Everful

Wholesale toe rings

Factory-direct selection, vetted for quality and ready to order.

Sign Up
Toe Rings

Find the perfect pieces: stainless steel rings, copper rings, alloy rings and more

All products in toe rings

filterShow Filters
Price Drop
Free Shipping
Best Seller
New Arrivals
Elegant Alloy Green Rhinestone Rings Collection Gold Plated Geometric Floral Wedding Banquet Engagement Finger Ring For Women
Elegant Alloy Green Rhinestone Rings Collection Gold Plated Geometric Floral Wedding Banquet Engagement Finger Ring For Women
like
Find Similar
5 options
Elegant Alloy Green Rhinestone Rings Collection Gold Plated Geometric Floral Wedding Banquet Engagement Finger Ring For Women
$1.18
No MOQ
 · 
53 sold recently
Free Shipping
Vintage Stainless Steel Double Koi Fish Ring Retro Chinese Style Carp Punk Band Ring Antique Silver Jewelry For Men Women
Vintage Stainless Steel Double Koi Fish Ring Retro Chinese Style Carp Punk Band Ring Antique Silver Jewelry For Men Women
like
Find Similar
6 options
Vintage Stainless Steel Double Koi Fish Ring Retro Chinese Style Carp Punk Band Ring Antique Silver Jewelry For Men Women
-4%
$3.24
No MOQ
Free Shipping
Minimalist Copper Crown Cross Open Ring For Women Adjustable Rhinestone Geometric Finger Ring Fashion Jewelry Gift
Minimalist Copper Crown Cross Open Ring For Women Adjustable Rhinestone Geometric Finger Ring Fashion Jewelry Gift
like
Find Similar
Elegant gold crown-shaped adjustable copper ring with sparkling zircon stones - Gold
Silver crown cross open ring with cubic zirconia stones in a minimalist design - Silver
Minimalist Copper Crown Cross Open Ring For Women Adjustable Rhinestone Geometric Finger Ring Fashion Jewelry Gift
$1.31
Mix MOQ : 2
Free Shipping
Stainless Steel Square Ring Base Tray Adjustable Open Finger Ring Gold Silver Bezel Setting For DIY Jewelry Accessories
Stainless Steel Square Ring Base Tray Adjustable Open Finger Ring Gold Silver Bezel Setting For DIY Jewelry Accessories
like
Find Similar
Detailed size chart for square stainless steel ring base with adjustable band for DIY - Silver Style (J962-S)
Macro detail of adjustable square gold ring base showing precise dimensions for DIY jewelry - Gold Style (J962-G)
Stainless Steel Square Ring Base Tray Adjustable Open Finger Ring Gold Silver Bezel Setting For DIY Jewelry Accessories
$0.31-0.52
Mix MOQ : 2
 · 
15 sold recently
Free Shipping
Minimalist Stainless Steel Rings For Men Wide Band Hammered Honeycomb Texture Geometric Fashion Casual Finger Jewelry
Minimalist Stainless Steel Rings For Men Wide Band Hammered Honeycomb Texture Geometric Fashion Casual Finger Jewelry
like
Find Similar
Men's wide stainless steel ring featuring textured honeycomb design and polished finish - US 7 / Steel
Polished wide gold stainless steel men's ring with hammered honeycomb texture design - US 7 / Gold
+12
Minimalist Stainless Steel Rings For Men Wide Band Hammered Honeycomb Texture Geometric Fashion Casual Finger Jewelry
$3.67-3.93
Mix MOQ : 3
Free Shipping
Vintage Titanium Steel Eagle Ring For Men Women Distressed Gothic Punk Jewelry Feather Texture Relief Animal Band Ring
Vintage Titanium Steel Eagle Ring For Men Women Distressed Gothic Punk Jewelry Feather Texture Relief Animal Band Ring
like
Find Similar
10 options
Vintage Titanium Steel Eagle Ring For Men Women Distressed Gothic Punk Jewelry Feather Texture Relief Animal Band Ring
-5%
$3.19-3.68
No MOQ
Free Shipping
Trendy Copper Adjustable Open Rings For Women Cubic Zirconia Faux Artificial Pearl Heart Bow Star Finger Jewelry Accessory
Trendy Copper Adjustable Open Rings For Women Cubic Zirconia Faux Artificial Pearl Heart Bow Star Finger Jewelry Accessory
like
Find Similar
Silver star-shaped open ring featuring three sparkling zircons in a stylish design - Silver Triple Star Zirconia Ring (8231)
Adjustable gold honeycomb ring with brilliant round zircon in classic four-prong setting - Gold Honeycomb Prong Ring (4526)
Silver bow ring with hexagonal honeycomb band and sparkling central round diamond - Silver Honeycomb Prong Ring (4527)
Minimalist gold bow ring with opal and pearl beaded band set on elegant fabric - Gemstone Pearl Ring Set (9621)
+169
Trendy Copper Adjustable Open Rings For Women Cubic Zirconia Faux Artificial Pearl Heart Bow Star Finger Jewelry Accessory
-26%
$0.26-1.79
No MOQ
 · 
153 sold recently
Free Shipping
Cute Fruit Stainless Steel Open Ring Adjustable Enamel Strawberry Cherry Finger Ring For Women Sweet Pastoral Jewelry
Cute Fruit Stainless Steel Open Ring Adjustable Enamel Strawberry Cherry Finger Ring For Women Sweet Pastoral Jewelry
like
Find Similar
Macro shot of an adjustable gold ring featuring vibrant red strawberry enamel charms - Strawberry Style (S-R853-caomei)
Macro shot of an adjustable gold ring featuring red cherry enamel patterns on a white base - Cherry Style (S-R853-yingtao)
Cute Fruit Stainless Steel Open Ring Adjustable Enamel Strawberry Cherry Finger Ring For Women Sweet Pastoral Jewelry
$1.63
No MOQ
 · 
1 reviews
Free Shipping
8mm American Flag Ring For Men Titanium Steel Electroplated Band Ring Gold Silver Patriotic Jewelry Independence Day Gift
