Long Strip Box / Black Large Polka Dots
Long Strip Cardboard Gift Boxes With Ribbon Bows And Stickers For Biscuit Candy Packaging Korean Style Fresh Design
$0.13
Mix MOQ : 20
 · 
35 sold recently
Gold Castle Candy Box Hollow Laser Cut Glitter Film Wedding Party Favors Gift Boxes Birthday Celebration Paper Treat Box
Gold Castle Candy Box Hollow Laser Cut Glitter Film Wedding Party Favors Gift Boxes Birthday Celebration Paper Treat Box
like
Find Similar
Golden glitter castle candy box with laser-cut hollow design for weddings and parties - Gold Castle (Glitter Film Castle Box-11)
Gold Castle Candy Box Hollow Laser Cut Glitter Film Wedding Party Favors Gift Boxes Birthday Celebration Paper Treat Box
$0.21
Mix MOQ : 50
It's A Girl Laser Cut Baby Shower Favor Box With Ribbon Heart Stroller Pattern Pearlescent Paper Candy Packaging For Newborn Party
It's A Girl Laser Cut Baby Shower Favor Box With Ribbon Heart Stroller Pattern Pearlescent Paper Candy Packaging For Newborn Party
like
Find Similar
White laser-cut baby shower candy box with It's A Girl text and ribbon bow - White
Pink laser-cut baby shower candy box with It's A Girl text and organza ribbon - Pink
Golden laser-cut baby shower candy box with It's A Girl text and stroller pattern - Gold
Purple laser-cut baby shower candy box with It's A Girl text and ribbon bow - Dark Purple
+5
It's A Girl Laser Cut Baby Shower Favor Box With Ribbon Heart Stroller Pattern Pearlescent Paper Candy Packaging For Newborn Party
$0.13
Mix MOQ : 50
Portable Candy Gift Box Paper Floral Print With Ribbon Handle For Wedding Party Engagement Favor
Portable Candy Gift Box Paper Floral Print With Ribbon Handle For Wedding Party Engagement Favor
like
Find Similar
Elegant green lily of the valley wedding candy gift box with silk ribbon handle - Small (10*6.5*6.2) / Green
Deep red and beige floral wedding candy gift box with a red ribbon and handle - Small (10*6.5*6.2) / Red
Elegant floral wedding candy gift box with red ribbon and wavy handle decoration - Small (10*6.5*6.2) / Red Organza Ribbon
Pink floral paper gift box with purple ribbon and Best Wishes text for wedding candy - Large (11.5*8*15) / Purple
+6
Portable Candy Gift Box Paper Floral Print With Ribbon Handle For Wedding Party Engagement Favor
-9%
$0.09-0.12
No MOQ
 · 
65 sold recently
Halloween Spider Web Portable Gift Box Cardboard Candy Packaging Box For Birthday Wedding Party Favors Red Black Handheld Box
Halloween Spider Web Portable Gift Box Cardboard Candy Packaging Box For Birthday Wedding Party Favors Red Black Handheld Box
like
Find Similar
Detail of red Halloween paper gift box featuring black spider and cobweb prints - Red with Black Spider (A026-1)
Red Spider-Man themed gift box with spider web patterns and handle for parties - Red Spider Web Style (A026-2)
Detail of red Spider-Man themed party gift box with spider web patterns and top handle - Red Large Spider Style (A026-3)
Detail of Spiderman style gift box with red spider web print and handle - Black with Red Spider (A026-4)
+2
Halloween Spider Web Portable Gift Box Cardboard Candy Packaging Box For Birthday Wedding Party Favors Red Black Handheld Box
$0.19
Mix MOQ : 12
 · 
10 views
Mr & Mr Laser Cut Wedding Candy Box White Cardstock Gift Box With Ribbon Bow For LGBTQ Valentine's Day Party Favors
Mr & Mr Laser Cut Wedding Candy Box White Cardstock Gift Box With Ribbon Bow For LGBTQ Valentine's Day Party Favors
like
Find Similar
Detailed close-up of white laser-cut Mr & Mr wedding candy box with a sheer organza ribbon bow - White
Mr & Mr Laser Cut Wedding Candy Box White Cardstock Gift Box With Ribbon Bow For LGBTQ Valentine's Day Party Favors
$0.13
Mix MOQ : 50
European Laser Cut Heart Hollow Candy Box Pearl Paper Gift Box For Wedding Valentine Day Party Favor Chocolate Packaging
European Laser Cut Heart Hollow Candy Box Pearl Paper Gift Box For Wedding Valentine Day Party Favor Chocolate Packaging
like
Find Similar
Hollow laser-cut heart pattern gold gift box for wedding candy and chocolate favors - Reflective Gold
Laser-cut silver heart candy gift box with elegant hollow design for wedding favors - Reflective Silver
Elegant laser-cut heart favor box in gold and white finish for wedding candy gifts - White
Elegant white laser-cut heart favor box with gold lining for weddings and luxury gifts - Ivory
+8
European Laser Cut Heart Hollow Candy Box Pearl Paper Gift Box For Wedding Valentine Day Party Favor Chocolate Packaging
$0.18
Mix MOQ : 50
Christmas Muffin Box With Clear Window Cardboard Cupcake Packaging Box Holiday Gift Box For Bakery Party Home Festive Decor
Christmas Muffin Box With Clear Window Cardboard Cupcake Packaging Box Holiday Gift Box For Bakery Party Home Festive Decor
like
Find Similar
Red Christmas cupcake box with clear PVC window and Santa Claus festive print pattern - Muffin Box 2 Holes Red.
