Everful

Wholesale toe rings

Factory-direct selection, vetted for quality and ready to order.

Sign Up
Toe Rings

Find the perfect pieces: stainless steel rings, copper rings, alloy rings and more

All products in toe rings

filterShow Filters
Price Drop
Free Shipping
Best Seller
New Arrivals
Vintage Stainless Steel Relief Dragon Ring For Men Punk Mythical Beast Embossed Band Ring Retro Fashion Jewelry Accessories
Vintage Stainless Steel Relief Dragon Ring For Men Punk Mythical Beast Embossed Band Ring Retro Fashion Jewelry Accessories
like
Find Similar
Vintage stainless steel ring with dragon totem and traditional cloud pattern details - US 7 / Steel
Retro men's gold stainless steel ring featuring embossed dragon and cloud patterns - US 7 / Gold
Men's black stainless steel ring with mythical beast relief carving on white background - US 7 / Black
+18
Vintage Stainless Steel Relief Dragon Ring For Men Punk Mythical Beast Embossed Band Ring Retro Fashion Jewelry Accessories
-5%
$2.46-2.71
No MOQ
 · 
12 views
Free Shipping
Vintage Stainless Steel Freemasonry Ring For Men Master Mason Signet Ring G Symbol Polished Punk Jewelry Gold Silver Two-Tone
Vintage Stainless Steel Freemasonry Ring For Men Master Mason Signet Ring G Symbol Polished Punk Jewelry Gold Silver Two-Tone
like
Find Similar
Detail of Freemason ring with gold-tone square and compass relief on silver band - US 7 / Two-tone (Gold & Silver)
Vintage stainless steel Freemasonry signet ring with compass G logo and engraved text - US 7 / Steel
Gold stainless steel Master Mason ring with black enamel and Freemasonry square logo - US 7 / All Gold
+21
Vintage Stainless Steel Freemasonry Ring For Men Master Mason Signet Ring G Symbol Polished Punk Jewelry Gold Silver Two-Tone
-4%
$2.87-3.12
No MOQ
 · 
11 sold recently
Free Shipping
Black Alloy Finger Rings Hollow Out Heart Butterfly Punk Gothic Hip Hop Retro Electroplated For Women And Men
Black Alloy Finger Rings Hollow Out Heart Butterfly Punk Gothic Hip Hop Retro Electroplated For Women And Men
like
Find Similar
11-piece gothic black heart butterfly ring set for women in minimalist punk style - 11-Piece Black Set
Black Alloy Finger Rings Hollow Out Heart Butterfly Punk Gothic Hip Hop Retro Electroplated For Women And Men
-4%
$0.69
No MOQ
 · 
21 sold recently
Round Signet Ring Flat Surface Polished Titanium Steel Minimalist Fashion Jewelry For Men Women
Round Signet Ring Flat Surface Polished Titanium Steel Minimalist Fashion Jewelry For Men Women
like
Find Similar
Macro view of a 10mm polished round signet ring with a minimalist smooth silver finish - US 6 / Silver
Macro view of a 10mm minimalist black stainless steel signet ring on white geometry - US 6 / Black
Macro shot of 10mm polished golden stainless steel signet ring with smooth mirror finish - US 6 / Gold
+21
Round Signet Ring Flat Surface Polished Titanium Steel Minimalist Fashion Jewelry For Men Women
$1.21-1.41
No MOQ
 · 
59 sold recently
Free Shipping
Vintage Copper Sunflower Cat's Eye Open Ring Gold Silver Plated Sunburst Adjustable Finger Ring Bohemian Jewelry For Women
Vintage Copper Sunflower Cat's Eye Open Ring Gold Silver Plated Sunburst Adjustable Finger Ring Bohemian Jewelry For Women
like
Find Similar
Vintage gold sunflower ring with blue opal stone and adjustable open band design - Adjustable Open / Gold
