Everful

Wholesale toe rings

Factory-direct selection, vetted for quality and ready to order.

Sign Up
Toe Rings

Find the perfect pieces: stainless steel rings, copper rings, alloy rings and more

All products in toe rings

filterShow Filters
Best Seller
New Arrivals
Price Drop
Free Shipping
Men Vintage Multi-Layer Cowhide Leather Bracelet Braided Cord Glass Beads Alloy Rings Punk Wristband Jewelry For Casual
Men Vintage Multi-Layer Cowhide Leather Bracelet Braided Cord Glass Beads Alloy Rings Punk Wristband Jewelry For Casual
like
Find Similar
Retro multi-layer leather bracelet set with woven ropes and beaded charms for men - Multi-Layered Style (TZ245)
Men Vintage Multi-Layer Cowhide Leather Bracelet Braided Cord Glass Beads Alloy Rings Punk Wristband Jewelry For Casual
-4%
$1.62
No MOQ
925 Sterling Silver Moissanite Freshwater Pearl Pendant Necklace Double Rings Wave Design Elegant Jewelry For Women
925 Sterling Silver Moissanite Freshwater Pearl Pendant Necklace Double Rings Wave Design Elegant Jewelry For Women
like
Find Similar
Elegant S925 sterling silver necklace with Moissanite and a round freshwater pearl pendant - Freshwater Pearl with Moissanite / 925 Silver
925 Sterling Silver Moissanite Freshwater Pearl Pendant Necklace Double Rings Wave Design Elegant Jewelry For Women
$51.30
No MOQ
Free Shipping
Minimalist Alloy Choker Necklace Cuff Bracelet And Ring Geometric Round Ball Silver Color Fashion Jewelry Accessories For Women
Minimalist Alloy Choker Necklace Cuff Bracelet And Ring Geometric Round Ball Silver Color Fashion Jewelry Accessories For Women
like
Find Similar
Minimalist silver jewelry set including collar necklace, open cuff bracelet, and ball ring - Silver
Minimalist Alloy Choker Necklace Cuff Bracelet And Ring Geometric Round Ball Silver Color Fashion Jewelry Accessories For Women
$2.31
No MOQ
Stainless Steel Cuban Link Chain Necklace Bracelet Plain Band Ring Hip Hop Style Silver Color Jewelry For Men Women
Stainless Steel Cuban Link Chain Necklace Bracelet Plain Band Ring Hip Hop Style Silver Color Jewelry For Men Women
like
Find Similar
Detailed view of silver stainless steel jewelry set with Cuban chain necklace and ring - Stainless Steel 3-piece Set / Silver
Stainless Steel Cuban Link Chain Necklace Bracelet Plain Band Ring Hip Hop Style Silver Color Jewelry For Men Women
-5%
$1.29
No MOQ
Elegant Bridal Lace Garters With Rhinestone And Faux Artificial Pearl Elastic Leg Ring For Wedding Party Women Anniversary Jewelry
Elegant Bridal Lace Garters With Rhinestone And Faux Artificial Pearl Elastic Leg Ring For Wedding Party Women Anniversary Jewelry
like
Find Similar
Detailed view of white lace bridal garter with sparkling rhinestones and size measurements - Silver (GS-J019)
NewElegant Bridal Lace Garters With Rhinestone And Faux Artificial Pearl Elastic Leg Ring For Wedding Party Women Anniversary Jewelry
-5%
$7.96
No MOQ
Free Shipping
Copper Leaf Necklace And Ring Jewelry Set Inlaid Green Rhinestone Botanical Minimalist Clavicle Chain Accessories For Women
Copper Leaf Necklace And Ring Jewelry Set Inlaid Green Rhinestone Botanical Minimalist Clavicle Chain Accessories For Women
like
Find Similar
Detail showing leaf-shaped jewelry set dimensions for gold and green gemstone items - Gold Green Zirconia
Copper Leaf Necklace And Ring Jewelry Set Inlaid Green Rhinestone Botanical Minimalist Clavicle Chain Accessories For Women
-5%
$2.24
No MOQ
 · 
19 views
Brass Gold Plated Geometric Oval Hollow Double Ring Hoop Earrings Minimalist Style With Zircon For Women
Brass Gold Plated Geometric Oval Hollow Double Ring Hoop Earrings Minimalist Style With Zircon For Women
like
Find Similar
Minimalist gold plated hollow geometric oval hoop earrings with a high-polished finish - Gold Double Ring Oval Style