Christmas kraft paper box with window and reindeer snowflake prints for muffins - Small Yellow (Reindeer)
Deep green Christmas muffin box with festive tree prints and clear PVC window - Small Green (Christmas Tree)
Blue Christmas cupcake box with snowman print and clear window for festive treats - Small Blue (Snowman)
+12
Christmas Muffin Box With Clear Window Cardboard Cupcake Packaging Box Holiday Gift Box For Bakery Party Home Festive Decor
$0.14-0.58
Mix MOQ : 5
 · 
100 sold recently
Christmas Drawer Gift Box Kraft Paper Candy Packaging Box Satin Ribbon Bow Santa Claus Reindeer Festive Party Favor Decor
Christmas Drawer Gift Box Kraft Paper Candy Packaging Box Satin Ribbon Bow Santa Claus Reindeer Festive Party Favor Decor
like
Find Similar
Christmas drawer candy box in dark green with reindeer design and a green satin bow - Dark Green Reindeer Style
Christmas drawer candy gift box featuring cartoon Santa Claus with a red satin bow accent - Red Santa Claus Style
Christmas Drawer Gift Box Kraft Paper Candy Packaging Box Satin Ribbon Bow Santa Claus Reindeer Festive Party Favor Decor
$0.24
Mix MOQ : 50
Laser Cut Birdcage Candy Box Wedding Favor Gift Box With Ribbon Heart Bird Pearlescent Paper Party Decoration Favor Boxes
Laser Cut Birdcage Candy Box Wedding Favor Gift Box With Ribbon Heart Bird Pearlescent Paper Party Decoration Favor Boxes
like
Find Similar
White laser-cut wedding favor box with birdcage design and sheer organza ribbon bow - 5x5x8CM / White
Pink laser-cut birdcage wedding candy favor box with white ribbon and bird heart patterns - 5x5x8CM / Pink
Macro detail of laser-cut birds inside a heart pattern on cream paper candy box - 5x5x8CM / Jewelry Cream Star
Laser-cut Tiffany blue birdcage candy box with heart-shaped birds and ribbon detail - 5x5x8CM / Tiffany Blue
+6
Laser Cut Birdcage Candy Box Wedding Favor Gift Box With Ribbon Heart Bird Pearlescent Paper Party Decoration Favor Boxes
$0.13
Mix MOQ : 50
Laser Cut Wedding Favor Candy Boxes With Ribbon Bride Groom Silhouette Paper Gift Boxes For Wedding Party Celebration
Laser Cut Wedding Favor Candy Boxes With Ribbon Bride Groom Silhouette Paper Gift Boxes For Wedding Party Celebration
like
Find Similar
White laser-cut wedding candy box with bride and groom silhouette and white ribbon - White
Close-up of pink laser-cut wedding favor box with bride silhouette and silk ribbon - Pink
Elegant gold laser-cut wedding favor box with silhouette design and ribbon - Gold
Elegant purple laser-cut wedding favor box featuring bride and groom silhouette and ribbon - Dark Purple
+2
Laser Cut Wedding Favor Candy Boxes With Ribbon Bride Groom Silhouette Paper Gift Boxes For Wedding Party Celebration
$0.14
Mix MOQ : 50
Cartoon Fairy Tale Castle House Shaped Paper Gift Box For Kids Birthday Party Favor Candy Cookie Folding Packaging Treat Bag
Cartoon Fairy Tale Castle House Shaped Paper Gift Box For Kids Birthday Party Favor Candy Cookie Folding Packaging Treat Bag
like
Find Similar
Hexagonal fairy tale castle gift box with red polka dot roof and yellow walls - Red (Castle Style)
Cartoon fairy tale castle gift box with green pointed roof and polka dot pattern - Green (Castle Style)
Orange polka dot roof house-shaped gift box with creative hollowed out doors and windows - Orange (Castle Style)
Yellow house-shaped gift box with blue polka dot roof and heart warming quote - Blue (House Style)
+1
Cartoon Fairy Tale Castle House Shaped Paper Gift Box For Kids Birthday Party Favor Candy Cookie Folding Packaging Treat Bag
$0.09
No MOQ
Square Cardboard Gift Boxes With Satin Ribbon Bow Wave Edge Foldable Candy Packaging For Wedding Party Favors Small
Square Cardboard Gift Boxes With Satin Ribbon Bow Wave Edge Foldable Candy Packaging For Wedding Party Favors Small
like
Find Similar
Elegant beige square paper gift box with decorative cream ribbon bow for soaps - Yellow
Light blue square paper gift box with beige ribbon bow and wavy cut-out design - Blue
Pink square gift box with cream silk ribbon and elegant wavy scalloped edge design - Pink
Square brown kraft paper gift box with a white ribbon bow and scalloped edge design - Original Color
+2
Square Cardboard Gift Boxes With Satin Ribbon Bow Wave Edge Foldable Candy Packaging For Wedding Party Favors Small
-7%
$0.13
Mix MOQ : 20
 · 
32 views
European Kraft Paper Candy Box With White Lace Pattern Satin Ribbon Bow Square DIY Gift Box For Wedding Party Favor Packaging
European Kraft Paper Candy Box With White Lace Pattern Satin Ribbon Bow Square DIY Gift Box For Wedding Party Favor Packaging
like
Find Similar