8mm American Flag Ring For Men Titanium Steel Electroplated Band Ring Gold Silver Patriotic Jewelry Independence Day Gift
like
Find Similar
Golden 8mm wide stainless steel ring with laser engraved American flag pattern - US 6 / Gold
8mm stainless steel ring for men featuring an engraved American flag pattern design - US 6 / Silver
+14
8mm American Flag Ring For Men Titanium Steel Electroplated Band Ring Gold Silver Patriotic Jewelry Independence Day Gift
$0.39-0.52
No MOQ
 · 
31 sold recently
Vintage Viking Bird Skull Ring Stainless Steel Norse Compass Valknut Gothic Punk Men Biker Finger Ring Jewelry
Vintage Viking Bird Skull Ring Stainless Steel Norse Compass Valknut Gothic Punk Men Biker Finger Ring Jewelry
like
Find Similar
Golden Viking crow skull ring with Vegvisir compass and Valknut symbols in punk style - US 7 / Gold
Vintage stainless steel Viking bird skull ring featuring Vegvisir and Valknut symbols - US 7 / Antique Silver
Detail of Viking raven skull ring with Vegvisir symbol and Valknut engraving on steel - US 7 / Silver
+18
Vintage Viking Bird Skull Ring Stainless Steel Norse Compass Valknut Gothic Punk Men Biker Finger Ring Jewelry
$2.88-3.14
No MOQ
Free Shipping
Fashion Copper Colorful Zirconia Open Adjustable Ring For Women Gold Silver Plated Crystal Floral Cluster Finger Ring Jewelry
Fashion Copper Colorful Zirconia Open Adjustable Ring For Women Gold Silver Plated Crystal Floral Cluster Finger Ring Jewelry
like
Find Similar
Adjustable gold ring with marquise green crystals and white zircon stones in a floral design - Adjustable Open / Green (Light KC Gold)
Adjustable gold plated open ring with pear purple and round white cubic zirconia stones - Adjustable Open / Purple (Light KC Gold)
Adjustable gold open ring with multi-colored pear and round cut 3A cubic zirconia stones - Adjustable Open / Mixed Color (Light KC Gold)
Macro detail of adjustable silver ring featuring teardrop red and white crystals - Adjustable Open / Rose Red (White Gold)
+1
Fashion Copper Colorful Zirconia Open Adjustable Ring For Women Gold Silver Plated Crystal Floral Cluster Finger Ring Jewelry
$0.86
No MOQ
 · 
34 sold recently
Vintage Stainless Steel Eagle And Snake Biker Ring For Men Punk Gothic Animal Totem Distressed Finish Band Ring Jewelry
Vintage Stainless Steel Eagle And Snake Biker Ring For Men Punk Gothic Animal Totem Distressed Finish Band Ring Jewelry
like
Find Similar
Detailed relief of an eagle fighting a snake on a vintage stainless steel men's ring - US 7 / Steel
+5
Vintage Stainless Steel Eagle And Snake Biker Ring For Men Punk Gothic Animal Totem Distressed Finish Band Ring Jewelry
$3.41
No MOQ
Free Shipping
Elegant Tulip Zircon Open Ring Gold Plated Alloy Pink Flower Adjustable Finger Ring For Women Daily Jewelry Accessory
Elegant Tulip Zircon Open Ring Gold Plated Alloy Pink Flower Adjustable Finger Ring For Women Daily Jewelry Accessory
like
Find Similar
Elegant gold tulip ring with pink teardrop zircon and sparkling micro-inlaid diamonds - Tulip Open Ring
Elegant Tulip Zircon Open Ring Gold Plated Alloy Pink Flower Adjustable Finger Ring For Women Daily Jewelry Accessory
$0.41-1.57
No MOQ
 · 
12 views
Free Shipping
Stainless Steel Square Link Bracelet Rhinestone Inlaid Geometric Chain Bangle Ring Fashion Jewelry for Women Men Gift
Stainless Steel Square Link Bracelet Rhinestone Inlaid Geometric Chain Bangle Ring Fashion Jewelry for Women Men Gift
like
Find Similar
Detailed macro view of a gold-plated stainless steel square link bracelet with crystals - Square Link Bracelet (39-E-9) / Gold
Detailed view of a rose gold stainless steel bracelet with crystal-set square links. - Square Link Bracelet (39-E-10) / Rose Gold
Macro detail of polished stainless steel square link bracelet with small inlaid stones - Square Link Bracelet (39-E-8) / Steel
Stainless Steel Square Link Bracelet Rhinestone Inlaid Geometric Chain Bangle Ring Fashion Jewelry for Women Men Gift
$1.96-2.25
No MOQ
 · 
378 sold recently
Geometric Stainless Steel Rings For Women Waterproof Hypoallergenic Minimalist Monstera Leaf Spiral Jewelry Fashion
Geometric Stainless Steel Rings For Women Waterproof Hypoallergenic Minimalist Monstera Leaf Spiral Jewelry Fashion
like
Find Similar
Macro shot of 11g waterproof gold stainless steel spiral ring with triple-layer design - #7 / Gold Triple Layer Spiral / Gold
Macro view of silver monstera leaf ring showing waterproof and hypoallergenic features - Adjustable / Hollow Monstera Leaf / Silver
Silver stainless steel geometric waterdrop ring with size and weight dimensions - One Size / Widen Water Drop Fluid / Silver
Detailed specs of stainless steel triple layer spiral ring with size and weight info - #7 / Triple Layer Spiral / Silver
+7
Geometric Stainless Steel Rings For Women Waterproof Hypoallergenic Minimalist Monstera Leaf Spiral Jewelry Fashion
$1.70-4.85
No MOQ
 · 
167 sold recently
Top 3% Best Sellers
in Rings
Free Shipping
Angel And Demon Wing Open Rings Adjustable Alloy Retro Silver Color Punk Gothic Jewelry Gift Unisex
Angel And Demon Wing Open Rings Adjustable Alloy Retro Silver Color Punk Gothic Jewelry Gift Unisex