NewBrass Gold Plated Geometric Oval Hollow Double Ring Hoop Earrings Minimalist Style With Zircon For Women
$3.67
Mix MOQ : 2
Free Shipping
Safety Pin Bangle And Adjustable Ring Stainless Steel 18K Gold Plated Trendy Minimalist Fashion Jewelry For Women
Safety Pin Bangle And Adjustable Ring Stainless Steel 18K Gold Plated Trendy Minimalist Fashion Jewelry For Women
like
Find Similar
Adjustable safety pin ring in golden finish worn by model with blurred background - Golden Safety Pin Ring (A126-Golden Ring)
Safety Pin Bangle And Adjustable Ring Stainless Steel 18K Gold Plated Trendy Minimalist Fashion Jewelry For Women
-4%
$2.79
No MOQ
Free Shipping
Elegant Pendant Necklace Gold Plated Stainless Steel Interlocking Rings Encrusted With Zirconia Smooth Snake Chain For Women
Elegant Pendant Necklace Gold Plated Stainless Steel Interlocking Rings Encrusted With Zirconia Smooth Snake Chain For Women
like
Find Similar
Gold stainless steel snake chain necklace with sparkling triple ring crystal pendant - Gold Three Ring Zirconia Style (NE2G330AG)
NewElegant Pendant Necklace Gold Plated Stainless Steel Interlocking Rings Encrusted With Zirconia Smooth Snake Chain For Women
-4%
$5.23
No MOQ
Free Shipping
Minimalist Twisted Ring Pendant Necklace Titanium Steel Mobius Loop Design Gold Plated Jewelry For Women Niche Style
Minimalist Twisted Ring Pendant Necklace Titanium Steel Mobius Loop Design Gold Plated Jewelry For Women Niche Style
like
Find Similar
Golden twisted Mobius ring pendant necklace on O-chain for women in premium steel - Gold Twisted Ring Style (05-H13)
Minimalist Twisted Ring Pendant Necklace Titanium Steel Mobius Loop Design Gold Plated Jewelry For Women Niche Style
-4%
$1.22
No MOQ
Free Shipping
Retro Punk Braided Cowhide Leather Necklace For Men Women Alloy Interlocking Rings Pendant Multi Layer Cord Vintage Jewelry
Retro Punk Braided Cowhide Leather Necklace For Men Women Alloy Interlocking Rings Pendant Multi Layer Cord Vintage Jewelry
like
Find Similar
Vintage layered brown leather necklace for men featuring interlocking matte silver rings - Interlocking Rings Style
Retro Punk Braided Cowhide Leather Necklace For Men Women Alloy Interlocking Rings Pendant Multi Layer Cord Vintage Jewelry
$1.70
No MOQ
Stainless Steel Rhinestone Inlaid Oval Ring Chain Bracelet Minimalist Fashion 18K Gold Plated Waterproof Jewelry For Women Men
Stainless Steel Rhinestone Inlaid Oval Ring Chain Bracelet Minimalist Fashion 18K Gold Plated Waterproof Jewelry For Women Men
like
Find Similar
Golden stainless steel chunky chain bracelet with sparkling crystal paved oval rings - Gold Rhinestone Link Style (SL41422)
Stainless Steel Rhinestone Inlaid Oval Ring Chain Bracelet Minimalist Fashion 18K Gold Plated Waterproof Jewelry For Women Men
$4.13
No MOQ
Free Shipping
Industrial Style Alloy Twisted Rope Circle Ring Pendant Necklace Goth Punk Jewelry For Men Women Silver Tone Wheat Chain
Industrial Style Alloy Twisted Rope Circle Ring Pendant Necklace Goth Punk Jewelry For Men Women Silver Tone Wheat Chain
like
Find Similar
Silver stainless steel oval pendant necklace with thorn texture on black leather - Steel
Industrial Style Alloy Twisted Rope Circle Ring Pendant Necklace Goth Punk Jewelry For Men Women Silver Tone Wheat Chain
$1.18
No MOQ
Multi Layer Concentric Ring Dangle Earrings Alloy Metal Rhinestone Bohemian Minimalist Style For Women
Multi Layer Concentric Ring Dangle Earrings Alloy Metal Rhinestone Bohemian Minimalist Style For Women
like
Find Similar
Minimalist silver multi-layered hoop earrings with cascading concentric circles - Silver (wl08100850)
Multi Layer Concentric Ring Dangle Earrings Alloy Metal Rhinestone Bohemian Minimalist Style For Women
$0.84
No MOQ
Mobius Ring Stud Earrings Copper Silver Earring Post With Round Zircon Minimalist Elegant Fashion Jewelry For Women
