Everful

Wholesale toe rings

Factory-direct selection, vetted for quality and ready to order.

Sign Up
Toe Rings

Find the perfect pieces: stainless steel rings, copper rings, alloy rings and more

All products in toe rings

filterShow Filters
Best Seller
New Arrivals
Price Drop
Free Shipping
925 Sterling Silver Mobius Rings For Couples Minimalist Polished Frosted Finish Adjustable Open Rings Valentine's Day Gift Jewelry
925 Sterling Silver Mobius Rings For Couples Minimalist Polished Frosted Finish Adjustable Open Rings Valentine's Day Gift Jewelry
like
Find Similar
2 options
925 Sterling Silver Mobius Rings For Couples Minimalist Polished Frosted Finish Adjustable Open Rings Valentine's Day Gift Jewelry
$12.05-13.36
No MOQ
Free Shipping
Men Vintage Biker 1%ER Letter Embossed Ring Stainless Steel Rhombus Signet Ring Retro Punk MC HB Number 13 Hip Hop Jewelry
Men Vintage Biker 1%ER Letter Embossed Ring Stainless Steel Rhombus Signet Ring Retro Punk MC HB Number 13 Hip Hop Jewelry
like
Find Similar
Vintage stainless steel motorcycle ring featuring 1% ER diamond-shaped relief and MC engraving - US 7 / Steel
Vintage motorcycle biker ring in stainless steel with 1% ER and MC gold accents - US 7 / Gold & Silver
+12
Men Vintage Biker 1%ER Letter Embossed Ring Stainless Steel Rhombus Signet Ring Retro Punk MC HB Number 13 Hip Hop Jewelry
$3.41-3.88
No MOQ
Free Shipping
925 Sterling Silver Woven Line Multi Layer Wrap Ring For Women Light Luxury Minimalist Adjustable Open Finger Ring Jewelry Gift
925 Sterling Silver Woven Line Multi Layer Wrap Ring For Women Light Luxury Minimalist Adjustable Open Finger Ring Jewelry Gift
like
Find Similar
Minimalist S925 sterling silver multi-layer woven ring with adjustable open band design - Adjustable Open / Silver
925 Sterling Silver Woven Line Multi Layer Wrap Ring For Women Light Luxury Minimalist Adjustable Open Finger Ring Jewelry Gift
$30.13
No MOQ
Free Shipping
Vintage Copper H-Shaped Hollow Open Ring For Women Engraved Anchor Link Adjustable Retro Minimalist Silver Plated Finger Ring Jewelry
Vintage Copper H-Shaped Hollow Open Ring For Women Engraved Anchor Link Adjustable Retro Minimalist Silver Plated Finger Ring Jewelry
like
Find Similar
Vintage silver hollowed chain ring with intricate engravings and adjustable open design - Adjustable Open / Silver
Vintage Copper H-Shaped Hollow Open Ring For Women Engraved Anchor Link Adjustable Retro Minimalist Silver Plated Finger Ring Jewelry
-5%
$0.67
No MOQ
Free Shipping
Elegant S925 Sterling Silver Faux Artificial Pearl Open Ring For Women Minimalist Adjustable White Shell Artificial Pearl French Style Jewelry
Elegant S925 Sterling Silver Faux Artificial Pearl Open Ring For Women Minimalist Adjustable White Shell Artificial Pearl French Style Jewelry
like
Find Similar
Elegant S925 sterling silver adjustable open ring featuring a lustrous white pearl - Adjustable Open / Pearl (White Gold Color)
Elegant S925 Sterling Silver Faux Artificial Pearl Open Ring For Women Minimalist Adjustable White Shell Artificial Pearl French Style Jewelry
$11.27
No MOQ
Free Shipping
Retro Snake Ring Alloy Adjustable Open Serpent Ring Realistic Scale Texture Vintage Gothic Punk Jewelry Men Women
Retro Snake Ring Alloy Adjustable Open Serpent Ring Realistic Scale Texture Vintage Gothic Punk Jewelry Men Women
like
Find Similar
Vintage gothic snake ring in silver finish with golden details and scale texture - Adjustable Open Snake Ring
Creative rose gold glasses shaped open ring displayed on a wooden jewelry cone stand - Rose Gold Glasses Style (2)
Vintage silver dragon head ring with red gem eyes and oxidized relief details - Red-Eyed Dragon Head Style (4)
Adjustable silver dollar sign ring with vintage textured dots and open band design - Silver Dollar Sign Style (6)
+16
Retro Snake Ring Alloy Adjustable Open Serpent Ring Realistic Scale Texture Vintage Gothic Punk Jewelry Men Women
-5%
$0.16-0.37
No MOQ
 · 
117 sold recently
Irregular Heart Shaped Stainless Steel Open Ring Adjustable Gold Polished Finger Ring For Women Minimalist Jewelry
Irregular Heart Shaped Stainless Steel Open Ring Adjustable Gold Polished Finger Ring For Women Minimalist Jewelry
like
Find Similar
1 option
Irregular Heart Shaped Stainless Steel Open Ring Adjustable Gold Polished Finger Ring For Women Minimalist Jewelry
-5%
$1.69
Mix MOQ : 2
Free Shipping
Vintage Irregular Stainless Steel Open Ring For Women Hollow Wave Design Adjustable Fluid Geometry Statement Jewelry Finger Ring