Vintage Copper Sunflower Cat's Eye Open Ring Gold Silver Plated Sunburst Adjustable Finger Ring Bohemian Jewelry For Women
$0.47
No MOQ
 · 
15 sold recently
Free Shipping
18K Gold Plated Copper Bow Open Ring For Women Rhinestone Inlaid Adjustable Sparkling Butterfly Knot Fashion Finger Jewelry
18K Gold Plated Copper Bow Open Ring For Women Rhinestone Inlaid Adjustable Sparkling Butterfly Knot Fashion Finger Jewelry
like
Find Similar
Elegant gold-plated bow ring for women featuring sparkling cubic zirconia stones and open band - Mini Gold-14316
Elegant 18K gold-plated bow ring with champagne pavé zircon and adjustable open band - Champagne Gold-14303
Exquisite 18K gold plated bow open ring with shimmering pavé zircon stones for women - Clear Gold-14306
Minimalist 18K gold-plated bow ring with sparkling cubic zirconia and open design - Sparkling Gold-14312
+7
18K Gold Plated Copper Bow Open Ring For Women Rhinestone Inlaid Adjustable Sparkling Butterfly Knot Fashion Finger Jewelry
-5%
$1.39-2.12
No MOQ
 · 
34 sold recently
Free Shipping
Vintage Viking Thor Hammer Skull Ring For Men Titanium Steel Punk Hip Hop Ring Gothic Mjolnir Biker Jewelry Halloween Gift
Vintage Viking Thor Hammer Skull Ring For Men Titanium Steel Punk Hip Hop Ring Gothic Mjolnir Biker Jewelry Halloween Gift
like
Find Similar
Close-up of gothic Thor’s hammer ring with skull relief and Celtic scrollwork - US Size 9
Gothic punk titanium steel skull ring with Mjölnir design and vintage black finish - US Size 7
+4
Vintage Viking Thor Hammer Skull Ring For Men Titanium Steel Punk Hip Hop Ring Gothic Mjolnir Biker Jewelry Halloween Gift
-4%
$2.74
No MOQ
Free Shipping
Gothic Punk Antique Silver Plated Alloy Claw Evil Eye Open Ring For Men Women Adjustable Dragon Eye Finger Jewelry
Gothic Punk Antique Silver Plated Alloy Claw Evil Eye Open Ring For Men Women Adjustable Dragon Eye Finger Jewelry
like
Find Similar
Detailed close-up of a gothic claw ring holding a mystical purple evil eye stone - Purple Floc Style (8#)
Macro shot of a punk dragon claw ring holding an amber evil eye bead with fine details - Amber Yellow Style (5#)
Macro detail of gothic claw ring in antique silver with a striking red eye centerpiece - Red Black Eye Style (6#)
Macro detail of gothic claw ring featuring a blue evil eye stone and vintage silver finish - Dark Blue Style (7#)
+4
Gothic Punk Antique Silver Plated Alloy Claw Evil Eye Open Ring For Men Women Adjustable Dragon Eye Finger Jewelry
$0.89
No MOQ
Retro Stainless Steel Cross Ring Gothic Punk Relief Totem Band For Men Women Unisex Hip Hop Jewelry Silver Gold Tone
Retro Stainless Steel Cross Ring Gothic Punk Relief Totem Band For Men Women Unisex Hip Hop Jewelry Silver Gold Tone
like
Find Similar
Vintage gothic silver cross ring with engraved floral patterns on black reflection - US 7 / Silver
Retro hip hop silver ring with gold Jerusalem cross and vintage engraved side patterns - US 7 / Gold
+10
Retro Stainless Steel Cross Ring Gothic Punk Relief Totem Band For Men Women Unisex Hip Hop Jewelry Silver Gold Tone
$3.67-3.93
No MOQ
Free Shipping
Minimalist Twisted Rope Ring For Women Titanium Steel Fine Band Stackable Waterproof Plain Band Fashion Jewelry
Minimalist Twisted Rope Ring For Women Titanium Steel Fine Band Stackable Waterproof Plain Band Fashion Jewelry
like
Find Similar