Square kraft paper candy box with white lace print and elegant satin ribbon bow - Lace Style With White Ribbon
European Kraft Paper Candy Box With White Lace Pattern Satin Ribbon Bow Square DIY Gift Box For Wedding Party Favor Packaging
$0.10
Mix MOQ : 50
Laser Cut Tiki Mask Candy Gift Box With Ribbon Bow Tropical Palm Tree Hollow Out Party Favor Box For Wedding Birthday
Laser Cut Tiki Mask Candy Gift Box With Ribbon Bow Tropical Palm Tree Hollow Out Party Favor Box For Wedding Birthday
like
Find Similar
Laser-cut black gift box featuring tropical Tiki mask patterns and a black organza ribbon - 5*5*8CM / Black
Laser-cut gold party gift box with Tiki mask hollow pattern and golden ribbon bow - 5*5*8CM / Gold
Laser-cut silver Tiki mask favor box with light blue ribbon for party candy and chocolate - 5*5*8CM / Silver
Close-up of white laser-cut favor box featuring Tiki mask patterns and a ribbon bow - 5*5*8CM / White
+2
Laser Cut Tiki Mask Candy Gift Box With Ribbon Bow Tropical Palm Tree Hollow Out Party Favor Box For Wedding Birthday
$0.13
Mix MOQ : 50
Vintage Easter Tinplate Gift Box With Handle Retro Rabbit Floral Printed Metal Storage Box For Holiday Treats Favors
Vintage Easter Tinplate Gift Box With Handle Retro Rabbit Floral Printed Metal Storage Box For Holiday Treats Favors
like
Find Similar
Easter garden tin gift box with a green handle and bunny pattern on white background - Easter Handheld Tin Box Type A
Purple Easter bunny tin gift box with handle and decorative floral egg patterns - Purple Easter Greeting Style (Style B)
Easter bunny tin gift box with green handle and vintage floral patterns for cookies - Easter Handheld Tin Box Type C
Vintage Easter rabbit tin gift box with blue metal handle and floral bunny illustrations - Peter Rabbit Inspired Pastoral Style (Style D)
+2
Vintage Easter Tinplate Gift Box With Handle Retro Rabbit Floral Printed Metal Storage Box For Holiday Treats Favors
$1.15
No MOQ
 · 
16 views
Graduation Paper Gift Box With Satin Ribbon Bowknot Doctoral Hat Window Hollow-out Candy Boxes For Graduation Party Favors Congrats Grad Packaging Box
Graduation Paper Gift Box With Satin Ribbon Bowknot Doctoral Hat Window Hollow-out Candy Boxes For Graduation Party Favors Congrats Grad Packaging Box
like
Find Similar
Orange and white graduation gift box with graduation cap prints and silk ribbon - Orange
European graduation gift box with graduation cap patterns and red silk ribbon decoration - Red
Blue and white graduation gift box with bow and Congrats text on a white background - Blue
Forest green graduation gift box with bow and hand-drawn academic cap patterns - Green
+2
Graduation Paper Gift Box With Satin Ribbon Bowknot Doctoral Hat Window Hollow-out Candy Boxes For Graduation Party Favors Congrats Grad Packaging Box
$0.11
Mix MOQ : 50
Triangular Pyramid Gift Box With Ribbon Fortune Cat Calligraphy Pattern Candy Packaging For Wedding Party Favor Cardboard Case
Triangular Pyramid Gift Box With Ribbon Fortune Cat Calligraphy Pattern Candy Packaging For Wedding Party Favor Cardboard Case
like
Find Similar
Triangle gift box featuring a cartoon lucky cat design and a red ribbon handle - Fortune Cat / 12.5x12.5x12cm
NewTriangular Pyramid Gift Box With Ribbon Fortune Cat Calligraphy Pattern Candy Packaging For Wedding Party Favor Cardboard Case
$0.10
No MOQ
Creative Handbag Shaped Candy Boxes Paper Bronzing Polka Dots Bow Gift Box Wedding Party Favor Celebration European Style
Creative Handbag Shaped Candy Boxes Paper Bronzing Polka Dots Bow Gift Box Wedding Party Favor Celebration European Style
like
Find Similar
Light blue gift box with gold polka dots and bow tie, elegant wedding candy bag design - Light Blue Polka Dot
Navy blue gift box with gold foil polka dots and a large decorative bow handle - Dark Blue Polka Dot
Elegant white wedding favor box with gold foil polka dots and a decorative bow handle - Champagne Polka Dot
Elegant dark green gift box with gold foil dots and bow on a white background - Green Polka Dot
+2
Creative Handbag Shaped Candy Boxes Paper Bronzing Polka Dots Bow Gift Box Wedding Party Favor Celebration European Style
$0.12
Mix MOQ : 100
 · 
43 views
Gold Glitter Laser Cut Castle Candy Boxes Wedding Party Decoration Pearl Paper Hollow Heart Star Gift Packaging Box
Gold Glitter Laser Cut Castle Candy Boxes Wedding Party Decoration Pearl Paper Hollow Heart Star Gift Packaging Box
like
Find Similar
Golden glitter castle candy box with laser-cut hollow details for wedding party favors - Glitter Gold
Gold Glitter Laser Cut Castle Candy Boxes Wedding Party Decoration Pearl Paper Hollow Heart Star Gift Packaging Box
$0.21
Mix MOQ : 50