like
Find Similar
Retro vintage Thai silver wings open ring with detailed feather pattern in punk style - Angel Wing Ring
Gothic angel and devil wing open rings in vintage silver finish for couples - Demon Wing Ring
Vintage angel and demon wing couple rings in silver with open adjustable design - Angel & Demon Pair
Adjustable S925 silver angel and demon wing ring with vintage punk style details - Double Wing Angel & Demon Ring
+1
Angel And Demon Wing Open Rings Adjustable Alloy Retro Silver Color Punk Gothic Jewelry Gift Unisex
$0.16-0.31
No MOQ
 · 
509 sold recently
Vintage Stainless Steel Open Ring French Style PVD Gold Plated Turquoise Look Adjustable Finger Ring for Women Jewelry
Vintage Stainless Steel Open Ring French Style PVD Gold Plated Turquoise Look Adjustable Finger Ring for Women Jewelry
like
Find Similar
Macro detail of French vintage gold open ring with three green stones on satin - Green Gemstone Style (YYR023115-G)
Close-up of vintage gold turquoise ring on elegant beige silk fabric background - Turquoise Blue Gemstone Style (YYR023115-B)
Detailed close-up of wide gold textured ring with three black gemstones on silk - Black Gemstone Style (YYR023115-BL)
Vintage gold-plated turquoise ring featuring radial engravings and size dimensions - Blue Gemstone Style (YYR023115-LA)
Vintage Stainless Steel Open Ring French Style PVD Gold Plated Turquoise Look Adjustable Finger Ring for Women Jewelry
$1.77
No MOQ
 · 
23 views
Free Shipping
Titanium Steel Cross Ring Set For Men Women Matte Brushed Wood Inlay Punk Band Wedding Daily Fashion Jewelry Gift Set
Titanium Steel Cross Ring Set For Men Women Matte Brushed Wood Inlay Punk Band Wedding Daily Fashion Jewelry Gift Set
like
Find Similar
Detailed close-up of six titanium cross rings with gold, silver and wood grain finishes - US 7 / Gold
Macro shot of titanium steel rings set featuring cross motifs and blue brushed finishes - US 7 / Silver
Men's 6pcs stainless steel cross ring set in black, silver and gold tones - US 7 / Black
+15
Titanium Steel Cross Ring Set For Men Women Matte Brushed Wood Inlay Punk Band Wedding Daily Fashion Jewelry Gift Set
-5%
$3.43-3.93
No MOQ
Free Shipping
Alloy Geometric Nail Rings Fingertip Armor Rings Adjustable Open Liquid Metal Style Gothic Punk Jewelry For Women Girls
Alloy Geometric Nail Rings Fingertip Armor Rings Adjustable Open Liquid Metal Style Gothic Punk Jewelry For Women Girls
like
Find Similar
Retro geometric gold metal nail ring with minimalist adjustable open band for women - Gold Pointed Smooth Style (01仿金M-382)
Polished silver nail ring with zirconia and adjustable open band for women - Silver Pointed Smooth Style (02白KM-383)
Silver punk nail rings set with gothic hollow design and crystals for fingertip - 2-Piece Punk Style Armor Ring Set (戒指2个)
Macro detail of silver-toned armor fingertip ring with sparkling zircon stones - Silver Zirconia Armor Fingertip Ring (01 白K WG1-0227)
+1
Alloy Geometric Nail Rings Fingertip Armor Rings Adjustable Open Liquid Metal Style Gothic Punk Jewelry For Women Girls
-5%
$0.57-1.30
No MOQ
 · 
18 views
Free Shipping
Vintage Gothic Evil Eye Spinner Ring For Men Stainless Steel Retro Punky Rotating Wide Band Finger Ring Jewelry Gift
Vintage Gothic Evil Eye Spinner Ring For Men Stainless Steel Retro Punky Rotating Wide Band Finger Ring Jewelry Gift
like
Find Similar
3 options
Vintage Gothic Evil Eye Spinner Ring For Men Stainless Steel Retro Punky Rotating Wide Band Finger Ring Jewelry Gift
$3.09
No MOQ
Free Shipping
Vintage Stainless Steel Jesus Christ Crucifix Ring Men Gothic Religious Cross Band Two Tone Gold Silver Jewelry Ring
Vintage Stainless Steel Jesus Christ Crucifix Ring Men Gothic Religious Cross Band Two Tone Gold Silver Jewelry Ring
like
Find Similar
Macro shot of vintage gold-plated crucifix relief and cross engraving on the ring - US Size 7 / Full Gold Color
Detail of vintage stainless steel ring featuring a golden crucifix and antique texture - US Size 7 / Gold & Silver
+11
Vintage Stainless Steel Jesus Christ Crucifix Ring Men Gothic Religious Cross Band Two Tone Gold Silver Jewelry Ring
$3.62
No MOQ
 · 
13 sold recently
Free Shipping
Vintage Stainless Steel Octopus Tentacle Ring Gothic Punk Suction Cup Finger Rings For Men Biker Party Jewelry
Vintage Stainless Steel Octopus Tentacle Ring Gothic Punk Suction Cup Finger Rings For Men Biker Party Jewelry
like
Find Similar
7 options
Vintage Stainless Steel Octopus Tentacle Ring Gothic Punk Suction Cup Finger Rings For Men Biker Party Jewelry
$3.35
No MOQ
Free Shipping
Hip Hop Stainless Steel Gold Plated Blue Evil Eye Ring For Men Iced Out Rhinestone Punk Rock Fashion Jewelry Finger Band
Hip Hop Stainless Steel Gold Plated Blue Evil Eye Ring For Men Iced Out Rhinestone Punk Rock Fashion Jewelry Finger Band
like
Find Similar
Gold-plated stainless steel hip hop ring featuring a blue evil eye with pavé crystals - US 7 / Gold
Silver stainless steel Evil Eye ring with blue bead and pavé zircon stones on white background - US 7 / Steel
+10
Hip Hop Stainless Steel Gold Plated Blue Evil Eye Ring For Men Iced Out Rhinestone Punk Rock Fashion Jewelry Finger Band