Detailed view of a gold-toned twisted rope ring over a deep blue rippled water background - US 5 / Gold
Detailed macro shot of twisted silver stainless steel ring with elegant rope texture - US 5 / Silver
Detail of rose gold titanium steel twisted rope ring with delicate woven texture design - US 5 / Rose Gold
+15
Minimalist Twisted Rope Ring For Women Titanium Steel Fine Band Stackable Waterproof Plain Band Fashion Jewelry
$0.18-0.26
No MOQ
 · 
246 sold recently
Free Shipping
S925 Sterling Silver Wave Ring For Women Minimalist Zirconia Inlaid Commuter Geometric Finger Ring Fashion Delicate Jewelry
S925 Sterling Silver Wave Ring For Women Minimalist Zirconia Inlaid Commuter Geometric Finger Ring Fashion Delicate Jewelry
like
Find Similar
4 options
S925 Sterling Silver Wave Ring For Women Minimalist Zirconia Inlaid Commuter Geometric Finger Ring Fashion Delicate Jewelry
$10.43
No MOQ
Free Shipping
Vintage Stainless Steel Skull Ring For Men Punk Gothic Rock Biker Jewelry Antique Silver Finished Skeleton Finger Ring
Vintage Stainless Steel Skull Ring For Men Punk Gothic Rock Biker Jewelry Antique Silver Finished Skeleton Finger Ring
like
Find Similar
4 options
Vintage Stainless Steel Skull Ring For Men Punk Gothic Rock Biker Jewelry Antique Silver Finished Skeleton Finger Ring
$2.88
No MOQ
 · 
13 sold recently
Free Shipping
Vintage Men Ring Alloy Engraved Ethnic Ottoman Style With Rectangular Faux Gemstone Dual Tone Plated Jewelry
Vintage Men Ring Alloy Engraved Ethnic Ottoman Style With Rectangular Faux Gemstone Dual Tone Plated Jewelry
like
Find Similar
Vintage ethnic men's silver ring with rectangular red gemstone and floral engravings - US 12 / Red
Vintage boho ring with emerald cut green zircon and intricate gold floral engraving - US 10 / Green
Vintage ethnic men's ring with rectangle black gemstone and dual-tone engraved patterns - US 7 / Black
Macro detail of retro engraved ring featuring a blue gemstone and golden accents - US 7 / Blue
+26
Vintage Men Ring Alloy Engraved Ethnic Ottoman Style With Rectangular Faux Gemstone Dual Tone Plated Jewelry
-5%
$1.32
No MOQ
 · 
18 sold recently
Free Shipping
Vintage Titanium Steel Braided Ring For Men Oxidized Silver Wheat Pattern Striped Industrial Band Ring Gothic Jewelry
Vintage Titanium Steel Braided Ring For Men Oxidized Silver Wheat Pattern Striped Industrial Band Ring Gothic Jewelry
like
Find Similar
6 options
Vintage Titanium Steel Braided Ring For Men Oxidized Silver Wheat Pattern Striped Industrial Band Ring Gothic Jewelry
$3.09
No MOQ
Free Shipping
Minimalist Stainless Steel Adjustable Ring Geometric Twisted Rope Design DIY Stone Tray Ring Base For Women Men Jewelry
Minimalist Stainless Steel Adjustable Ring Geometric Twisted Rope Design DIY Stone Tray Ring Base For Women Men Jewelry
like
Find Similar
Detailed size specifications for triple setting stainless steel twisted open ring base - Silver
Detail view of rainbow plating 304 stainless steel ring with twisted texture and open band - Rainbow
Detailed view of adjustable gold-plated stainless steel ring base with three oval bezels - Gold
Minimalist Stainless Steel Adjustable Ring Geometric Twisted Rope Design DIY Stone Tray Ring Base For Women Men Jewelry
$0.52-0.78
Mix MOQ : 2
Free Shipping
Minimalist Interlocked Two Tone Stainless Steel Rings For Men Women Brushed Matte Finish Geometric Band Ring Fashion Jewelry