Vintage Irregular Stainless Steel Open Ring For Women Hollow Wave Design Adjustable Fluid Geometry Statement Jewelry Finger Ring
like
Find Similar
Irregular layered stainless steel open ring with silver finish and dimensions shown - Silver
Gold French vintage hollow irregular wavy ring made of stainless steel for women - Gold
Vintage Irregular Stainless Steel Open Ring For Women Hollow Wave Design Adjustable Fluid Geometry Statement Jewelry Finger Ring
$1.52-1.78
No MOQ
Free Shipping
Vintage Titanium Steel Boxing Glove Ring For Men Retro Punk Chain Band Sporty Fashion Finger Jewelry Accessory Gift
Vintage Titanium Steel Boxing Glove Ring For Men Retro Punk Chain Band Sporty Fashion Finger Jewelry Accessory Gift
like
Find Similar
Retro stainless steel boxing glove ring with vintage punk cuban chain design - US 7 / Boxing Glove Style / Steel
Vintage golden heart ring with embossed details and hollow chain-style band - US 7 / Heart Style / Gold
+10
Vintage Titanium Steel Boxing Glove Ring For Men Retro Punk Chain Band Sporty Fashion Finger Jewelry Accessory Gift
-5%
$3.48
No MOQ
Free Shipping
S925 Sterling Silver Irregular Heart Open Ring For Women Adjustable Minimalist Heart Link Ring Korean Fashion Jewelry Gift
S925 Sterling Silver Irregular Heart Open Ring For Women Adjustable Minimalist Heart Link Ring Korean Fashion Jewelry Gift
like
Find Similar
Polished S925 sterling silver open ring featuring a continuous heart-shaped pattern - Size 13 (Adjustable) / Silver
S925 Sterling Silver Irregular Heart Open Ring For Women Adjustable Minimalist Heart Link Ring Korean Fashion Jewelry Gift
-16%
$20.64
No MOQ
Free Shipping
Vintage Titanium Steel Skull Cross Guns Pirate Ring For Men Gothic Punk Biker Jewelry Distressed Silver Color Finger Band
Vintage Titanium Steel Skull Cross Guns Pirate Ring For Men Gothic Punk Biker Jewelry Distressed Silver Color Finger Band
like
Find Similar
4 options
Vintage Titanium Steel Skull Cross Guns Pirate Ring For Men Gothic Punk Biker Jewelry Distressed Silver Color Finger Band
-4%
$2.87
No MOQ
Free Shipping
Bohemian Stainless Steel Open Ring For Women Vintage Gold Plated Beaded Band Adjustable Resin Turquoise Amber Finger Ring
Bohemian Stainless Steel Open Ring For Women Vintage Gold Plated Beaded Band Adjustable Resin Turquoise Amber Finger Ring
like
Find Similar
Macro shot of a 1.5cm blue stone ring with golden rope texture and 3g weight data - Deep Blue Stone (RC-1083G01)
Detail of 1.5cm turquoise stone on gold twisted band ring weighing 3g with size labels - Turquoise Stone (RC-1083G02)
Macro view of gold ring featuring amber stone with size and weight measurements - Amber Orange (RC-1083G03)
Bohemian Stainless Steel Open Ring For Women Vintage Gold Plated Beaded Band Adjustable Resin Turquoise Amber Finger Ring
$1.44
No MOQ
Free Shipping
Luxury 925 Sterling Silver Ring Set For Women Geometric Square Cluster Inlaid Zirconia Layering Rings Fashion Jewelry Gift
Luxury 925 Sterling Silver Ring Set For Women Geometric Square Cluster Inlaid Zirconia Layering Rings Fashion Jewelry Gift
like
Find Similar
Luxurious S925 sterling silver rhyming square diamond ring set with marquise stones - US 6 / Silver
Luxury 925 Sterling Silver Ring Set For Women Geometric Square Cluster Inlaid Zirconia Layering Rings Fashion Jewelry Gift
-5%
$53.51
No MOQ
Free Shipping
S925 Sterling Silver Open Ring For Women Niche Design Minimalist Retro Striped Texture Adjustable Finger Ring Jewelry Gift
S925 Sterling Silver Open Ring For Women Niche Design Minimalist Retro Striped Texture Adjustable Finger Ring Jewelry Gift
like
Find Similar
Minimalist S925 sterling silver open ring with vertical stripe texture and wide band design - Adjustable Open / Fine Textured Ice Style (JZB147)
S925 Sterling Silver Open Ring For Women Niche Design Minimalist Retro Striped Texture Adjustable Finger Ring Jewelry Gift
-12%
$28.12
No MOQ
Free Shipping
Copper Evil Eye Adjustable Ring For Women Teardrop Zirconia Enamel Open Band Vintage Fashion Finger Jewelry Accessory Gift
Copper Evil Eye Adjustable Ring For Women Teardrop Zirconia Enamel Open Band Vintage Fashion Finger Jewelry Accessory Gift
like
Find Similar
Pink evil eye adjustable open ring with gold metal water drop design for women - Pink (ZYN-DMR70G-2)
Close-up of golden evil eye adjustable ring with blue enamel and metallic bead accents - Blue White (ZYN-DMR70G-3)
Macro view of gold teardrop evil eye ring with black enamel and bead edge details - Black (ZYN-DMR70G-5)