$3.09-3.35
No MOQ
Free Shipping
925 Sterling Silver Evil Eye Adjustable Chain Ring For Women Personalized Sweet Cool Rhinestone Enamel Finger Ring Jewelry
925 Sterling Silver Evil Eye Adjustable Chain Ring For Women Personalized Sweet Cool Rhinestone Enamel Finger Ring Jewelry
like
Find Similar
1 option
925 Sterling Silver Evil Eye Adjustable Chain Ring For Women Personalized Sweet Cool Rhinestone Enamel Finger Ring Jewelry
-14%
$7.10
No MOQ
Free Shipping
Retro Gothic Snake Ring For Men Women Titanium Steel 3D Animal Scales Distressed Punk Style Statement Ring Jewelry Gift
Retro Gothic Snake Ring For Men Women Titanium Steel 3D Animal Scales Distressed Punk Style Statement Ring Jewelry Gift
like
Find Similar
Retro punk snake ring in vintage silver finish with 3D scales on a black mirror surface - US 7 / Steel
Vintage gold snake ring in 3D scale texture with an adjustable open design for men and women - US 7 / Gold
+10
Retro Gothic Snake Ring For Men Women Titanium Steel 3D Animal Scales Distressed Punk Style Statement Ring Jewelry Gift
-4%
$2.99-3.24
No MOQ
Free Shipping
Men Titanium Steel Ring Set Retro Punk Black Band Rings For Men Cool Geometric Chain Rotating Finger Ring Jewelry Gift
Men Titanium Steel Ring Set Retro Punk Black Band Rings For Men Cool Geometric Chain Rotating Finger Ring Jewelry Gift
like
Find Similar
6-piece men's black titanium steel ring set with square signet and matte finishes - US 6 / Retro Punk Style (SMTZ215)
6-piece set of men's black titanium steel rings featuring vintage punk and matte designs - US 6 / Modern Industrial Style (SMTZ216)
+14
Men Titanium Steel Ring Set Retro Punk Black Band Rings For Men Cool Geometric Chain Rotating Finger Ring Jewelry Gift
$4.58-5.50
No MOQ
Free Shipping
Vintage Stainless Steel Open Ring For Women Gold Plated Bold Hammered Liquid Metal Style Adjustable Chubby Statement Ring
Vintage Stainless Steel Open Ring For Women Gold Plated Bold Hammered Liquid Metal Style Adjustable Chubby Statement Ring
like
Find Similar
Chubby hammered stainless steel open ring with 9.1g weight and dimension labels - Steel Color Wide Hammered (R693_2 Steel Color)
Detailed view of wide hammered texture gold ring with dimension and weight measurements - Hammered Bumpy Style (R693_1)
Detailed dimensions of wide hammered gold dome ring showing width, height and weight - Polished Liquid Wave Pattern (R692_1)
Chunky stainless steel open ring with detailed dimension markings and 14.8g weight info - Steel Color Oval Hammered (R692_2 Steel Color)
Vintage Stainless Steel Open Ring For Women Gold Plated Bold Hammered Liquid Metal Style Adjustable Chubby Statement Ring
$3.35
No MOQ
Free Shipping
Retro Tiger Eye Stone Rings Vintage Gold Plated Open Adjustable Band Beaded Jewelry For Women Artistic Design
Retro Tiger Eye Stone Rings Vintage Gold Plated Open Adjustable Band Beaded Jewelry For Women Artistic Design
like
Find Similar
Close-up of golden vintage open ring featuring round tiger eye stones and sparkling zircons - 1# Gold Snake Open Ring
Close-up of vintage golden ring with oval tiger eye stone and micro-diamond disc - 2# Gold Tiger Eye Rhinestone Ring
Detailed view of irregular adjustable gold ring featuring a round brown tiger eye stone - 3# Gold Round Tiger Eye Sunburst Ring
Macro view of vintage gold sunburst ring with tiger eye stone on textured fabric - 4# Gold Sunflower Tiger Eye Ring
+12
Retro Tiger Eye Stone Rings Vintage Gold Plated Open Adjustable Band Beaded Jewelry For Women Artistic Design
$1.18-3.80
No MOQ
 · 
14 sold recently
Free Shipping
Vintage Men's Stainless Steel Ring With Large Rectangular Zirconia Double Dragon Relief Punk Style Signet Ring For Daily Wear Jewelry
Vintage Men's Stainless Steel Ring With Large Rectangular Zirconia Double Dragon Relief Punk Style Signet Ring For Daily Wear Jewelry
like
Find Similar
Mens vintage stainless steel ring with dragon relief and square red gemstone inlay - US 7 / Steel with Red Zirconia
Men's silver steel ring featuring a black square gemstone and side dragon carvings - US 7 / Steel Black Zirconia
Men's punk stainless steel dragon ring featuring a large rectangular green gemstone center - US 7 / Silver/Green Zirconia
Punk style titanium steel men's signet ring with large blue gemstone and relief carving - US 7 / Steel with Blue Zirconia
+24
Vintage Men's Stainless Steel Ring With Large Rectangular Zirconia Double Dragon Relief Punk Style Signet Ring For Daily Wear Jewelry
-4%
$2.91
No MOQ
 · 
12 sold recently
Free Shipping
925 Sterling Silver Wavy Curved Stackable Rings For Women Minimalist Knuckle Band Thin Line Finger Ring Jewelry Gift
925 Sterling Silver Wavy Curved Stackable Rings For Women Minimalist Knuckle Band Thin Line Finger Ring Jewelry Gift
like
Find Similar
Set of seven minimalist S925 sterling silver wavy rings with a high-polished metallic finish - US 7
+6
925 Sterling Silver Wavy Curved Stackable Rings For Women Minimalist Knuckle Band Thin Line Finger Ring Jewelry Gift
-12%
$5.48
No MOQ
Free Shipping
S999 Sterling Silver Cat Paw Couple Rings Pink Heart Rhinestone Adjustable Open Finger Rings For Women Men Jewelry Gift