Minimalist Interlocked Two Tone Stainless Steel Rings For Men Women Brushed Matte Finish Geometric Band Ring Fashion Jewelry
like
Find Similar
Minimalist two-tone interlocking stainless steel ring with a brushed matte finish surface - US 6 / Silver+Gold
Detail of interlocking two-tone stainless steel rings with a brushed matte finish - US 6 / Silver & Black
Detailed view of two-tone interlocking rings with silver and blue brushed metal texture - US 6 / Silver & Blue
+21
Minimalist Interlocked Two Tone Stainless Steel Rings For Men Women Brushed Matte Finish Geometric Band Ring Fashion Jewelry
-5%
$0.75
No MOQ
Minimalist 304 Stainless Steel Hammered Rings Irregular Geometric Textured Adjustable Open Band Jewelry For Men Women
Minimalist 304 Stainless Steel Hammered Rings Irregular Geometric Textured Adjustable Open Band Jewelry For Men Women
like
Find Similar
Detail shot of 1.0cm wide hammered stainless steel ring with adjustable opening feature - Silver
Iridescent 304 stainless steel ring with 1.0cm width and textured geometric pattern - Rainbow
Detailed close-up showing 1.0cm width and hammered texture on golden stainless steel ring - Gold
Minimalist 304 Stainless Steel Hammered Rings Irregular Geometric Textured Adjustable Open Band Jewelry For Men Women
$0.52-0.78
Mix MOQ : 2
Free Shipping
Vintage Rose Ring Stainless Steel Zirconia Flower Jewelry Women Gothic Punk Style Antique Silver Retro Accessory
Vintage Rose Ring Stainless Steel Zirconia Flower Jewelry Women Gothic Punk Style Antique Silver Retro Accessory
like
Find Similar
Classic stainless steel rose ring with zircon center in vintage gothic style for women - US 6 / Antique Silver
+5
Vintage Rose Ring Stainless Steel Zirconia Flower Jewelry Women Gothic Punk Style Antique Silver Retro Accessory
$3.67
No MOQ
Free Shipping
Stainless Steel Skull Ring Vintage Punk Gothic Style Biker Band Jewelry For Men Retro Two Tone Gold Silver Finish Finger Ring
Stainless Steel Skull Ring Vintage Punk Gothic Style Biker Band Jewelry For Men Retro Two Tone Gold Silver Finish Finger Ring
like
Find Similar
Vintage gothic skull ring in stainless steel with punk style and engraved details - US 7 / Steel
Vintage punk skull ring in stainless steel with golden swastika emblem and oxidized finish - US 7 / Two-tone (Gold & Silver)
+12
Stainless Steel Skull Ring Vintage Punk Gothic Style Biker Band Jewelry For Men Retro Two Tone Gold Silver Finish Finger Ring
$3.41-3.93
No MOQ
Free Shipping
Vintage Gothic Titanium Steel Evil Eye Ring For Men Women Punk Feather Scale Dragon Eye Retro Finger Ring Jewelry Gift
Vintage Gothic Titanium Steel Evil Eye Ring For Men Women Punk Feather Scale Dragon Eye Retro Finger Ring Jewelry Gift
like
Find Similar
Gothic retro devil eye ring in silver finish with green gem and feather textures - US 8 / Green
Gothic dragon eye ring with feather texture and orange pupil stone on reflective surface - US 8 / Orange
+8
Vintage Gothic Titanium Steel Evil Eye Ring For Men Women Punk Feather Scale Dragon Eye Retro Finger Ring Jewelry Gift
$3.93
No MOQ
Free Shipping
Stainless Steel Rotatable Zodiac Roman Numerals Ring 18K Gold Plated Vintage Three In One Spinner Ring Jewelry For Men Women
Stainless Steel Rotatable Zodiac Roman Numerals Ring 18K Gold Plated Vintage Three In One Spinner Ring Jewelry For Men Women
like
Find Similar
3 options