Mobius Ring Stud Earrings Copper Silver Earring Post With Round Zircon Minimalist Elegant Fashion Jewelry For Women
like
Find Similar
Detailed view of silver S925 Mobius stud earrings with sparkling round zircon accents - Silver Sparkling Zirconia Mobius Stud Earrings
Mobius Ring Stud Earrings Copper Silver Earring Post With Round Zircon Minimalist Elegant Fashion Jewelry For Women
-4%
$0.82
Mix MOQ : 2
Free Shipping
Alloy Hand Back Chain Bracelet Gold Color Hollow Out Fingernail Claws Finger Ring Decor Gothic Exotic For Women
Alloy Hand Back Chain Bracelet Gold Color Hollow Out Fingernail Claws Finger Ring Decor Gothic Exotic For Women
like
Find Similar
Golden hip hop hollow round slave bracelet with tassel finger nail covers for women - Gold
Alloy Hand Back Chain Bracelet Gold Color Hollow Out Fingernail Claws Finger Ring Decor Gothic Exotic For Women
$1.34
Mix MOQ : 2
Heart Charm Stainless Steel 18K Gold Plated Cable Wire Open Adjustable Bangle Bracelet And Ring For Women Fashion Jewelry
Heart Charm Stainless Steel 18K Gold Plated Cable Wire Open Adjustable Bangle Bracelet And Ring For Women Fashion Jewelry
like
Find Similar
18K gold plated heart cable jewelry set featuring a twisted wire bracelet and matching ring - Gold
Heart Charm Stainless Steel 18K Gold Plated Cable Wire Open Adjustable Bangle Bracelet And Ring For Women Fashion Jewelry
-5%
$4.18
Mix MOQ : 2
Free Shipping
Silver Plated Copper Star Artificial Pearl Stud Earrings Minimalist Four Pointed Star Geometric Planet Ring Jewelry For Women
Silver Plated Copper Star Artificial Pearl Stud Earrings Minimalist Four Pointed Star Geometric Planet Ring Jewelry For Women
like
Find Similar
Minimalist S925 silver star pearl stud earrings with planet ring design for women - Silver Four-Point Star Pearl Style (XP51)
NewSilver Plated Copper Star Artificial Pearl Stud Earrings Minimalist Four Pointed Star Geometric Planet Ring Jewelry For Women
-4%
$0.70
Mix MOQ : 2
Free Shipping
Asymmetric Long Dangle Earrings Stainless Steel Gold Plated Black Cube Geometric Oval Rings Minimalist Jewelry For Women
Asymmetric Long Dangle Earrings Stainless Steel Gold Plated Black Cube Geometric Oval Rings Minimalist Jewelry For Women
like
Find Similar
Asymmetric gold geometric hoop earrings with black cube charms and long fringe tassels - Asymmetric Tassel Style
NewAsymmetric Long Dangle Earrings Stainless Steel Gold Plated Black Cube Geometric Oval Rings Minimalist Jewelry For Women
-4%
$2.99
No MOQ
Free Shipping
Rhinestone Double Interlocking Ring Stud Earrings With 925 Sterling Silver Post Fashion Copper Earrings For Women
Rhinestone Double Interlocking Ring Stud Earrings With 925 Sterling Silver Post Fashion Copper Earrings For Women
like
Find Similar
Elegant double hoop earrings with micro-paved rhinestones and S925 silver needles. - Silver
Rhinestone Double Interlocking Ring Stud Earrings With 925 Sterling Silver Post Fashion Copper Earrings For Women
$3.46
No MOQ
Starfish Jewelry Arm Ring Cuff Bracelet And Finger Ring Alloy Hammered Texture Bohemian Beach Vacation Style Women
Starfish Jewelry Arm Ring Cuff Bracelet And Finger Ring Alloy Hammered Texture Bohemian Beach Vacation Style Women
like
Find Similar
Detail showing hammered texture and starfish charms on golden bracelet and ring set - Golden 3-Piece Set
NewStarfish Jewelry Arm Ring Cuff Bracelet And Finger Ring Alloy Hammered Texture Bohemian Beach Vacation Style Women
$2.57
No MOQ
Hollow Leaf Necklace Earring Ring Jewelry Alloy Gold Plated Fashion Simple Nature Theme Women Accessories
Hollow Leaf Necklace Earring Ring Jewelry Alloy Gold Plated Fashion Simple Nature Theme Women Accessories
like
Find Similar
Detailed view of gold hollow leaf necklace, earrings, and ring set with vein texture - Golden 3-Piece Set