Golden evil eye adjustable open ring with blue enamel and teardrop shape design - Dark Blue (ZYN-DMR70G-1)
+2
Copper Evil Eye Adjustable Ring For Women Teardrop Zirconia Enamel Open Band Vintage Fashion Finger Jewelry Accessory Gift
-4%
$1.57
Mix MOQ : 2
Free Shipping
Vintage Punk Men Black Titanium Steel Ring With Red Maltese Cross Enamel Gothic Motorcycle Band Ring Jewelry Gift
Vintage Punk Men Black Titanium Steel Ring With Red Maltese Cross Enamel Gothic Motorcycle Band Ring Jewelry Gift
like
Find Similar
Retro punk black titanium steel ring for men featuring a red Maltese cross relief design - US 7 / Black
+6
Vintage Punk Men Black Titanium Steel Ring With Red Maltese Cross Enamel Gothic Motorcycle Band Ring Jewelry Gift
$3.54
No MOQ
Free Shipping
Handmade Copper Beads Beaded Ring For Women Fresh Sweet Daisy Flower Glass Beads Elastic Finger Ring Resort Style Jewelry
Handmade Copper Beads Beaded Ring For Women Fresh Sweet Daisy Flower Glass Beads Elastic Finger Ring Resort Style Jewelry
like
Find Similar
Handmade woven daisy flower beaded ring with gold copper beads for a casual women's style - Gold White Beaded Daisy Flower Style (JS-R24042501A)
Handmade Copper Beads Beaded Ring For Women Fresh Sweet Daisy Flower Glass Beads Elastic Finger Ring Resort Style Jewelry
-11%
$0.81
No MOQ
 · 
51 sold recently
Free Shipping
French Vintage Stainless Steel Tiger Eye Stone Adjustable Open Ring For Women Bohemian Style Jewelry Gold Plated Accessory
French Vintage Stainless Steel Tiger Eye Stone Adjustable Open Ring For Women Bohemian Style Jewelry Gold Plated Accessory
like
Find Similar
Detailed view of twisted 18K gold plated steel ring with oval tiger eye stone inlay - Twist Rope Tiger Eye Style (JDR0307007)
Macro shot of 18K gold stainless steel ring featuring oval tiger eye stone and radial metal frame - Sunburst Hollow Tiger Eye Style (JDR0307008)
French Vintage Stainless Steel Tiger Eye Stone Adjustable Open Ring For Women Bohemian Style Jewelry Gold Plated Accessory
$2.36-3.01
No MOQ
Free Shipping
925 Sterling Silver Wave Ring For Women Vintage Triple Layer Mobius Hollow Out Open Adjustable Fashion Finger Ring Jewelry
925 Sterling Silver Wave Ring For Women Vintage Triple Layer Mobius Hollow Out Open Adjustable Fashion Finger Ring Jewelry
like
Find Similar
1 option
925 Sterling Silver Wave Ring For Women Vintage Triple Layer Mobius Hollow Out Open Adjustable Fashion Finger Ring Jewelry
-14%
$18.86
No MOQ
Free Shipping
304 Stainless Steel Pave Zirconia Ring Minimalist Stackable Band For Women Elegant Wedding Party Fashion Jewelry Gift
304 Stainless Steel Pave Zirconia Ring Minimalist Stackable Band For Women Elegant Wedding Party Fashion Jewelry Gift
like
Find Similar
Close-up of sparkling silver stainless steel eternity ring with paved clear crystals - US 6 / Steel
Macro detail of gold plated eternity ring featuring pavé set crystals on white background - US 6 / Gold
+6
304 Stainless Steel Pave Zirconia Ring Minimalist Stackable Band For Women Elegant Wedding Party Fashion Jewelry Gift
$3.24-3.46
No MOQ
 · 
27 sold recently
Free Shipping
Vintage St Michael Protect Us Archangel Signet Ring For Men Stainless Steel Religious Cross Guardian Amulet Finger Ring
Vintage St Michael Protect Us Archangel Signet Ring For Men Stainless Steel Religious Cross Guardian Amulet Finger Ring
like
Find Similar
Vintage St. Michael stainless steel signet ring with religious relief and black finish - US 7 / Steel
Polished gold Saint Michael Archangel signet ring with religious relief and engraving - US 7 / Gold
+12
Vintage St Michael Protect Us Archangel Signet Ring For Men Stainless Steel Religious Cross Guardian Amulet Finger Ring
-4%
$2.94-3.19
No MOQ
Free Shipping
Vintage Distressed Antique Silver Titanium Steel Ring Roman Numeral Engraved Band For Men Women Retro Industrial Style Jewelry
Vintage Distressed Antique Silver Titanium Steel Ring Roman Numeral Engraved Band For Men Women Retro Industrial Style Jewelry
like
Find Similar
Retro stainless steel ring with Roman numerals engraving and aged silver finish - US 6 / Curved Roman Numeral Design
Detailed close-up of retro silver stainless steel ring with Roman numeral engravings - US 6 / Flat Roman Numeral Design
+14
Vintage Distressed Antique Silver Titanium Steel Ring Roman Numeral Engraved Band For Men Women Retro Industrial Style Jewelry
$0.92
No MOQ
Free Shipping
S925 Sterling Silver Ring Hand Wrapped Wire Design Adjustable Opening Vintage Minimalist Hand Jewelry For Women Finger Ring