S999 Sterling Silver Cat Paw Couple Rings Pink Heart Rhinestone Adjustable Open Finger Rings For Women Men Jewelry Gift
like
Find Similar
Elegant adjustable S999 silver ring with floral texture on a rustic wooden tray - Adjustable Open / Men's Style (D832)
Frosted S999 silver open ring with cute cat paw design and pink heart gemstone - Adjustable Open / Women's Style (D832)
S999 Sterling Silver Cat Paw Couple Rings Pink Heart Rhinestone Adjustable Open Finger Rings For Women Men Jewelry Gift
$11.79-16.77
No MOQ
Free Shipping
Adjustable Copper Ring Set For Women Heart Four Leaf Clover Design Rhinestone Inlaid Fashion Open Finger Rings Jewelry Accessory
Adjustable Copper Ring Set For Women Heart Four Leaf Clover Design Rhinestone Inlaid Fashion Open Finger Rings Jewelry Accessory
like
Find Similar
Three-in-one rose gold adjustable clover ring set with white cubic zirconia crystals - Adjustable Open / Rose Gold
Three-in-one heart clover silver ring set with micro-inlaid zircon and sparkling finish - Adjustable Open / Silver
Adjustable Copper Ring Set For Women Heart Four Leaf Clover Design Rhinestone Inlaid Fashion Open Finger Rings Jewelry Accessory
$2.15
Mix MOQ : 2
Free Shipping
Minimalist Frosted Titanium Steel Ring Polished Edge Finger Band Daily Wear Fashion Jewelry For Men Women Unisex
Minimalist Frosted Titanium Steel Ring Polished Edge Finger Band Daily Wear Fashion Jewelry For Men Women Unisex
like
Find Similar
Minimalist matte black titanium steel ring for women with polished inner surface - US 5 / 8mm Double Step Black
Elegant gold-plated frosted titanium steel ring with polished edges for women - US 5 / 8mm Double Step Gold
Elegant rose gold frosted titanium steel ring with minimalist high-polished inner band - US 5 / 2mm Double Step Rose Gold
Minimalist frosted titanium steel ring with a matte finish and polished interior edges - US 5 / 2mm Double Step Silver
+156
Minimalist Frosted Titanium Steel Ring Polished Edge Finger Band Daily Wear Fashion Jewelry For Men Women Unisex
-15%
$0.09-0.37
Mix MOQ : 2
 · 
666 sold recently
Free Shipping
S925 Sterling Silver Beaded Chain Ring For Women Vintage Minimalist Adjustable Open Ring With Ball Tassel Dainty Jewelry
S925 Sterling Silver Beaded Chain Ring For Women Vintage Minimalist Adjustable Open Ring With Ball Tassel Dainty Jewelry
like
Find Similar
Minimalist S925 sterling silver triple-row beaded chain ring with adjustable drop charms - Adjustable Open / Wide Version (14JZ23) / Silver
Adjustable S925 sterling silver beaded chain ring in a pink velvet jewelry box - Adjustable Open / Narrow Version (14JZ23) / Silver
S925 Sterling Silver Beaded Chain Ring For Women Vintage Minimalist Adjustable Open Ring With Ball Tassel Dainty Jewelry
-12%
$6.47-9.21
No MOQ
Free Shipping
925 Sterling Silver Bear Open Ring Square Zirconia Animal Adjustable Finger Jewelry For Women Girls Gift Sweet Aesthetic
925 Sterling Silver Bear Open Ring Square Zirconia Animal Adjustable Finger Jewelry For Women Girls Gift Sweet Aesthetic
like
Find Similar
Minimalist 925 sterling silver bear ring with square zircon stone on model's hand - Zirconia Bear Style
925 Sterling Silver Bear Open Ring Square Zirconia Animal Adjustable Finger Jewelry For Women Girls Gift Sweet Aesthetic
-5%
$1.89
No MOQ
Free Shipping
Fashion Hollow Beaded Flower Stainless Steel Open Ring Minimalist Ins Style Adjustable Floral Ring For Women Jewelry Gift
Fashion Hollow Beaded Flower Stainless Steel Open Ring Minimalist Ins Style Adjustable Floral Ring For Women Jewelry Gift
like
Find Similar
Detail of a gold-tone beaded triple-band ring featuring a light blue flower with seven beads - Light Blue
Detailed view of adjustable gold beaded ring with a pink floral bead motif detail - Light Pink
Detailed macro view of gold hollow beaded flower ring with light green crystal petals - Light Green
Fashion Hollow Beaded Flower Stainless Steel Open Ring Minimalist Ins Style Adjustable Floral Ring For Women Jewelry Gift
-5%
$2.04
No MOQ
Free Shipping
Women Fashion Round Stone Ring 316L Stainless Steel Bezel Set Crystal Cats Eye Stone Polished Minimalist Hypoallergenic
Women Fashion Round Stone Ring 316L Stainless Steel Bezel Set Crystal Cats Eye Stone Polished Minimalist Hypoallergenic
like
Find Similar
Polished silver titanium steel ring featuring a faceted green cat-eye gemstone inlay - US 7 / Green Crystal (KR82285-K)
Polished silver stainless steel ring featuring a round dark blue cat eye stone - US 7 / Ink Blue Cat Eye (KR88989-K)
Polished silver titanium ring with round multi-faceted blue crystal gemstone - US 7 / Blue Crystal (KR82286-K)
Titanium steel ring with silver band and a large round grey cat eye stone inlay - US 7 / Grey Crystal (KR82289-K)
+60
Women Fashion Round Stone Ring 316L Stainless Steel Bezel Set Crystal Cats Eye Stone Polished Minimalist Hypoallergenic
$3.13
No MOQ
 · 
27 sold recently
Free Shipping
Matte Black Alloy Wave Knuckle Ring For Women Minimalist Hollow Out Multi Layer Finger Ring Accessory Fashionable Jewelry
Matte Black Alloy Wave Knuckle Ring For Women Minimalist Hollow Out Multi Layer Finger Ring Accessory Fashionable Jewelry