Stainless Steel Rotatable Zodiac Roman Numerals Ring 18K Gold Plated Vintage Three In One Spinner Ring Jewelry For Men Women
$4.06
No MOQ
Free Shipping
Korean Style Natural Shell Beaded Rings Heart Flower Charms Elastic Handwoven Finger Rings For Women Jewelry Decoration
Korean Style Natural Shell Beaded Rings Heart Flower Charms Elastic Handwoven Finger Rings For Women Jewelry Decoration
like
Find Similar
Detailed view of heart shell beaded ring on champagne satin fabric for minimalist jewelry look - Heart Style
NewKorean Style Natural Shell Beaded Rings Heart Flower Charms Elastic Handwoven Finger Rings For Women Jewelry Decoration
-5%
$1.12
No MOQ
Free Shipping
Minimalist 18K Gold Plated Stainless Steel Open Ring For Women Geometric Double Line Adjustable Waterproof Fashion Jewelry Finger Ring
Minimalist 18K Gold Plated Stainless Steel Open Ring For Women Geometric Double Line Adjustable Waterproof Fashion Jewelry Finger Ring
like
Find Similar
Detail showing dimensions and 2.6g weight of the adjustable gold stainless steel ring - Adjustable Open / Gold (JDRW2408030)
Minimalist 18K Gold Plated Stainless Steel Open Ring For Women Geometric Double Line Adjustable Waterproof Fashion Jewelry Finger Ring
$2.49
No MOQ
Free Shipping
Vintage Crown Signet Ring For Men Stainless Steel 18K Gold Plated Relief Geometric Finger Ring Personality Jewelry Accessories
Vintage Crown Signet Ring For Men Stainless Steel 18K Gold Plated Relief Geometric Finger Ring Personality Jewelry Accessories
like
Find Similar
10 options
Vintage Crown Signet Ring For Men Stainless Steel 18K Gold Plated Relief Geometric Finger Ring Personality Jewelry Accessories
$2.88-3.41
No MOQ
Free Shipping
Minimalist Stainless Steel Wave Irregular Open Rings Adjustable Gold Silver Smooth Surface Rings For Women Modern Jewelry
Minimalist Stainless Steel Wave Irregular Open Rings Adjustable Gold Silver Smooth Surface Rings For Women Modern Jewelry
like
Find Similar
Minimalist adjustable gold stainless steel rings with fluid wave design and polished finish - Gold Wave Style (F753)
Polished silver stainless steel open rings with minimalist wavy S-line design - Silver Wave Style (F754)
Minimalist Stainless Steel Wave Irregular Open Rings Adjustable Gold Silver Smooth Surface Rings For Women Modern Jewelry
$1.05-1.30
Mix MOQ : 2
Free Shipping
Minimalist 925 Sterling Silver Chain Ring For Women Brushed Bead Pendant Soft Link Finger Ring Korean Style Jewelry
Minimalist 925 Sterling Silver Chain Ring For Women Brushed Bead Pendant Soft Link Finger Ring Korean Style Jewelry
like
Find Similar
S925 sterling silver chain ring featuring a brushed finish metallic bead on textured fabric - 12# / Silver Brushed Bead Chain Ring (JZC093)
Minimalist 925 Sterling Silver Chain Ring For Women Brushed Bead Pendant Soft Link Finger Ring Korean Style Jewelry
-11%
$10.20
No MOQ
Free Shipping
Vintage Stainless Steel All-Seeing Eye Ring For Men Eye Of Providence Pharaoh Pyramid Gothic Punk Band Retro Silver Jewelry
Vintage Stainless Steel All-Seeing Eye Ring For Men Eye Of Providence Pharaoh Pyramid Gothic Punk Band Retro Silver Jewelry
like
Find Similar
7 options
Vintage Stainless Steel All-Seeing Eye Ring For Men Eye Of Providence Pharaoh Pyramid Gothic Punk Band Retro Silver Jewelry
-4%
$3.19
No MOQ
Free Shipping
Stainless Steel Hollow Out Dome Ring For Women Geometric Honeycomb Mesh Wide Band Statement Ring Gold Silver Plated Jewelry