S925 Sterling Silver Ring Hand Wrapped Wire Design Adjustable Opening Vintage Minimalist Hand Jewelry For Women Finger Ring
like
Find Similar
1 option
S925 Sterling Silver Ring Hand Wrapped Wire Design Adjustable Opening Vintage Minimalist Hand Jewelry For Women Finger Ring
-14%
$23.04
No MOQ
Free Shipping
925 Sterling Silver Evil Eye Heart Ring For Women Luxury Zirconia Inlaid Enamel Band Ring Fashion Jewelry Finger Ring Gift
925 Sterling Silver Evil Eye Heart Ring For Women Luxury Zirconia Inlaid Enamel Band Ring Fashion Jewelry Finger Ring Gift
like
Find Similar
Elegant S925 sterling silver evil eye ring with blue enamel and heart zircon inlay - US 8 / Silver
925 Sterling Silver Evil Eye Heart Ring For Women Luxury Zirconia Inlaid Enamel Band Ring Fashion Jewelry Finger Ring Gift
-20%
$24.19
No MOQ
Free Shipping
S925 Sterling Silver Irregular Wrinkled Open Ring For Women Minimalist Lava Texture Adjustable Ring Personalized Niche Fashion Jewelry
S925 Sterling Silver Irregular Wrinkled Open Ring For Women Minimalist Lava Texture Adjustable Ring Personalized Niche Fashion Jewelry
like
Find Similar
S925 sterling silver open ring with unique crumpled texture on a woven mat background - Adjustable Open / Wrinkled Texture Style (JZH035)
NewS925 Sterling Silver Irregular Wrinkled Open Ring For Women Minimalist Lava Texture Adjustable Ring Personalized Niche Fashion Jewelry
-11%
$36.84
No MOQ
Free Shipping
Wolf Head Ring Alloy Vintage Silver Color Detailed Carving Punk Gothic Hip Hop Retro Style Jewelry For Men Women
Wolf Head Ring Alloy Vintage Silver Color Detailed Carving Punk Gothic Hip Hop Retro Style Jewelry For Men Women
like
Find Similar
Vintage silver wolf head ring for men in retro gothic style with detailed metal engraving - Antique Silver / US 6
+5
Wolf Head Ring Alloy Vintage Silver Color Detailed Carving Punk Gothic Hip Hop Retro Style Jewelry For Men Women
-16%
$0.54
No MOQ
 · 
96 sold recently
Men Vintage Gothic Rings Alloy Black Rhinestone Hollow Star Cross Pattern Punk Style Party Jewelry Finger Accessory
Men Vintage Gothic Rings Alloy Black Rhinestone Hollow Star Cross Pattern Punk Style Party Jewelry Finger Accessory
like
Find Similar
5-piece vintage silver ring set for men with black stone inlays and embossed patterns - Antique Silver
Men Vintage Gothic Rings Alloy Black Rhinestone Hollow Star Cross Pattern Punk Style Party Jewelry Finger Accessory
$1.81
No MOQ
Vintage 18K Gold Plated Stainless Steel Heart Adjustable Ring Retro Embossed Belt Buckle Motif Jewelry Gift For Women
Vintage 18K Gold Plated Stainless Steel Heart Adjustable Ring Retro Embossed Belt Buckle Motif Jewelry Gift For Women
like
Find Similar
Detail view of 18K gold heart ring showing waterproof stainless steel and sizing info - Belt Buckle Heart Style (JDR0108012)
Detail of 18K gold stainless steel ring with pearl, heart, and crystal G letter charms - Heart Pearl Letter G Style (JDR0204008)
Vintage 18K Gold Plated Stainless Steel Heart Adjustable Ring Retro Embossed Belt Buckle Motif Jewelry Gift For Women
$3.54-4.06
No MOQ
Free Shipping
Vintage Fashion 925 Sterling Silver Hollow Heart Ring Original Design Minimalist Commuter Style Finger Ring For Women Jewelry
Vintage Fashion 925 Sterling Silver Hollow Heart Ring Original Design Minimalist Commuter Style Finger Ring For Women Jewelry
like
Find Similar
Vintage 925 sterling silver hollow heart ring with S925 stamp on a white background - US Size 5 / Silver
+4
NewVintage Fashion 925 Sterling Silver Hollow Heart Ring Original Design Minimalist Commuter Style Finger Ring For Women Jewelry
-4%
$17.56
No MOQ
Free Shipping
Luminous Leaf Branch Open Ring Glow In The Dark Zinc Alloy Adjustable Finger Ring For Halloween Party Unisex Jewelry Gift
Luminous Leaf Branch Open Ring Glow In The Dark Zinc Alloy Adjustable Finger Ring For Halloween Party Unisex Jewelry Gift
like
Find Similar
Detailed close-up of adjustable leaf ring glowing in dark with green luminescent filling - Silver Green Glow
Macro shot of luminous blue leaf ring with adjustable silver branch design for Halloween - Silver Blue Glow
Detailed macro view of glowing blue leaf ring with adjustable silver open band design - Silver Teal Glow
Macro shot of luminous orange leaf ring with glow-in-the-dark effects in the dark - Silver Orange Red Glow
Luminous Leaf Branch Open Ring Glow In The Dark Zinc Alloy Adjustable Finger Ring For Halloween Party Unisex Jewelry Gift
-4%
$0.80
No MOQ
Minimalist 925 Sterling Silver Adjustable Open Ring For Women Niche Molten Liquid Metal Design Irregular Finger Ring