Envelope Gift Box With Satin Ribbon Bow Paper Packaging For Scarf Stationery Elegant Folding Birthday Wedding Favor
Envelope Gift Box With Satin Ribbon Bow Paper Packaging For Scarf Stationery Elegant Folding Birthday Wedding Favor
like
Find Similar
Elegant pale yellow envelope gift box with a matching silk ribbon bow on white silk - Beige
Orange luxury gift bag with black trim and beige ribbon bow on white silk fabric - Orange
Elegant grey pearl cardstock envelope gift box featuring a yellow satin ribbon bow - Light Gray
Elegant black envelope gift box for scarves with a pale yellow silk ribbon bow - Dark Gray
+3
Envelope Gift Box With Satin Ribbon Bow Paper Packaging For Scarf Stationery Elegant Folding Birthday Wedding Favor
$0.58
No MOQ
 · 
101 sold recently
European Vintage Crown Shape Gift Box Bronzing Paper Candy Box With Ribbon For Wedding Party Perfume Packaging
European Vintage Crown Shape Gift Box Bronzing Paper Candy Box With Ribbon For Wedding Party Perfume Packaging
like
Find Similar
Pink crown-shaped gift box with gold foil vintage patterns and elegant handle - Medium / Pink
Elegant green crown gift box with gold foil patterns for perfume and candy packaging - Medium / Green
European crown gift box with gold foil vintage patterns for wedding favors - Medium / Yellow
European Vintage Crown Shape Gift Box Bronzing Paper Candy Box With Ribbon For Wedding Party Perfume Packaging
-4%
$0.24
No MOQ
Kraft Paper Wedding Candy Boxes Valentine's Day Heart Pattern Portable Gift Box With Twine And Tags Party Favor Boxes For Treats XOXO
Kraft Paper Wedding Candy Boxes Valentine's Day Heart Pattern Portable Gift Box With Twine And Tags Party Favor Boxes For Treats XOXO
like
Find Similar
Brown kraft paper gift box with handle heart tag and XOXO print for wedding candy - Kraft Handheld Box / Natural Brown (XOXO)
White kraft paper wedding favor box with red heart patterns and 'FOR YOU' gift tag - White Handheld Box / White (Heart Arrow)
Kraft Paper Wedding Candy Boxes Valentine's Day Heart Pattern Portable Gift Box With Twine And Tags Party Favor Boxes For Treats XOXO
$0.22
Mix MOQ : 50
Vintage Kraft Paper Pillow Candy Boxes With Gold Ribbon For Wedding Party Favor Mini Gift Packaging Treat Boxes
Vintage Kraft Paper Pillow Candy Boxes With Gold Ribbon For Wedding Party Favor Mini Gift Packaging Treat Boxes
like
Find Similar
Elegant kraft paper pillow gift box with a gold ribbon for wedding candy and small favors - Kraft Paper with Gold Ribbon
Vintage Kraft Paper Pillow Candy Boxes With Gold Ribbon For Wedding Party Favor Mini Gift Packaging Treat Boxes
$0.06
Mix MOQ : 5
European Laser Cut Wedding Favor Candy Boxes Mr & Mrs Couple Silhouette Pearl Paper Gift Box With Ribbon For Bridal Party
European Laser Cut Wedding Favor Candy Boxes Mr & Mrs Couple Silhouette Pearl Paper Gift Box With Ribbon For Bridal Party
like
Find Similar
Elegant red laser-cut wedding candy box with MR & MRS text and matching ribbon - Pearlescent Red
Silver laser-cut Mr & Mrs wedding favor box with a light blue silk ribbon decoration - Reflective Silver
White laser-cut wedding favor box featuring Mr & Mrs silhouettes with a white ribbon bow - White
Pink laser-cut wedding favor box with Mr & Mrs silhouette and white ribbon bow - Pink
+11
European Laser Cut Wedding Favor Candy Boxes Mr & Mrs Couple Silhouette Pearl Paper Gift Box With Ribbon For Bridal Party
$0.12
Mix MOQ : 50
White Cardboard Ramadan Eid Hand-held Gift Boxes Moon Star Lantern Pattern Cartoon Festive Party Favor Candy Packaging Boxes
White Cardboard Ramadan Eid Hand-held Gift Boxes Moon Star Lantern Pattern Cartoon Festive Party Favor Candy Packaging Boxes
like
Find Similar
White Eid themed paper gift box with colorful moon and floral prints for desserts - Ramadan Lantern Floral Pattern Style (S904)
Detail of Eid party gift boxes with gold crescent moon and star patterns and handles - Ramadan Moon Star Rose Pattern Style (S715)
White Cardboard Ramadan Eid Hand-held Gift Boxes Moon Star Lantern Pattern Cartoon Festive Party Favor Candy Packaging Boxes
$0.81
Mix MOQ : 2
Laser Cut Cross Pattern Hollow Candy Box With Ribbon Thank You Tag For Wedding Baptism Religious Celebration Gift Box
Laser Cut Cross Pattern Hollow Candy Box With Ribbon Thank You Tag For Wedding Baptism Religious Celebration Gift Box
like
Find Similar
White laser-cut wedding favor box with cross pattern, ribbon, and Thank You tag - White
Hollow laser-cut white wedding candy box with cross pattern and thank you tag - Ivory
Laser Cut Cross Pattern Hollow Candy Box With Ribbon Thank You Tag For Wedding Baptism Religious Celebration Gift Box
$0.14
Mix MOQ : 50