Hollow Leaf Necklace Earring Ring Jewelry Alloy Gold Plated Fashion Simple Nature Theme Women Accessories
$1.70
No MOQ
Free Shipping
Minimalist Geometric Gold Plated Alloy Jewelry Bracelet And Ring Abstract Spiral Open Adjustable For Women Elegant
Minimalist Geometric Gold Plated Alloy Jewelry Bracelet And Ring Abstract Spiral Open Adjustable For Women Elegant
like
Find Similar
Polished gold infinity spiral arm cuff and matching ring set on a stone surface - Golden 2-Piece Set (Bangle + Ring)
NewMinimalist Geometric Gold Plated Alloy Jewelry Bracelet And Ring Abstract Spiral Open Adjustable For Women Elegant
$1.44
No MOQ
Minimalist Alloy Gold Plated Choker Bangle And Ring High Texture Open Circle Round Bead Jewelry For Women
Minimalist Alloy Gold Plated Choker Bangle And Ring High Texture Open Circle Round Bead Jewelry For Women
like
Find Similar
Minimalist gold jewelry set featuring open necklace, bracelet, and ball-accented ring - Gold Yellow
Minimalist Alloy Gold Plated Choker Bangle And Ring High Texture Open Circle Round Bead Jewelry For Women
$2.04
No MOQ
Polished Gold Alloy Open Cuff Bracelet And Ring Minimalist Organic Teardrop Shape Jewelry For Women
Polished Gold Alloy Open Cuff Bracelet And Ring Minimalist Organic Teardrop Shape Jewelry For Women
like
Find Similar
Polished gold adjustable open bangle and wave ring set for women in minimalist style - Gold Yellow
Polished Gold Alloy Open Cuff Bracelet And Ring Minimalist Organic Teardrop Shape Jewelry For Women
$2.15
No MOQ
Geometric Chunky Link Chain Earrings 18K Gold Plated Titanium Steel Interlocking Double Ring Niche Minimalist For Women
Geometric Chunky Link Chain Earrings 18K Gold Plated Titanium Steel Interlocking Double Ring Niche Minimalist For Women
like
Find Similar
Modern 18K gold plated titanium steel double-link chain earrings on white background - Gold
NewGeometric Chunky Link Chain Earrings 18K Gold Plated Titanium Steel Interlocking Double Ring Niche Minimalist For Women
$2.21
No MOQ
Free Shipping
Vintage French Style Jewelry Necklace Earrings Ring Red Enamel Circular Wrinkled Alloy Gold Color For Women
Vintage French Style Jewelry Necklace Earrings Ring Red Enamel Circular Wrinkled Alloy Gold Color For Women
like
Find Similar
Detail of vintage gold-rimmed red enamel necklace and earrings set with pleated texture - Necklace-Gold-Red (3-Piece Set)
NewVintage French Style Jewelry Necklace Earrings Ring Red Enamel Circular Wrinkled Alloy Gold Color For Women
$3.74
No MOQ
Leopard Print Round Acrylic Pendant Necklace With Faux Suede Leather Cord Geometric Ring Sweater Chain For Women
Leopard Print Round Acrylic Pendant Necklace With Faux Suede Leather Cord Geometric Ring Sweater Chain For Women
like
Find Similar
Detail of leopard print acrylic round pendant with brown faux leather cord on a tray - Leopard Round (WN1696) / Brown
Leopard Print Round Acrylic Pendant Necklace With Faux Suede Leather Cord Geometric Ring Sweater Chain For Women
$2.57
No MOQ
Free Shipping
Gourd Shape Necklace And Open Ring Green Resin Inlaid Zircon Brass Vintage Chinese Style Jewelry For Women
Gourd Shape Necklace And Open Ring Green Resin Inlaid Zircon Brass Vintage Chinese Style Jewelry For Women
like
Find Similar
Close-up of green resin gourd pendant with zircon flower detail on fine silver chain - Necklace - Silver Green
Gourd Shape Necklace And Open Ring Green Resin Inlaid Zircon Brass Vintage Chinese Style Jewelry For Women
$3.09
No MOQ
Free Shipping
Irregular Ring Pendant Necklace 18K Gold Plated Stainless Steel Minimalist Geometric Circle Black Rope Cord For Women
Irregular Ring Pendant Necklace 18K Gold Plated Stainless Steel Minimalist Geometric Circle Black Rope Cord For Women
like
Find Similar
18K gold plated irregular oval pendant necklace on black cord for women's fashion - Gold