Minimalist 925 Sterling Silver Adjustable Open Ring For Women Niche Molten Liquid Metal Design Irregular Finger Ring
like
Find Similar
1 option
Minimalist 925 Sterling Silver Adjustable Open Ring For Women Niche Molten Liquid Metal Design Irregular Finger Ring
-17%
$35.69
No MOQ
Free Shipping
Minimalist 18K Gold Plated Stainless Steel Open Ring For Women Hollow Geometric Round Adjustable Rhinestone Finger Ring Retro Jewelry Gift
Minimalist 18K Gold Plated Stainless Steel Open Ring For Women Hollow Geometric Round Adjustable Rhinestone Finger Ring Retro Jewelry Gift
like
Find Similar
Detailed size specifications of 316L stainless steel ring with synthetic turquoise stone - Blue Stone Style (HR0003G47-1)
Adjustable 18K gold-plated open ring with green stone inlay and detailed size specifications - Green Stone Style (HR0003G47-2)
Minimalist 18K gold plated ring with a large circular frame and purple gemstone - Purple Stone Style (HR0003G47-3)
Minimalist 18K Gold Plated Stainless Steel Open Ring For Women Hollow Geometric Round Adjustable Rhinestone Finger Ring Retro Jewelry Gift
$2.07
No MOQ
Free Shipping
Vintage 925 Sterling Silver Heart Open Ring For Women Korean Minimalist Hollow Love Heart Double Layer Adjustable Jewelry Ring
Vintage 925 Sterling Silver Heart Open Ring For Women Korean Minimalist Hollow Love Heart Double Layer Adjustable Jewelry Ring
like
Find Similar
S925 sterling silver minimalist open ring with hollow heart-shaped linked pattern - Adjustable Open / Heart Vintage Open Ring (JZA147)
Vintage 925 Sterling Silver Heart Open Ring For Women Korean Minimalist Hollow Love Heart Double Layer Adjustable Jewelry Ring
-12%
$24.39
No MOQ
Free Shipping
S925 Sterling Silver Korean Niche Design Gold Silver Contrast Wave Open Ring Minimalist Adjustable Geometric Finger Ring For Women
S925 Sterling Silver Korean Niche Design Gold Silver Contrast Wave Open Ring Minimalist Adjustable Geometric Finger Ring For Women
like
Find Similar
Minimalist S925 sterling silver wavy open ring with gold and silver two-tone layered design - Adjustable Open / Double Layer Intertwined Wave Style (JZH017)
S925 Sterling Silver Korean Niche Design Gold Silver Contrast Wave Open Ring Minimalist Adjustable Geometric Finger Ring For Women
-13%
$24.89
No MOQ
Free Shipping
Vintage Punk Skull Stainless Steel Ring For Men Women Gothic Hip Hop Distressed Titanium Steel Thumb Ring Personality Jewelry Gift
Vintage Punk Skull Stainless Steel Ring For Men Women Gothic Hip Hop Distressed Titanium Steel Thumb Ring Personality Jewelry Gift
like
Find Similar
Punk style skull stack ring in vintage titanium steel with detailed retro carving - US 7 / Antique Silver
+5
Vintage Punk Skull Stainless Steel Ring For Men Women Gothic Hip Hop Distressed Titanium Steel Thumb Ring Personality Jewelry Gift
-4%
$3.24
No MOQ
Free Shipping
Geometric Zircon Rings Titanium Steel Gold Plated Colorful Gemstone Statement Jewelry Women Fashion Accessory
Geometric Zircon Rings Titanium Steel Gold Plated Colorful Gemstone Statement Jewelry Women Fashion Accessory
like
Find Similar
Macro detail of a large oval blue zircon gemstone set in a gold-plated titanium ring - US 6 / Blue Zirconia
Detailed view of an oval yellow gemstone ring on a white silk background - US 6 / Yellow Zirconia
Close-up of a gold-plated titanium ring with a rectangular emerald zircon in a bezel setting - US 6 / Rectangular Green Zircon
Detail of a wide gold ring with a heart-shaped zircon on white silk background - US 6 / Heart-shaped Transparent Zircon
+11
Geometric Zircon Rings Titanium Steel Gold Plated Colorful Gemstone Statement Jewelry Women Fashion Accessory
$3.38-4.95
No MOQ
 · 
10 views
Free Shipping
Vintage Blue Zirconia Flower Open Ring Adjustable Purple Clover Cluster Ring Korean Style Fashion Alloy Ring For Women Daily Jewelry
Vintage Blue Zirconia Flower Open Ring Adjustable Purple Clover Cluster Ring Korean Style Fashion Alloy Ring For Women Daily Jewelry
like
Find Similar
Adjustable silver ring with vintage square cluster of blue and white zircon stones - Blue Zirconia Vintage Cluster Style (J0194) / Silver
Adjustable gold open ring featuring a four-leaf clover design with purple gemstone - Purple Clover Style (J0095) / Gold
Vintage Blue Zirconia Flower Open Ring Adjustable Purple Clover Cluster Ring Korean Style Fashion Alloy Ring For Women Daily Jewelry
-5%
$0.74-1.37
No MOQ
Free Shipping
S925 Sterling Silver Flower Adjustable Drawstring Ring For Women Minimalist Hollow Heart Floral Chain Ring Fashion Jewelry Gift