Portable Diwali Festival Gift Boxes Traditional Peacock Print White Cardboard Sweet Cake Handheld Packaging Gift Box
Portable Diwali Festival Gift Boxes Traditional Peacock Print White Cardboard Sweet Cake Handheld Packaging Gift Box
like
Find Similar
Macro side view of purple Diwali gift box with Happy Festival of Lights handle - Purple Peacock (A034-1)
Red Happy Diwali paper gift box featuring peacock and diya patterns for festival candy - Red Ganesha (A034-4)
Purple Happy Diwali gift box with peacock feather patterns and sturdy handles - Purple Diya (A034-2)
Pink Happy Diwali gift box with golden mandala patterns and convenient handle - Pink Mandala (A034-3)
Portable Diwali Festival Gift Boxes Traditional Peacock Print White Cardboard Sweet Cake Handheld Packaging Gift Box
$0.19
Mix MOQ : 12
Glitter Candy Gift Boxes With Ribbon And Artificial Pearl For Wedding Engagement Party French Style Elegant Favor Box
Glitter Candy Gift Boxes With Ribbon And Artificial Pearl For Wedding Engagement Party French Style Elegant Favor Box
like
Find Similar
12 options
Glitter Candy Gift Boxes With Ribbon And Artificial Pearl For Wedding Engagement Party French Style Elegant Favor Box
$0.17-0.24
No MOQ
 · 
201 sold recently
Romantic Butterfly Gift Box 3D Handle White Cardboard Candy Box For Wedding Birthday Party Floral Packaging Treat Box
Romantic Butterfly Gift Box 3D Handle White Cardboard Candy Box For Wedding Birthday Party Floral Packaging Treat Box
like
Find Similar
Pastel purple butterfly gift box with 3D gold-trimmed butterfly handle and floral prints - Purple Butterfly Handheld Box
Pink gradient gift box with 3D butterfly handle and floral patterns for party favors - Pink Butterfly Handheld Box
Romantic Butterfly Gift Box 3D Handle White Cardboard Candy Box For Wedding Birthday Party Floral Packaging Treat Box
$0.24
Mix MOQ : 50
Hollow Candy Gift Boxes Laser Cut Paper Rose Flower Pattern Ribbon Bow Wedding Party Favor Elegant Decorative Boxes
Hollow Candy Gift Boxes Laser Cut Paper Rose Flower Pattern Ribbon Bow Wedding Party Favor Elegant Decorative Boxes
like
Find Similar
Elegant beige laser-cut floral candy box with ribbon bow on white background - Ivory
Detail of laser-cut rose hollow candy box in gold paper with a matching silk ribbon - Reflective Gold
Silver laser-cut floral wedding favor box with a light blue satin ribbon bow detail - Reflective Silver
Close-up of golden laser-cut wedding favor box with floral patterns and a ribbon bow - Gold
+11
Hollow Candy Gift Boxes Laser Cut Paper Rose Flower Pattern Ribbon Bow Wedding Party Favor Elegant Decorative Boxes
$0.13
Mix MOQ : 50
 · 
41 views
European Style Groom Tuxedo And Bride Dress Wedding Candy Gift Box Creative Party Favors Paper Treat Box For Guests Decoration
European Style Groom Tuxedo And Bride Dress Wedding Candy Gift Box Creative Party Favors Paper Treat Box For Guests Decoration
like
Find Similar
2 options
European Style Groom Tuxedo And Bride Dress Wedding Candy Gift Box Creative Party Favors Paper Treat Box For Guests Decoration
-11%
$0.08
No MOQ
Butterfly Laser Cut Candy Gift Box Artificial Pearl Paper With Ribbon For Wedding Party Celebration Favors Elegant Hollow Out
Butterfly Laser Cut Candy Gift Box Artificial Pearl Paper With Ribbon For Wedding Party Celebration Favors Elegant Hollow Out
like
Find Similar
Laser-cut white wedding favor box with butterfly design and translucent ribbon bow - White
Elegant white laser-cut butterfly favor box with ribbon for wedding and party candy - Ivory
Laser cut butterfly candy box with pink ribbon for wedding favors and gift packaging - Jade Pearl
Detailed laser-cut gold butterfly candy box with a satin ribbon and white floral decor - Gold
+8
Butterfly Laser Cut Candy Gift Box Artificial Pearl Paper With Ribbon For Wedding Party Celebration Favors Elegant Hollow Out
-7%
$0.13
Mix MOQ : 50
 · 
24 views
Hollow Bear Candy Boxes Laser Cut Pearlescent Paper Gift Box With Ribbon Thank You Tags For Wedding Baby Shower Party
Hollow Bear Candy Boxes Laser Cut Pearlescent Paper Gift Box With Ribbon Thank You Tags For Wedding Baby Shower Party
like
Find Similar
Detail of white hollow bear favor box with ribbon and gold Thank You gift tag - White
Macro shot of pink laser-cut baby shower candy box with ribbon and thank you tag - Pink
Yellow laser-cut teddy bear party gift box with golden ribbon bow and thank you tag - Gold
Close-up of white cutout hollow favor box with bear pattern and pearl ribbon detail - Ivory
+4
Hollow Bear Candy Boxes Laser Cut Pearlescent Paper Gift Box With Ribbon Thank You Tags For Wedding Baby Shower Party
-7%
$0.13