like
Find Similar
Three-piece set of trendy matte black wavy rings for women in a minimalist modern style - Matte Black
Matte Black Alloy Wave Knuckle Ring For Women Minimalist Hollow Out Multi Layer Finger Ring Accessory Fashionable Jewelry
$0.77
Mix MOQ : 2
Minimalist Stainless Steel Striped Open Ring Industrial Style Adjustable Finger Ring Jewelry For Men Women Rainbow Gold Silver
Minimalist Stainless Steel Striped Open Ring Industrial Style Adjustable Finger Ring Jewelry For Men Women Rainbow Gold Silver
like
Find Similar
Detail of silver titanium steel open ring with irregular vertical striped texture - Silver
Rainbow striped titanium steel open ring with luxury colorful metallic gradient finish - Rainbow
Detail view of gold adjustable titanium ring with unique architectural ribbed texture layers - Gold
Minimalist Stainless Steel Striped Open Ring Industrial Style Adjustable Finger Ring Jewelry For Men Women Rainbow Gold Silver
$0.50-0.78
Mix MOQ : 2
Free Shipping
Vintage Stainless Steel Crown Ring For Men Women Punk Cross Pattern Hollow Out Finger Ring Gold Black Silver Jewelry
Vintage Stainless Steel Crown Ring For Men Women Punk Cross Pattern Hollow Out Finger Ring Gold Black Silver Jewelry
like
Find Similar
Elegant stainless steel crown ring for women in silver finish on a clean white background - US 7 / Steel
Polished gold stainless steel crown ring with vintage black checkered patterns for women - US 7 / Gold
Polished black stainless steel crown ring for women with unique spherical accents on top - US 7 / Black
+18
Vintage Stainless Steel Crown Ring For Men Women Punk Cross Pattern Hollow Out Finger Ring Gold Black Silver Jewelry
$2.88-3.14
No MOQ
Free Shipping
Fashion Copper Gold Plated Bee Open Ring For Women Minimalist Rhinestone Enamel Artificial Pearl Adjustable Jewelry Gift
Fashion Copper Gold Plated Bee Open Ring For Women Minimalist Rhinestone Enamel Artificial Pearl Adjustable Jewelry Gift
like
Find Similar
Luxurious 18K gold bee open ring with white enamel wings and sparkling zircons - Gold White Wing Bee(14810)
Luxe 18K gold plated bee open ring with white enamel wings and sparkling zircon accents - Silver White Wing Bee(14811)
Macro shot of 18K gold plated bee ring with colorful enamel and zircon stones - Colorful Striped Bee(14812)
Adjustable silver bee ring with white pearl and sparkling zircon on natural wood - Silver Pearl Bee(14813)
+1
Fashion Copper Gold Plated Bee Open Ring For Women Minimalist Rhinestone Enamel Artificial Pearl Adjustable Jewelry Gift
-5%
$2.24-3.48
No MOQ
Free Shipping
Vintage Alloy Snake Ring Adjustable Open Gothic Punk Animal Scale Texture Retro Jewelry For Men Women
Vintage Alloy Snake Ring Adjustable Open Gothic Punk Animal Scale Texture Retro Jewelry For Men Women
like
Find Similar
Vintage silver snake-shaped ring with cobra design and detailed scale texture - Adjustable Open / Style 24 (Antique Silver Cobra)
Vintage silver snake open ring with detailed scale texture and retro punk style design - Adjustable Open / Style 9 (Retro Silver Snake)
Close-up of vintage silver snake ring showcasing detailed scales and antique finish - Adjustable Open / Style 35 (Distressed Scaly Snake Head)
Vintage silver snake ring with detailed scales and an adjustable open punk design - Adjustable Open / Style 34 (S-Type Wrap Silver Snake)
+34
Vintage Alloy Snake Ring Adjustable Open Gothic Punk Animal Scale Texture Retro Jewelry For Men Women
-8%
$0.18-0.23
No MOQ
 · 
832 sold recently
Top 10% Best Sellers
in Rings
Butterfly Open Ring Gold Plated Stainless Steel Black Zirconia Adjustable Finger Ring For Women Elegant Fashion Jewelry
Butterfly Open Ring Gold Plated Stainless Steel Black Zirconia Adjustable Finger Ring For Women Elegant Fashion Jewelry
like
Find Similar
1 option
Butterfly Open Ring Gold Plated Stainless Steel Black Zirconia Adjustable Finger Ring For Women Elegant Fashion Jewelry
-4%
$1.87
No MOQ
 · 
1 reviews
Free Shipping
Stainless Steel Beaded Tassel Open Ring For Women Minimalist Gold Silver Mixed Color Adjustable Finger Ring Jewelry Gift
Stainless Steel Beaded Tassel Open Ring For Women Minimalist Gold Silver Mixed Color Adjustable Finger Ring Jewelry Gift
like
Find Similar
Gold stainless steel wide band ring with silver beads and 1.0cm dangling tassels - Bicolor Gold and Silver Tassel Style (JDRW2408019-PS)
Stainless Steel Beaded Tassel Open Ring For Women Minimalist Gold Silver Mixed Color Adjustable Finger Ring Jewelry Gift
$3.80
No MOQ
Free Shipping
Modern Men Titanium Steel Ring Brushed Finish Contrasting Color Band Ring Polished Inner Daily Commuting Unisex Jewelry
Modern Men Titanium Steel Ring Brushed Finish Contrasting Color Band Ring Polished Inner Daily Commuting Unisex Jewelry
like
Find Similar
Macro shot of 8mm brushed silver ring with vibrant blue center groove and polished interior - US 7 / Silver & Blue
Detail of 8mm wide men's ring with matte black finish and polished blue inner band - US 7 / Black and Blue
8mm black brushed stainless steel ring with a polished gold center band for men - US 7 / Black and Gold
+21