Irregular Ring Pendant Necklace 18K Gold Plated Stainless Steel Minimalist Geometric Circle Black Rope Cord For Women
$3.74
No MOQ
 · 
10 views
Free Shipping
Men Hip Hop Pendant Necklace Titanium Steel Retro Cross Star Ring Inlaid Zirconia Enamel Punk Style Jewelry Accessory
Men Hip Hop Pendant Necklace Titanium Steel Retro Cross Star Ring Inlaid Zirconia Enamel Punk Style Jewelry Accessory
like
Find Similar
Vintage S925 silver necklace with cross pendant and black enamel ring for men - Circle Cross Style (A5008)
Men Hip Hop Pendant Necklace Titanium Steel Retro Cross Star Ring Inlaid Zirconia Enamel Punk Style Jewelry Accessory
$3.41
No MOQ
Free Shipping
925 Sterling Silver Two-Tone Double Ring Pendant Necklace For Women Minimalist Brushed Gold Silver Paved Rhinestone Clavicle Chain Jewelry
925 Sterling Silver Two-Tone Double Ring Pendant Necklace For Women Minimalist Brushed Gold Silver Paved Rhinestone Clavicle Chain Jewelry
like
Find Similar
1 option
925 Sterling Silver Two-Tone Double Ring Pendant Necklace For Women Minimalist Brushed Gold Silver Paved Rhinestone Clavicle Chain Jewelry
$31.18
No MOQ
Free Shipping
Lily Of The Valley Flower Pendant Necklace Copper Circle Ring Clavicle Chain Minimalist Jewelry Gift For Women
Lily Of The Valley Flower Pendant Necklace Copper Circle Ring Clavicle Chain Minimalist Jewelry Gift For Women
like
Find Similar
Silver Lily of the Valley pendant necklace with round ring on dark blue velvet - Silver Ring Orchid
Lily Of The Valley Flower Pendant Necklace Copper Circle Ring Clavicle Chain Minimalist Jewelry Gift For Women
-5%
$1.46
Mix MOQ : 2
Free Shipping
Colorful Seed Bead Jewelry Necklace Bracelet Ring Handmade Bohemia Summer Style Sweet Accessories
Colorful Seed Bead Jewelry Necklace Bracelet Ring Handmade Bohemia Summer Style Sweet Accessories
like
Find Similar
3-piece seed bead jewelry set including necklace bracelet and ring in bohemian style - 3-Piece Set Colorful Ring Bracelet Necklace
NewColorful Seed Bead Jewelry Necklace Bracelet Ring Handmade Bohemia Summer Style Sweet Accessories
$1.44
No MOQ
Free Shipping
Gothic Cross Pendant Necklace Titanium Steel Cuban Chain Never Say Die Engraved Ring Heavy Industrial Style Jewelry Gift
Gothic Cross Pendant Necklace Titanium Steel Cuban Chain Never Say Die Engraved Ring Heavy Industrial Style Jewelry Gift
like
Find Similar
1 option
Gothic Cross Pendant Necklace Titanium Steel Cuban Chain Never Say Die Engraved Ring Heavy Industrial Style Jewelry Gift
$4.72
No MOQ
Double Ring Pendant Necklace Stainless Steel Alloy Rhinestone Black Silver Geometric Circle Necklace Men Women Jewelry
Double Ring Pendant Necklace Stainless Steel Alloy Rhinestone Black Silver Geometric Circle Necklace Men Women Jewelry
like
Find Similar
Double ring letter pendant necklace with black and silver finish and crystal accent - Silver and Black Double Ring Style
Double Ring Pendant Necklace Stainless Steel Alloy Rhinestone Black Silver Geometric Circle Necklace Men Women Jewelry
-5%
$1.33
Mix MOQ : 2
Bohemian Vintage Alloy Swan Green Wood Ring Pendant Long Necklace For Women Ethnic Wax Cord Beaded Sweater Chain Jewelry
Bohemian Vintage Alloy Swan Green Wood Ring Pendant Long Necklace For Women Ethnic Wax Cord Beaded Sweater Chain Jewelry
like
Find Similar
Vintage long necklace with green wooden ring, bronze swan pendant and colorful beads - Bronze Swan Wood Ring Pendant (N0324)
Bohemian Vintage Alloy Swan Green Wood Ring Pendant Long Necklace For Women Ethnic Wax Cord Beaded Sweater Chain Jewelry
$1.44
No MOQ
Vintage Ethnic Bohemian Long Necklace For Women Wood Ring Bronze Alloy Hollow Flower Pendant Woven Wax Cord Sweater Chain
Vintage Ethnic Bohemian Long Necklace For Women Wood Ring Bronze Alloy Hollow Flower Pendant Woven Wax Cord Sweater Chain
like
Find Similar