Mix MOQ : 50
 · 
10 views
Gift Box Embossed Paper Gold Stamping Ribbon Bow Merci Beaucoup Folding Candy Packaging Wedding Party Favor Decorative
Gift Box Embossed Paper Gold Stamping Ribbon Bow Merci Beaucoup Folding Candy Packaging Wedding Party Favor Decorative
like
Find Similar
Elegant white textured gift box with orange ribbon and merci beaucoup gold foil printing - White Embossed/5.7x6x10cm
Gift Box Embossed Paper Gold Stamping Ribbon Bow Merci Beaucoup Folding Candy Packaging Wedding Party Favor Decorative
-6%
$0.14
No MOQ
 · 
114 sold recently
Laser Cut Heart Hollow Candy Box With Ribbon Pearlescent Paper Wedding Gift Box Romantic Party Favor Packaging Box
Laser Cut Heart Hollow Candy Box With Ribbon Pearlescent Paper Wedding Gift Box Romantic Party Favor Packaging Box
like
Find Similar
European laser cut white wedding favor box with heart patterns and satin ribbon bow - White
Elegant laser-cut cream wedding candy box with heart pattern and white silk ribbon bow - Ivory
Pink heart-shaped laser-cut wedding favor box with a delicate light pink ribbon bow - Pink
Macro shot of laser-cut heart pattern on yellow pearlescent paper wedding favor gift box - Gold
+4
Laser Cut Heart Hollow Candy Box With Ribbon Pearlescent Paper Wedding Gift Box Romantic Party Favor Packaging Box
$0.13
Mix MOQ : 50
Floral Fan Design Handheld Paper Gift Box White Cardstock Folding Candy Packaging For Wedding Birthday Party Favors
Floral Fan Design Handheld Paper Gift Box White Cardstock Folding Candy Packaging For Wedding Birthday Party Favors
like
Find Similar
Floral print paper gift box with yellow handle for mooncakes and festive candy packaging - Fresh Gardenia / 9x6x8cm
Floral Fan Design Handheld Paper Gift Box White Cardstock Folding Candy Packaging For Wedding Birthday Party Favors
-47%
$0.10
Mix MOQ : 2
European Robin Egg Blue Wedding Candy Box Square Paper Gift Box With White Satin Ribbon Bowknot For Party Favor Jewelry
European Robin Egg Blue Wedding Candy Box Square Paper Gift Box With White Satin Ribbon Bowknot For Party Favor Jewelry
like
Find Similar
European tiffany blue wedding candy box with elegant white ribbon bow on white plate - Top and Bottom Lid Style / Robin Egg Blue (With White Ribbon)
European Robin Egg Blue Wedding Candy Box Square Paper Gift Box With White Satin Ribbon Bowknot For Party Favor Jewelry
-8%
$0.11
No MOQ
Heart Shaped Gift Boxes Marble Pattern Paper With Gold Trim For Birthday Valentine Anniversary Wedding Gifts
Heart Shaped Gift Boxes Marble Pattern Paper With Gold Trim For Birthday Valentine Anniversary Wedding Gifts
like
Find Similar
Three-piece heart-shaped gift box set with black marble pattern and golden trim details - Black 3-Piece Set
Three-piece heart-shaped gift box set with white marble pattern on knit background - White 3-Piece Set
Heart Shaped Gift Boxes Marble Pattern Paper With Gold Trim For Birthday Valentine Anniversary Wedding Gifts
$3.71
Mix MOQ : 5
 · 
83 views
Christmas Pyramid Gift Box Triangular Candy Packaging Box With Ribbon Pinecone For Christmas Eve Holiday Party Favor
Christmas Pyramid Gift Box Triangular Candy Packaging Box With Ribbon Pinecone For Christmas Eve Holiday Party Favor
like
Find Similar
Dark green triangular Christmas gift box with festive patterns and star ornament - Christmas Small Gift (HB0029)
Christmas Pyramid Gift Box Triangular Candy Packaging Box With Ribbon Pinecone For Christmas Eve Holiday Party Favor
$0.17
No MOQ
Bee Theme Honeycomb Window Cardboard Gift Box For Chocolate Candy Biscuit Wedding Baby Shower Party Favor Packaging
Bee Theme Honeycomb Window Cardboard Gift Box For Chocolate Candy Biscuit Wedding Baby Shower Party Favor Packaging
like
Find Similar
Square yellow bee-themed gift box with honeycomb windows and internal chocolate dividers - Bee Chocolate Box Style
Bee Theme Honeycomb Window Cardboard Gift Box For Chocolate Candy Biscuit Wedding Baby Shower Party Favor Packaging
$0.52
Mix MOQ : 50
Heart Shaped Top Pearlescent Paper Candy Boxes Square Bottom Elegant Wedding Party Favor Gift Packaging Foldable Cardstock
Heart Shaped Top Pearlescent Paper Candy Boxes Square Bottom Elegant Wedding Party Favor Gift Packaging Foldable Cardstock
like
Find Similar
Set of six purple pearlescent paper candy boxes with a creative heart-shaped top closure - Purple
Set of 6 peach pink square gift boxes with interlocking heart shaped closure tops - Pink
Set of six white heart-shaped pearl paper candy boxes for wedding favors and gifts - White
Dark red pearlescent paper candy boxes with heart-shaped seal in a 6-piece pack - Dark Red
+1