S925 Sterling Silver Flower Adjustable Drawstring Ring For Women Minimalist Hollow Heart Floral Chain Ring Fashion Jewelry Gift
like
Find Similar
Detailed macro view of S925 sterling silver flower ring with adjustable chain and heart core - Silver
S925 Sterling Silver Flower Adjustable Drawstring Ring For Women Minimalist Hollow Heart Floral Chain Ring Fashion Jewelry Gift
$15.98
No MOQ
Free Shipping
Men's Vintage Feather Ring Set 12 Pieces Punk Gothic Bohemian Adjustable Antique Silver Color Alloy Band Rings Jewelry
Men's Vintage Feather Ring Set 12 Pieces Punk Gothic Bohemian Adjustable Antique Silver Color Alloy Band Rings Jewelry
like
Find Similar
12-piece vintage silver feather ring set for men featuring retro bohemian texture designs - Antique Silver
Men's Vintage Feather Ring Set 12 Pieces Punk Gothic Bohemian Adjustable Antique Silver Color Alloy Band Rings Jewelry
$2.07
No MOQ
Celtic Dragon Stainless Steel Ring For Men Women Retro Punk Style Wide Wedding Band Comfortable Fit Fashion Jewelry Gift
Celtic Dragon Stainless Steel Ring For Men Women Retro Punk Style Wide Wedding Band Comfortable Fit Fashion Jewelry Gift
like
Find Similar
Blue stainless steel dragon ring with silver Celtic knots and blue glitter inlay on white - Size 5 / Blue Dragon Pattern
Macro view of gold stainless steel ring featuring detailed Celtic knot engraving - Size 5 / Gold Dragon Pattern
+16
Celtic Dragon Stainless Steel Ring For Men Women Retro Punk Style Wide Wedding Band Comfortable Fit Fashion Jewelry Gift
-4%
$0.65
Mix MOQ : 2
Free Shipping
Vintage S925 Sterling Silver Karakusa Dragon Scale Ring For Women Gold Silver Contrast Fashion Adjustable Open Ring Jewelry Gift
Vintage S925 Sterling Silver Karakusa Dragon Scale Ring For Women Gold Silver Contrast Fashion Adjustable Open Ring Jewelry Gift
like
Find Similar
S925 sterling silver dragon scale ring with gold contrast and ornate vine engraving - Gold and Silver Contrast Karakusa Style (KDP1508)
Vintage S925 Sterling Silver Karakusa Dragon Scale Ring For Women Gold Silver Contrast Fashion Adjustable Open Ring Jewelry Gift
$36.78
Mix MOQ : 2
Free Shipping
Men Vintage Six Character Mantra Titanium Steel Spinner Ring Ethnic Style Religious Relief Stainless Steel Jewelry Band Ring
Men Vintage Six Character Mantra Titanium Steel Spinner Ring Ethnic Style Religious Relief Stainless Steel Jewelry Band Ring
like
Find Similar
Retro stainless steel spinning ring with embossed silver six-word mantra on black finish - US 7 / Steel
+5
Men Vintage Six Character Mantra Titanium Steel Spinner Ring Ethnic Style Religious Relief Stainless Steel Jewelry Band Ring
$3.41
Mix MOQ : 2
Free Shipping
Vintage Viking Braided Titanium Steel Ring For Men Retro Distressed Finish Masculine Band Ring Masculine Fashion Jewelry
Vintage Viking Braided Titanium Steel Ring For Men Retro Distressed Finish Masculine Band Ring Masculine Fashion Jewelry
like
Find Similar
5 options
Vintage Viking Braided Titanium Steel Ring For Men Retro Distressed Finish Masculine Band Ring Masculine Fashion Jewelry
$3.35
No MOQ
Free Shipping
Dinosaur Adjustable Open Ring Copper T-Rex Animal Shape Creative Fashion Jewelry For Women
Dinosaur Adjustable Open Ring Copper T-Rex Animal Shape Creative Fashion Jewelry For Women
like
Find Similar
Adjustable gold dinosaur ring featuring a T-Rex design with detailed black accents - Adjustable Open / Gold
Adjustable silver T-Rex dinosaur open ring with detailed metal carving for women - Adjustable Open / White Gold
Dinosaur Adjustable Open Ring Copper T-Rex Animal Shape Creative Fashion Jewelry For Women
-4%
$0.85
No MOQ
 · 
32 sold recently
Free Shipping
925 Sterling Silver Butterfly Zirconia Open Adjustable Rings Women Minimalist Fashion Jewelry Single Stone Zirconia Ring
925 Sterling Silver Butterfly Zirconia Open Adjustable Rings Women Minimalist Fashion Jewelry Single Stone Zirconia Ring
like
Find Similar
Exquisite S925 sterling silver butterfly ring with sparkling cubic zirconia on ceramic plate - Adjustable Open / Butterfly Style (D638)
S925 sterling silver ring with a sparkling solitaire zircon in a classic 4-prong setting - Adjustable Open / Single Stone Style (D637)
925 Sterling Silver Butterfly Zirconia Open Adjustable Rings Women Minimalist Fashion Jewelry Single Stone Zirconia Ring
$9.96-11.00
No MOQ
Free Shipping
Men Hip Hop Stainless Steel Eagle Signet Ring Gold Silver Plated Black Enamel Relief Animal Biker Jewelry Finger Ring