Retro bohemian long necklace with hollow metal flower and wood circle pendant for women - Vintage Hollow Flower Wood Ring Pendant (N0302)
NewVintage Ethnic Bohemian Long Necklace For Women Wood Ring Bronze Alloy Hollow Flower Pendant Woven Wax Cord Sweater Chain
$1.44
No MOQ
Men's Leather Bracelet Vintage Punk Style Wristband with Metal Circle Ring and Rivets Adjustable Fashion Jewelry for Men
Men's Leather Bracelet Vintage Punk Style Wristband with Metal Circle Ring and Rivets Adjustable Fashion Jewelry for Men
like
Find Similar
Men's retro brown leather bracelet with large gunmetal ring and snap button closure - Dark Brown
Men's Leather Bracelet Vintage Punk Style Wristband with Metal Circle Ring and Rivets Adjustable Fashion Jewelry for Men
$1.00
No MOQ
Double Ring Bangle Stainless Steel Minimalist Geometric Open Cuff Bracelet Fashion Jewelry For Women
Double Ring Bangle Stainless Steel Minimalist Geometric Open Cuff Bracelet Fashion Jewelry For Women
like
Find Similar
1 option
Double Ring Bangle Stainless Steel Minimalist Geometric Open Cuff Bracelet Fashion Jewelry For Women
$5.45
No MOQ
Free Shipping
Stainless Steel Dual Tone Geometric Interlocking Oval Ring Tassel Drop Earrings For Women Modern Industrial Style
Stainless Steel Dual Tone Geometric Interlocking Oval Ring Tassel Drop Earrings For Women Modern Industrial Style
like
Find Similar
Two-tone 304 stainless steel interlocking oval chain drop earrings in gold and silver - Gold and Silver Two-Tone Tassel
Stainless Steel Dual Tone Geometric Interlocking Oval Ring Tassel Drop Earrings For Women Modern Industrial Style
-4%
$3.12
No MOQ
Free Shipping
Elegant Gold Plated Alloy Chain Bracelet With Tubular Bamboo Segments And Twisted Rope Texture Rings Minimalist Style
Elegant Gold Plated Alloy Chain Bracelet With Tubular Bamboo Segments And Twisted Rope Texture Rings Minimalist Style
like
Find Similar
Detailed shot of a gold-plated bamboo link bracelet featuring lobster clasp and extension chain - Gold
Elegant Gold Plated Alloy Chain Bracelet With Tubular Bamboo Segments And Twisted Rope Texture Rings Minimalist Style
$1.26
No MOQ
Free Shipping
Alloy Gold Plated Jewelry Choker Necklace Bracelet And Ring Minimalist Geometric Bead Open Design For Women
Alloy Gold Plated Jewelry Choker Necklace Bracelet And Ring Minimalist Geometric Bead Open Design For Women
like
Find Similar
Three-piece gold jewelry set with open collar, beaded ring and layered bracelet on model - Golden 3-Piece Set
Alloy Gold Plated Jewelry Choker Necklace Bracelet And Ring Minimalist Geometric Bead Open Design For Women
$2.31
No MOQ
Golden Alloy Spiral Snail Shell Bracelet And Adjustable Ring Ocean Style Jewelry For Women Vacation Accessory
Golden Alloy Spiral Snail Shell Bracelet And Adjustable Ring Ocean Style Jewelry For Women Vacation Accessory
like
Find Similar
Golden spiral conch jewelry set with a matching ring and bracelet in polished finish - Gold Conch Spiral 2-Piece Set (Bracelet + Ring)
Golden Alloy Spiral Snail Shell Bracelet And Adjustable Ring Ocean Style Jewelry For Women Vacation Accessory
$1.70
No MOQ
Stainless Steel Artificial Pearl Necklace Earrings Ring Gold Plated Geometric Square For Women Retro Fashion Jewelry
Stainless Steel Artificial Pearl Necklace Earrings Ring Gold Plated Geometric Square For Women Retro Fashion Jewelry
like
Find Similar
Gold stainless steel jewelry set with square pearl necklace earrings and ring - Gold Irregular Square Pearl Set (N2690 E5858 R465)
Stainless Steel Artificial Pearl Necklace Earrings Ring Gold Plated Geometric Square For Women Retro Fashion Jewelry
$5.11
No MOQ
Free Shipping
925 Sterling Silver Pendant Necklace Interlocking Double Ring Two Tone Minimalist Modern Jewelry For Women
925 Sterling Silver Pendant Necklace Interlocking Double Ring Two Tone Minimalist Modern Jewelry For Women
like
Find Similar
1 option