Heart Shaped Top Pearlescent Paper Candy Boxes Square Bottom Elegant Wedding Party Favor Gift Packaging Foldable Cardstock
$0.05
Mix MOQ : 50
 · 
86 sold recently
Laser Cut Hollow Wedding Candy Box Heart Rose Paper Gift Box With Ribbon And Thank You Tags For Valentine Party Favors
Laser Cut Hollow Wedding Candy Box Heart Rose Paper Gift Box With Ribbon And Thank You Tags For Valentine Party Favors
like
Find Similar
Laser-cut white wedding favor box with silhouette design and thank you ribbon tag - White
Close-up of laser-cut wedding favor box with ribbon and golden Thank You tag - Ivory
Pink laser-cut wedding favor box with cutout silhouettes and thank you tag ribbon - Pink
Laser cut wedding favor box in Tiffany blue with ribbon and Thank You tag detail - Tiffany Blue
+5
Laser Cut Hollow Wedding Candy Box Heart Rose Paper Gift Box With Ribbon And Thank You Tags For Valentine Party Favors
$0.14
Mix MOQ : 50
Easter Twelve Grids DIY Surprise Blind Box White Cardboard Cartoon Rabbit Carrot Poke Fun Gift Packaging Box Party Supplies Holiday Surprise
Easter Twelve Grids DIY Surprise Blind Box White Cardboard Cartoon Rabbit Carrot Poke Fun Gift Packaging Box Party Supplies Holiday Surprise
like
Find Similar
Rectangle Easter surprise blind box with 12 grids and colorful cartoon rabbit illustrations - Hb0096-12-compartment Blind Box With Rabbit And Carrot Design; 13*17*4cm
Easter Twelve Grids DIY Surprise Blind Box White Cardboard Cartoon Rabbit Carrot Poke Fun Gift Packaging Box Party Supplies Holiday Surprise
-4%
$1.35
No MOQ
Laser Cut Birdcage Paper Chocolate Wrap Pearlescent Hollow Candy Decoration For Wedding Valentine Party Favor Accessories
Laser Cut Birdcage Paper Chocolate Wrap Pearlescent Hollow Candy Decoration For Wedding Valentine Party Favor Accessories
like
Find Similar
White laser cut paper chocolate wrapper in elegant birdcage design for wedding decor - White
Close-up of pink laser-cut birdcage candy box with pearl paper floral patterns - Pink
European style gold laser-cut birdcage candy box with elegant floral pattern and bird detail - Gold
Deep purple laser-cut wedding favor box with birdcage design and chocolate inside - Dark Purple
+6
Laser Cut Birdcage Paper Chocolate Wrap Pearlescent Hollow Candy Decoration For Wedding Valentine Party Favor Accessories
$0.09
Mix MOQ : 50
Eid Mubarak Hollow Candy Box Laser Cut Pearlescent Paper Gift Box With Ribbon Moon Star Palace Design For Wedding Ramadan Party Favor
Eid Mubarak Hollow Candy Box Laser Cut Pearlescent Paper Gift Box With Ribbon Moon Star Palace Design For Wedding Ramadan Party Favor
like
Find Similar
Golden Eid Mubarak gift box with hollow mosque design and elegant ribbon bow - 5*5*8CM / Reflective Gold
Silver Eid Mubarak gift box with laser-cut mosque design and a grey satin ribbon bow - 5*5*8CM / Reflective Silver
Eid Mubarak Hollow Candy Box Laser Cut Pearlescent Paper Gift Box With Ribbon Moon Star Palace Design For Wedding Ramadan Party Favor
$0.13
Mix MOQ : 50
Wedding Candy Gift Box Paper Hexagon With Wooden Ring Handle Ribbon Bow Gold Stamping Favor Packaging For Party Guests
Wedding Candy Gift Box Paper Hexagon With Wooden Ring Handle Ribbon Bow Gold Stamping Favor Packaging For Party Guests
like
Find Similar
Elegant burgundy hexagonal wedding candy box with wooden handle and gold floral pattern - Wooden Ring Handle / Burgundy (European Style)
Elegant hexagonal wedding favor box with wooden ring handle and pink silk ribbon bow - Wooden Ring Handle / Beige European Style + Pink Ribbon
Elegant cream wedding gift box with wooden ring handle and blue ribbon bow decoration - Wooden Ring Handle / Beige European Style + Blue Ribbon
Elegant geometric cream gift box with wood ring handle and dark green satin bow - Wooden Ring Handle / Beige European Style + Green Ribbon
+2
Wedding Candy Gift Box Paper Hexagon With Wooden Ring Handle Ribbon Bow Gold Stamping Favor Packaging For Party Guests
$0.27
Mix MOQ : 2
 · 
231 sold recently
Square Candy Boxes Cardboard Gift Boxes With Ribbons For Wedding Party Favors Elegant European Style Cube Containers
Square Candy Boxes Cardboard Gift Boxes With Ribbons For Wedding Party Favors Elegant European Style Cube Containers
like
Find Similar
Square gold candy gift box with reflective mirror finish and matching ribbon bow decoration - Gold + Ribbon
Square silver mirror gift box with satin ribbon bow on white decorative background - Silver + Ribbon
Elegant square black gift box with matching silk ribbon bow for wedding candy - Black + Ribbon
Deep blue square gift box with matching silk ribbon and bow on white surface - Navy Blue + Ribbon
+2