Men Hip Hop Stainless Steel Eagle Signet Ring Gold Silver Plated Black Enamel Relief Animal Biker Jewelry Finger Ring
like
Find Similar
Detailed close-up of gold eagle signet ring with black enamel background and vintage patterns - US 7 / Gold
Men's stainless steel eagle signet ring with gold-plated accents and black enamel - US 7 / Steel
+12
Men Hip Hop Stainless Steel Eagle Signet Ring Gold Silver Plated Black Enamel Relief Animal Biker Jewelry Finger Ring
$2.88-3.14
No MOQ
Free Shipping
Viking Compass Stainless Steel Ring For Men Retro Nordic Vegvisir Signet Ring Pitted Texture Punk Gothic Jewelry Band
Viking Compass Stainless Steel Ring For Men Retro Nordic Vegvisir Signet Ring Pitted Texture Punk Gothic Jewelry Band
like
Find Similar
Vintage Nordic Viking compass titanium steel ring with black matte finish and open band - Size 7 / Black
Vintage Nordic Viking Vegvisir compass stainless steel signet ring with honeycomb texture - Size 7 / Steel
+8
Viking Compass Stainless Steel Ring For Men Retro Nordic Vegvisir Signet Ring Pitted Texture Punk Gothic Jewelry Band
$3.01-3.41
No MOQ
Free Shipping
925 Sterling Silver Crown Ring For Women Korean INS Style Flower Shape Oval Adjustable Open Finger Ring French Vintage Jewelry
925 Sterling Silver Crown Ring For Women Korean INS Style Flower Shape Oval Adjustable Open Finger Ring French Vintage Jewelry
like
Find Similar
1 option
925 Sterling Silver Crown Ring For Women Korean INS Style Flower Shape Oval Adjustable Open Finger Ring French Vintage Jewelry
-25%
$17.94
No MOQ
Free Shipping
Vintage 925 Sterling Silver Gold Plated Square Labradorite Ring Elegant Geometric Adjustable Zirconia Jewelry For Women
Vintage 925 Sterling Silver Gold Plated Square Labradorite Ring Elegant Geometric Adjustable Zirconia Jewelry For Women
like
Find Similar
Square labradorite silver ring in gold finish with side stones and adjustable band - Adjustable Open / Labradorite
Vintage 925 Sterling Silver Gold Plated Square Labradorite Ring Elegant Geometric Adjustable Zirconia Jewelry For Women
$24.91
No MOQ
Free Shipping
925 Sterling Silver Lace Textured Open Ring For Women Beaded Woven Design Adjustable Vintage Minimalist Fashion Jewelry
925 Sterling Silver Lace Textured Open Ring For Women Beaded Woven Design Adjustable Vintage Minimalist Fashion Jewelry
like
Find Similar
Minimalist S925 sterling silver open ring with textured crown beads and frosted finish - Adjustable Open / Micro-beaded Lace Woven Style (JZX062)
925 Sterling Silver Lace Textured Open Ring For Women Beaded Woven Design Adjustable Vintage Minimalist Fashion Jewelry
-12%
$43.31
No MOQ
Free Shipping
Crochet Ring Knitting Tension Guide Adjustable Spiral Metal Wire Finger Ring Crafting Tool Artistic Style
Crochet Ring Knitting Tension Guide Adjustable Spiral Metal Wire Finger Ring Crafting Tool Artistic Style
like
Find Similar
Close-up of blue metallic spiral crochet ring for tension control and knitting - Sapphire Blue
Detailed view of orange metal spiral crochet ring with smooth coil design for knitting - Orange Red
Macro shot of rose gold spiral tension ring for knitting crochet on white background - Pink
Macro shot of an adjustable gold S-shaped spiral crochet ring for knitting and tension - Gold
+11
Crochet Ring Knitting Tension Guide Adjustable Spiral Metal Wire Finger Ring Crafting Tool Artistic Style
$0.12-1.73
Mix MOQ : 2
 · 
84 sold recently
Free Shipping
Vintage Stainless Steel Bulldog Ring For Men Gothic Punk Animal Head Biker Finger Ring Dominating Retro Jewelry Gift
Vintage Stainless Steel Bulldog Ring For Men Gothic Punk Animal Head Biker Finger Ring Dominating Retro Jewelry Gift
like
Find Similar
2 options
Vintage Stainless Steel Bulldog Ring For Men Gothic Punk Animal Head Biker Finger Ring Dominating Retro Jewelry Gift
$3.09
No MOQ
Free Shipping
Vintage Punk Double Head Snake Open Ring For Men Women Adjustable Alloy Silver Color Snake Scale Texture Jewelry Finger Ring
Vintage Punk Double Head Snake Open Ring For Men Women Adjustable Alloy Silver Color Snake Scale Texture Jewelry Finger Ring
like
Find Similar
Vintage punk double snake head ring with adjustable open band and scale texture - Silver
Vintage Punk Double Head Snake Open Ring For Men Women Adjustable Alloy Silver Color Snake Scale Texture Jewelry Finger Ring
$0.73
Mix MOQ : 2
Free Shipping
Vintage Stainless Steel Eagle Feather Open Ring For Men Retro Oxidized Adjustable Punk Gothic Finger Ring Biker Jewelry Gift
Vintage Stainless Steel Eagle Feather Open Ring For Men Retro Oxidized Adjustable Punk Gothic Finger Ring Biker Jewelry Gift