925 Sterling Silver Pendant Necklace Interlocking Double Ring Two Tone Minimalist Modern Jewelry For Women
$50.69
No MOQ
Free Shipping
Minimalist Circular Hollow Hoop Earrings Metal Geometric Interlocking Multi Ring Design With Silver Earring Post
Minimalist Circular Hollow Hoop Earrings Metal Geometric Interlocking Multi Ring Design With Silver Earring Post
like
Find Similar
Minimalist silver triple layered hoop earrings with a polished hollow round design - Triple Layered Circle Hoop / Silver
Minimalist Circular Hollow Hoop Earrings Metal Geometric Interlocking Multi Ring Design With Silver Earring Post
$1.26
No MOQ
Free Shipping
Multi Layer Metal Bangle Bracelet And Ring Wave Texture Geometric Open Wide Cuff Fashion Jewelry For Women
Multi Layer Metal Bangle Bracelet And Ring Wave Texture Geometric Open Wide Cuff Fashion Jewelry For Women
like
Find Similar
Detail of silver wavy multilayer open bangle cuff on a white natural stone prop - Bangle / Silver
Multi Layer Metal Bangle Bracelet And Ring Wave Texture Geometric Open Wide Cuff Fashion Jewelry For Women
$2.09
No MOQ
Free Shipping
Finger Ring Bracelet Gold Plated Stainless Steel With Green Zircon Round Geometric Slave Bracelet For Women Jewelry
Finger Ring Bracelet Gold Plated Stainless Steel With Green Zircon Round Geometric Slave Bracelet For Women Jewelry
like
Find Similar
Macro view of gold chain hand harness featuring three green round-cut cubic zirconias - Gold Plated Green Zirconia Slave Style (YYB025057)
Finger Ring Bracelet Gold Plated Stainless Steel With Green Zircon Round Geometric Slave Bracelet For Women Jewelry
$2.36
No MOQ
Free Shipping
Triangle Zebra Stripe Jewelry Stainless Steel Gold Plated Layered Snake Chain Necklace Earrings Ring Women
Triangle Zebra Stripe Jewelry Stainless Steel Gold Plated Layered Snake Chain Necklace Earrings Ring Women
like
Find Similar
Elegant vintage gold triangular jewelry set with black zebra pattern and necklace earrings - Gold Zebra Pattern Set (N2692 E5860 R467)
Triangle Zebra Stripe Jewelry Stainless Steel Gold Plated Layered Snake Chain Necklace Earrings Ring Women
$6.55
No MOQ
Free Shipping
Elegant Copper Infinity Moebius Ring Pendant Necklace For Women Rhinestone Geometric Korean Minimalist Clavicle Chain Jewelry
Elegant Copper Infinity Moebius Ring Pendant Necklace For Women Rhinestone Geometric Korean Minimalist Clavicle Chain Jewelry
like
Find Similar
1 option
Elegant Copper Infinity Moebius Ring Pendant Necklace For Women Rhinestone Geometric Korean Minimalist Clavicle Chain Jewelry
$2.04
No MOQ
Free Shipping
Men Bracelet PU Leather Alloy Multi Layer Braided Design Magnetic Buckle Metal Ring Wristband Retro Casual Jewelry For Men
Men Bracelet PU Leather Alloy Multi Layer Braided Design Magnetic Buckle Metal Ring Wristband Retro Casual Jewelry For Men
like
Find Similar
Men's multi-layer leather bracelet with silver alloy rings and magnetic clasp on white backdrop - Steel
Men Bracelet PU Leather Alloy Multi Layer Braided Design Magnetic Buckle Metal Ring Wristband Retro Casual Jewelry For Men
$1.81
No MOQ
Free Shipping
Multicolor Titanium Steel Interlocking Three Ring Pendant Necklace With Rhinestone Screw Pattern For Men Women Jewelry
Multicolor Titanium Steel Interlocking Three Ring Pendant Necklace With Rhinestone Screw Pattern For Men Women Jewelry
like
Find Similar
Rainbow plated triple interlocking ring necklace in titanium steel with screw motif - Colorful
Multicolor Titanium Steel Interlocking Three Ring Pendant Necklace With Rhinestone Screw Pattern For Men Women Jewelry
-4%
$1.94
Mix MOQ : 2
Retro Punk Men Leather Bracelet Multi-layer Woven Hemp Rope Wood Beads Alloy Ring Rivet Cuff Bracelet Bangle Jewelry
Retro Punk Men Leather Bracelet Multi-layer Woven Hemp Rope Wood Beads Alloy Ring Rivet Cuff Bracelet Bangle Jewelry
like