Modern Men Titanium Steel Ring Brushed Finish Contrasting Color Band Ring Polished Inner Daily Commuting Unisex Jewelry
$0.52-1.02
No MOQ
 · 
34 sold recently
Free Shipping
Luminous Butterfly Open Ring Zinc Alloy Glow In The Dark Adjustable Finger Ring Trendy Hip Hop Jewelry Accessory For Women Men
Luminous Butterfly Open Ring Zinc Alloy Glow In The Dark Adjustable Finger Ring Trendy Hip Hop Jewelry Accessory For Women Men
like
Find Similar
Glow in the dark butterfly ring with green fluorescent wings and hip-hop style design - 1# Green Glow
Detailed close-up of luminous butterfly ring with blue glow effect on black background - Blue Glow
Luminous blue butterfly ring with glowing eye detail and black metal base on dark background - Teal Glow
Macro shot of luminous butterfly ring with orange gradient wings and black bead on dark band - Orange Glow
Luminous Butterfly Open Ring Zinc Alloy Glow In The Dark Adjustable Finger Ring Trendy Hip Hop Jewelry Accessory For Women Men
$1.23
Mix MOQ : 3
Free Shipping
Stainless Steel Ring With Inlaid Abalone Shell High Polished Beveled Edge Fashion Band Jewelry For Men Women
Stainless Steel Ring With Inlaid Abalone Shell High Polished Beveled Edge Fashion Band Jewelry For Men Women
like
Find Similar
Macro detail of 8mm stainless steel ring featuring colorful abalone shell inlay - US 6 / Old Style Brown
Macro shot of 8mm stainless steel ring with abalone shell inlay and polished silver edge - US 6 / New Colorful Abalone Shell
+14
Stainless Steel Ring With Inlaid Abalone Shell High Polished Beveled Edge Fashion Band Jewelry For Men Women
-5%
$0.95
No MOQ
 · 
1K+ sold recently
Top 5% Best Sellers
in Rings
Free Shipping
Vintage Punk Titanium Steel Skull Goat Horn Ring Gothic Distressed Silver Skeleton Biker Ring For Men Women Jewelry
Vintage Punk Titanium Steel Skull Goat Horn Ring Gothic Distressed Silver Skeleton Biker Ring For Men Women Jewelry
like
Find Similar
Vintage punk goat skull ring in textured stainless steel with realistic gothic carving - US 8 / Antique Silver
+4
Vintage Punk Titanium Steel Skull Goat Horn Ring Gothic Distressed Silver Skeleton Biker Ring For Men Women Jewelry
$3.14
No MOQ
 · 
15 sold recently
Free Shipping
Nordic Viking Celtic Knot Ring For Men Vintage Stainless Steel Distressed Punk Biker Wide Band Ring Finger Jewelry Gift
Nordic Viking Celtic Knot Ring For Men Vintage Stainless Steel Distressed Punk Biker Wide Band Ring Finger Jewelry Gift
like
Find Similar
16 options
Nordic Viking Celtic Knot Ring For Men Vintage Stainless Steel Distressed Punk Biker Wide Band Ring Finger Jewelry Gift
-4%
$2.69-3.24
No MOQ
 · 
19 sold recently
Free Shipping
Vintage Punk Armor Hinged Joint Full Finger Ring Antique Silver Alloy Skull Dragon Snake Gothic Rock Jewelry Men Women
Vintage Punk Armor Hinged Joint Full Finger Ring Antique Silver Alloy Skull Dragon Snake Gothic Rock Jewelry Men Women
like
Find Similar
Gothic silver dragon armor ring with red crystal eyes and articulated joint design - Adjustable Open / L-Red Eyed Dragon Joint Ring
Retro punk gothic articulated skull ring with red gems in vintage silver finish - Adjustable Open / H-Red Zircon Skeleton Claw
Gothic silver articulated armor ring featuring sharp claw design and witch hat elements - Adjustable Open / A-Witch Hat Claw
Macro shot of punk skull and sharp claw armor ring with vintage silver finish metal details - Adjustable Open / B-Skeleton Mechanical Claw
+10
Vintage Punk Armor Hinged Joint Full Finger Ring Antique Silver Alloy Skull Dragon Snake Gothic Rock Jewelry Men Women
-4%
$0.70
No MOQ
 · 
45 sold recently
Vintage Stainless Steel Celtic Knot Witch Knot Ring Hollow Geometric Band Jewelry For Men Women Daily Retro Accessory
Vintage Stainless Steel Celtic Knot Witch Knot Ring Hollow Geometric Band Jewelry For Men Women Daily Retro Accessory
like
Find Similar
Macro view of vintage Celtic knot cut-out ring with polished silver steel finish - US 7 / Silver
Macro shot of gold Celtic knot stainless steel ring on dark textured background - US 7 / Gold
+8
Vintage Stainless Steel Celtic Knot Witch Knot Ring Hollow Geometric Band Jewelry For Men Women Daily Retro Accessory
$0.58-0.65
No MOQ
 · 
13 sold recently
Forever Love Engraved Heart Couple Rings Titanium Stainless Steel Cubic Zirconia Wedding Band Jewelry Gift Men Women
Forever Love Engraved Heart Couple Rings Titanium Stainless Steel Cubic Zirconia Wedding Band Jewelry Gift Men Women
like
Find Similar
Men's hip-hop two-tone stainless steel ring with polished gold and silver finish - US 5
Two-tone stainless steel ring with polished gold edges and silver band inlay - US 5
Minimalist gold and silver two-tone stainless steel ring engraved with Forever Love - US 5
Matte black stainless steel band ring with pinky swear graphic and I Love You engraving - 19-c-2 Black Promise 6mm Width / Size 7
+73
Forever Love Engraved Heart Couple Rings Titanium Stainless Steel Cubic Zirconia Wedding Band Jewelry Gift Men Women
$0.17-0.78
No MOQ
 · 
247 sold recently
Free Shipping
Vintage Stainless Steel Tiger Eye Stone Ring For Men Women Retro Hip Hop Bold Geometric Inlaid Gemstone Punk Finger Jewelry