like
Find Similar
6 options
NewVintage Stainless Steel Eagle Feather Open Ring For Men Retro Oxidized Adjustable Punk Gothic Finger Ring Biker Jewelry Gift
-5%
$3.48
No MOQ
Free Shipping
Minimalist S925 Sterling Silver Adjustable Open Ring For Women Hammered Texture Cross Design Finger Jewelry Fashion Gift
Minimalist S925 Sterling Silver Adjustable Open Ring For Women Hammered Texture Cross Design Finger Jewelry Fashion Gift
like
Find Similar
Minimalist S925 sterling silver open ring featuring organic hammered branch texture - Size 13 (Adjustable Open) / Silver
Minimalist S925 Sterling Silver Adjustable Open Ring For Women Hammered Texture Cross Design Finger Jewelry Fashion Gift
-16%
$20.47
No MOQ
Free Shipping
925 Sterling Silver Open Ring For Women Minimalist Geometric Line Adjustable Finger Ring With Zirconia Pavé Setting Fashion Jewelry
925 Sterling Silver Open Ring For Women Minimalist Geometric Line Adjustable Finger Ring With Zirconia Pavé Setting Fashion Jewelry
like
Find Similar
Minimalist S925 sterling silver open ring featuring a sparkling cubic zirconia row - Adjustable Open / Silver
New925 Sterling Silver Open Ring For Women Minimalist Geometric Line Adjustable Finger Ring With Zirconia Pavé Setting Fashion Jewelry
-4%
$10.73
No MOQ
Free Shipping
Vintage Stainless Steel Number 13 Ring For Men Punk Hip Hop Wide Band Signet Ring Biker Jewelry Gold Black Silver Tone
Vintage Stainless Steel Number 13 Ring For Men Punk Hip Hop Wide Band Signet Ring Biker Jewelry Gold Black Silver Tone
like
Find Similar
Polished gold square signet ring with embossed number 13 for men, 45-degree angle view - US 7 / Gold
Matte black titanium steel ring for men featuring an engraved number 13 on wide band - US 7 / Black
Men's punk style stainless steel ring with embossed number 13 on a silver metal band - US 7 / Steel
+21
Vintage Stainless Steel Number 13 Ring For Men Punk Hip Hop Wide Band Signet Ring Biker Jewelry Gold Black Silver Tone
-4%
$2.74-2.99
No MOQ
Free Shipping
Vintage Men Titanium Steel Skull Ring Punk Gothic Retro Biker Band Rings For Men Gold Silver Color Jewelry Gift
Vintage Men Titanium Steel Skull Ring Punk Gothic Retro Biker Band Rings For Men Gold Silver Color Jewelry Gift
like
Find Similar
Retro gothic skull ring for men made of high-quality stainless steel in vintage silver finish - US 7 / Steel
Retro punk style gold skull band ring for men made of durable stainless steel - US 7 / Gold
+12
Vintage Men Titanium Steel Skull Ring Punk Gothic Retro Biker Band Rings For Men Gold Silver Color Jewelry Gift
$3.41-3.93
No MOQ
Free Shipping
Elegant Bowknot Open Ring Copper Plated Cubic Zirconia Adjustable Finger Ring Fashionable Minimalist Jewelry For Women Gift
Elegant Bowknot Open Ring Copper Plated Cubic Zirconia Adjustable Finger Ring Fashionable Minimalist Jewelry For Women Gift
like
Find Similar
Sparkling S925 sterling silver bow ring with crystals in a 45-degree angle view - Adjustable Open / Silver
Elegant gold bow open ring for women featuring sparkling zircon and an adjustable band - Adjustable Open / Gold
Elegant Bowknot Open Ring Copper Plated Cubic Zirconia Adjustable Finger Ring Fashionable Minimalist Jewelry For Women Gift
-5%
$1.29
No MOQ
Free Shipping
Vintage Gothic Skull Ring For Men Titanium Steel Gold Plated Rectangular Rhinestone Punk Rock Fashion Statement Jewelry
Vintage Gothic Skull Ring For Men Titanium Steel Gold Plated Rectangular Rhinestone Punk Rock Fashion Statement Jewelry
like
Find Similar
Vintage gold skull ring for men featuring a large rectangular blue gemstone center - US 7 / Gold Blue Stone
Vintage gold men's titanium ring with large red ruby gemstone and skull carvings - US 7 / Gold Red Stone
Gothic men's titanium ring with green gemstone and skull carvings in gold finish - US 7 / Gold Green Stone
+25
Vintage Gothic Skull Ring For Men Titanium Steel Gold Plated Rectangular Rhinestone Punk Rock Fashion Statement Jewelry
-5%
$3.43
No MOQ
Free Shipping
Go to

More in jewelry

Lab-Created Gemstone Jewelry

Explore more in toe rings

openfoot jewelryfingersimplewhiteplasticinlaiddesignbodyplated stainless steel
footgold platedlayerartificialpolishedgirlsgold plated adjustableturquoise18k gold platedcolor ring

Ready to source like an insider

Get a direct line to the factory floor — no minimums, no middlemen, no guesswork.
iconReal factory pricing, no markup in betweeniconEvery order hand-inspected before it shipsicon5,000+ new products added daily
Get Inside Access