Find Similar
Men's vintage punk 4-piece multilayer leather bracelet set with metallic ring - Set of 4 (TZ294)
Retro Punk Men Leather Bracelet Multi-layer Woven Hemp Rope Wood Beads Alloy Ring Rivet Cuff Bracelet Bangle Jewelry
-5%
$1.69
No MOQ
Women Retro Long Pendant Necklace Heart Wood Ring Design Alloy Engraved Sweater Chain Bohemian Ethnic Style Jewelry
Women Retro Long Pendant Necklace Heart Wood Ring Design Alloy Engraved Sweater Chain Bohemian Ethnic Style Jewelry
like
Find Similar
Retro long sweater necklace with wooden heart pendant and engraved metal on cord chain - Retro Heart Style (N0308)
Women Retro Long Pendant Necklace Heart Wood Ring Design Alloy Engraved Sweater Chain Bohemian Ethnic Style Jewelry
$1.44
No MOQ
Titanium Steel Intertwined Double Ring Pendant Necklace For Couples Silver Rose Gold Black Roman Numerals Rhinestone Jewelry
Titanium Steel Intertwined Double Ring Pendant Necklace For Couples Silver Rose Gold Black Roman Numerals Rhinestone Jewelry
like
Find Similar
2 options
Titanium Steel Intertwined Double Ring Pendant Necklace For Couples Silver Rose Gold Black Roman Numerals Rhinestone Jewelry
$3.41
No MOQ
Free Shipping
Geometric Rhombus Drop Earrings 18K Gold Plated Stainless Steel Vertical Irregular Hollow Rings Minimalist Jewelry For Women
Geometric Rhombus Drop Earrings 18K Gold Plated Stainless Steel Vertical Irregular Hollow Rings Minimalist Jewelry For Women
like
Find Similar
Minimalist 18K gold plated stainless steel triple irregular hoop earrings for women - 3 Linked Rhombus Earrings - Gold / Gold
Geometric Rhombus Drop Earrings 18K Gold Plated Stainless Steel Vertical Irregular Hollow Rings Minimalist Jewelry For Women
$4.29
No MOQ
Free Shipping
Gothic Punk Black PU Leather Double Layer Leg Ring With Alloy O-Ring And Rivets Adjustable Geometric Body Chain For Women Party
Gothic Punk Black PU Leather Double Layer Leg Ring With Alloy O-Ring And Rivets Adjustable Geometric Body Chain For Women Party
like
Find Similar
Gothic double layer black leather leg ring with silver O-rings and rivet details - Black
Gothic Punk Black PU Leather Double Layer Leg Ring With Alloy O-Ring And Rivets Adjustable Geometric Body Chain For Women Party
-5%
$1.64
No MOQ
Polished Titanium Steel Cylinder Pendant Necklace Interlocking Rings Memory Engraving Men Women Fashion Memorial Jewelry Accessory
Polished Titanium Steel Cylinder Pendant Necklace Interlocking Rings Memory Engraving Men Women Fashion Memorial Jewelry Accessory
like
Find Similar
Polished stainless steel cylinder urn necklace with silver and rose gold rings decoration - Silver (Set With Chain)
Polished Titanium Steel Cylinder Pendant Necklace Interlocking Rings Memory Engraving Men Women Fashion Memorial Jewelry Accessory
-4%
$2.99
No MOQ
Free Shipping
925 Sterling Silver Necklace For Women Double Interlocking Rings Rhinestone Pendant Clavicle Chain Jewelry Gift
925 Sterling Silver Necklace For Women Double Interlocking Rings Rhinestone Pendant Clavicle Chain Jewelry Gift
like
Find Similar
S925 sterling silver interlocking double circle necklace with sparkling moissanite - 925 Silver / White Gold (DO190035-S-W-WH)
925 Sterling Silver Necklace For Women Double Interlocking Rings Rhinestone Pendant Clavicle Chain Jewelry Gift
-20%
$31.65
No MOQ
Free Shipping
Go to

More in jewelry

Lab-Created Gemstone Jewelry

Explore more in toe rings

openfoot jewelryfingersimplewhiteplasticinlaiddesignbodyplated stainless steel
footgold platedsteelartificialpolishedgirlsgold plated adjustableturquoise18k gold platedcolor ring

Ready to source like an insider

Get a direct line to the factory floor — no minimums, no middlemen, no guesswork.
iconReal factory pricing, no markup in betweeniconEvery order hand-inspected before it shipsicon5,000+ new products added daily
Get Inside Access