Vintage Stainless Steel Tiger Eye Stone Ring For Men Women Retro Hip Hop Bold Geometric Inlaid Gemstone Punk Finger Jewelry
like
Find Similar
Polished silver titanium steel ring featuring an oval tiger eye stone in a retro design - US 7 / Retro Silver
Vintage gold-plated titanium steel ring featuring an oval tiger eye stone inlay for men - US 7 / Retro Gold
+10
Vintage Stainless Steel Tiger Eye Stone Ring For Men Women Retro Hip Hop Bold Geometric Inlaid Gemstone Punk Finger Jewelry
$3.41-3.67
No MOQ
Free Shipping
S925 Sterling Silver Open Adjustable Ring Women Irregular U-Shaped Tin Foil Pleated Texture Fashion Design Finger Ring
S925 Sterling Silver Open Adjustable Ring Women Irregular U-Shaped Tin Foil Pleated Texture Fashion Design Finger Ring
like
Find Similar
2 options
S925 Sterling Silver Open Adjustable Ring Women Irregular U-Shaped Tin Foil Pleated Texture Fashion Design Finger Ring
-29%
$24.58
No MOQ
Free Shipping
Vintage Woven Celtic Knot Viking Ring For Men Titanium Steel Two-tone Gold Silver Band Finger Ring Retro Jewelry Gift
Vintage Woven Celtic Knot Viking Ring For Men Titanium Steel Two-tone Gold Silver Band Finger Ring Retro Jewelry Gift
like
Find Similar
Vintage Celtic knot braided Viking steel ring for men with an antique silver finish - US 7 / Steel
Vintage Viking woven knot ring in two-tone stainless steel with celtic gold pattern - US 7 / Gold & Silver
+12
Vintage Woven Celtic Knot Viking Ring For Men Titanium Steel Two-tone Gold Silver Band Finger Ring Retro Jewelry Gift
-5%
$3.19-3.68
No MOQ
 · 
10 sold recently
Free Shipping
Vintage Stainless Steel Men's Punk Ring Middle Finger Gesture Gothic Rock Style Skeleton Hand Biker Finger Ring Jewelry
Vintage Stainless Steel Men's Punk Ring Middle Finger Gesture Gothic Rock Style Skeleton Hand Biker Finger Ring Jewelry
like
Find Similar
6 options
Vintage Stainless Steel Men's Punk Ring Middle Finger Gesture Gothic Rock Style Skeleton Hand Biker Finger Ring Jewelry
$3.09
No MOQ
 · 
12 sold recently
Free Shipping
Fashion Square Natural Stone Ring For Women Alloy Gold Plated Minimalist Geometric Ins Style Finger Jewelry Elegant
Fashion Square Natural Stone Ring For Women Alloy Gold Plated Minimalist Geometric Ins Style Finger Jewelry Elegant
like
Find Similar
Minimalist gold ring featuring a square-cut pale pink natural stone on a white stage - Small / Small Size Pink Quartz
Minimalist gold ring featuring a square white natural stone with marble texture - Small / Small Size White Stone
Minimalist golden ring with square white marble stone in a modern geometric style - Medium Version / Medium Size White Turquoise
Minimalist golden square ring with turquoise stone texture in a classic bezel setting - Medium Version / Medium Size Turquoise
+9
Fashion Square Natural Stone Ring For Women Alloy Gold Plated Minimalist Geometric Ins Style Finger Jewelry Elegant
-5%
$0.87-1.24
No MOQ
 · 
160 sold recently
Free Shipping
Men Hip Hop Titanium Steel Square Signet Ring Pave Rhinestone Electroplated Gold Silver Personalized Trendy Male Band Ring Jewelry
Men Hip Hop Titanium Steel Square Signet Ring Pave Rhinestone Electroplated Gold Silver Personalized Trendy Male Band Ring Jewelry
like
Find Similar
Macro detail of men's gold hip hop signet ring with rectangle iced-out crystal setting - US 7 / Gold
Hip hop style silver men's signet ring with full pavé cubic zirconia diamonds - US 7 / Steel
+12
Men Hip Hop Titanium Steel Square Signet Ring Pave Rhinestone Electroplated Gold Silver Personalized Trendy Male Band Ring Jewelry
$3.67
No MOQ
Free Shipping
Vintage Horse Head Titanium Steel Ring For Men Punk Gothic Distressed Biker Ring Personality Jewelry Animal Sculptural Ring
Vintage Horse Head Titanium Steel Ring For Men Punk Gothic Distressed Biker Ring Personality Jewelry Animal Sculptural Ring
like
Find Similar
6 options
Vintage Horse Head Titanium Steel Ring For Men Punk Gothic Distressed Biker Ring Personality Jewelry Animal Sculptural Ring
$3.67
No MOQ
Free Shipping
Gothic Spider Ring Zinc Alloy Faux Artificial Pearl Adjustable Open Dark Punk Style Animal Jewelry For Women Men
Gothic Spider Ring Zinc Alloy Faux Artificial Pearl Adjustable Open Dark Punk Style Animal Jewelry For Women Men
like
Find Similar
Gothic black spider adjustable open ring with iridescent dark pearl for women - Black Spider / Black
Detailed view of punk spider ring with moonstone worn by a model on black fabric - White Spider / Silver
Gothic Spider Ring Zinc Alloy Faux Artificial Pearl Adjustable Open Dark Punk Style Animal Jewelry For Women Men
$0.34
No MOQ
 · 
619 sold recently
Top 10% Best Sellers
in Rings
Go to

More in jewelry

Lab-Created Gemstone Jewelry

Explore more in toe rings

openfoot jewelryfingersimplewhiteplasticinlaiddesignbodyplated stainless steel
footgold platedsteelartificialpolishedgirlsgold plated adjustableturquoise18k gold platedcolor ring

Ready to source like an insider

Get a direct line to the factory floor — no minimums, no middlemen, no guesswork.
iconReal factory pricing, no markup in betweeniconEvery order hand-inspected before it shipsicon5,000+ new products added daily
Get Inside Access