Square Candy Boxes Cardboard Gift Boxes With Ribbons For Wedding Party Favors Elegant European Style Cube Containers
$0.12
Mix MOQ : 50
House Shaped Gift Boxes With Hemp Rope White Kraft Paper Hollow Window DIY Candy Packaging Boxes For Wedding Party Christmas
House Shaped Gift Boxes With Hemp Rope White Kraft Paper Hollow Window DIY Candy Packaging Boxes For Wedding Party Christmas
like
Find Similar
White house-shaped gift box with hollow windows and rustic hemp rope handle - House Style / White
Minimalist house-shaped brown kraft paper gift box with cutout windows and hemp rope - House Style / Natural Kraft Color
House Shaped Gift Boxes With Hemp Rope White Kraft Paper Hollow Window DIY Candy Packaging Boxes For Wedding Party Christmas
-12%
$1.32
No MOQ
Diwali Hollow Candy Boxes Laser Cut Cardboard Gift Packaging Chocolate Containers Wedding Party Festive Decor
Diwali Hollow Candy Boxes Laser Cut Cardboard Gift Packaging Chocolate Containers Wedding Party Festive Decor
like
Find Similar
Elegant white and gold Diwali laser-cut hollow gift box on a porcelain plate - White
Lace hollow Diwali gift box in bright gold finish on a decorative porcelain plate - Reflective Gold
Elegant laser-cut silver and gold Diwali gift box with Happy Diwali cutout on porcelain - Reflective Silver
Pink and gold hollow Diwali gift box with Happy Diwali text on a ceramic plate - Pink
+4
Diwali Hollow Candy Boxes Laser Cut Cardboard Gift Packaging Chocolate Containers Wedding Party Festive Decor
$0.18
Mix MOQ : 50
 · 
10 views
Heart Shaped Elephant Laser Hollow Candy Box Pearlescent Paper Gift Box With Ribbon For Wedding Birthday Party Favors
Heart Shaped Elephant Laser Hollow Candy Box Pearlescent Paper Gift Box With Ribbon For Wedding Birthday Party Favors
like
Find Similar
White heart-shaped elephant candy box with laser-cut patterns and a silk ribbon bow - White
Pearlescent white heart-shaped candy box with golden elephant and silk ribbon for parties - Ivory
Macro shot of ivory pearlescent heart candy box with laser-cut elephant and organza ribbon - Jewelry Cream Star
Pink heart-shaped elephant candy box with white organza ribbon for party favors - Pink
+5
Heart Shaped Elephant Laser Hollow Candy Box Pearlescent Paper Gift Box With Ribbon For Wedding Birthday Party Favors
$0.12
Mix MOQ : 50
Minimalist Handheld Paper Gift Packaging Box With Handle Gold Foil Thank You Print Versatile Treat Box For Cookies Snacks
Minimalist Handheld Paper Gift Packaging Box With Handle Gold Foil Thank You Print Versatile Treat Box For Cookies Snacks
like
Find Similar
Minimalist square gift box set with leather handle and gold foil stamping for festival gifts - White and Dark Green (СПАСИБО) / Small (14x6x20cm)
Minimalist Handheld Paper Gift Packaging Box With Handle Gold Foil Thank You Print Versatile Treat Box For Cookies Snacks
$0.14
No MOQ
Christmas Snowman Laser Cut Candy Box With Ribbon Pearlescent Paper Gift Boxes For Holiday Wedding Party Favors
Christmas Snowman Laser Cut Candy Box With Ribbon Pearlescent Paper Gift Boxes For Holiday Wedding Party Favors
like
Find Similar
Detailed laser-cut white Christmas favor box with snowman motif and large white ribbon bow - White
Green Christmas snowman gift box with laser-cut design and satin ribbon bow decoration - Dark Green
Champagne laser-cut snowman gift box with organza ribbon for Christmas candy - Gold
Red Christmas snowman hollow gift box with ribbon for festive candy and chocolate packaging - Pearlescent Red
+2
Christmas Snowman Laser Cut Candy Box With Ribbon Pearlescent Paper Gift Boxes For Holiday Wedding Party Favors
$0.13
Mix MOQ : 50
Cute Cartoon Square Candy Box Cardboard Packaging For Cake Chocolate Cookie Birthday Party Treat Box Korean Style Gift Case
Cute Cartoon Square Candy Box Cardboard Packaging For Cake Chocolate Cookie Birthday Party Treat Box Korean Style Gift Case
like
Find Similar
Green and brown checkered gift box featuring a cute cartoon rabbit and inspirational text - Cartoon Rabbit Green
Blue and white checkered square candy box with cartoon cat for gift packaging - Cat Grey
Cute Cartoon Square Candy Box Cardboard Packaging For Cake Chocolate Cookie Birthday Party Treat Box Korean Style Gift Case
$0.10
No MOQ
Go to

More in party supplies

Explore more in transparent gift boxes

partyplasticgoldartificialdiycakecardpetdisplaysmall
holidaystoragehomesanta clauskidsstorage boxtreesolid colorstylestar

Ready to source like an insider

Get a direct line to the factory floor — no minimums, no middlemen, no guesswork.
iconReal factory pricing, no markup in betweeniconEvery order hand-inspected before it shipsicon5,000+ new products added daily
Get Inside Access