Stainless Steel Hollow Out Dome Ring For Women Geometric Honeycomb Mesh Wide Band Statement Ring Gold Silver Plated Jewelry
like
Find Similar
Exaggerated 18K gold hollow mesh spherical ring in polished stainless steel - Gold (JDR0106050-7)
Detailed size and weight specs of wide hollow stainless steel ring with sphere top - Silver (JDR0106050-S-7)
Stainless Steel Hollow Out Dome Ring For Women Geometric Honeycomb Mesh Wide Band Statement Ring Gold Silver Plated Jewelry
$4.58-5.11
No MOQ
Free Shipping
Vintage Dragon Head Ring Stainless Steel Punk Hip Hop Carved Wrap Ring For Men Women Gothic Jewelry With Red Black Eyes
Vintage Dragon Head Ring Stainless Steel Punk Hip Hop Carved Wrap Ring For Men Women Gothic Jewelry With Red Black Eyes
like
Find Similar
Retro stainless steel dragon wrap ring for men and women with detailed vintage scaling - US 7 / Black Eye
Retro dragon head ring in silver stainless steel with red gem eyes on black mirror surface - US 7 / Red Eye
+10
Vintage Dragon Head Ring Stainless Steel Punk Hip Hop Carved Wrap Ring For Men Women Gothic Jewelry With Red Black Eyes
$2.88-3.14
No MOQ
Free Shipping
Vintage Spider Ring Alloy Gothic Punk Adjustable Open Band With Pear Shape Simulated Opal Halloween Party Jewelry For Women Men
Vintage Spider Ring Alloy Gothic Punk Adjustable Open Band With Pear Shape Simulated Opal Halloween Party Jewelry For Women Men
like
Find Similar
Vintage black spider open ring with blue waterdrop opal stone in a top-down view - Matte Black
Gothic spider ring in oxidized silver finish with a pear-cut opal stone inlay - Antique Silver
Vintage Spider Ring Alloy Gothic Punk Adjustable Open Band With Pear Shape Simulated Opal Halloween Party Jewelry For Women Men
-4%
$0.45
No MOQ
 · 
76 sold recently
Free Shipping
Vintage Stainless Steel FK Letter Hollow Out Ring For Men Women Hip Hop Cool Wide Band Finger Jewelry Fashion Party Accessories
Vintage Stainless Steel FK Letter Hollow Out Ring For Men Women Hip Hop Cool Wide Band Finger Jewelry Fashion Party Accessories
like
Find Similar
Retro stainless steel men's ring with stylized hollow lettering and polished finish - US 7 / Steel
Detailed macro view of a chunky gold men's ring with polished crown hollow design - US 7 / Gold
+12
Vintage Stainless Steel FK Letter Hollow Out Ring For Men Women Hip Hop Cool Wide Band Finger Jewelry Fashion Party Accessories
$3.41-3.93
No MOQ
Free Shipping
Fashion Titanium Steel Greek Meander Ring For Unisex Hollow Great Wall Pattern Band Stainless Steel Ring Personalized Jewelry
Fashion Titanium Steel Greek Meander Ring For Unisex Hollow Great Wall Pattern Band Stainless Steel Ring Personalized Jewelry
like
Find Similar
Detailed macro shot of silver stainless steel wide band ring with Greek key cutout design - US 7 / Steel
Close-up of golden stainless steel ring featuring Greek Greca hollow pattern design - US 7 / Gold
+8
Fashion Titanium Steel Greek Meander Ring For Unisex Hollow Great Wall Pattern Band Stainless Steel Ring Personalized Jewelry
$0.42-0.47
No MOQ
 · 
12 views
Vintage Stainless Steel Hexagonal Ring For Men Black Enamel Inlay Geometric Polished Brushed Band Ring Fashion Jewelry Gift
Vintage Stainless Steel Hexagonal Ring For Men Black Enamel Inlay Geometric Polished Brushed Band Ring Fashion Jewelry Gift
like
Find Similar
6 options
Vintage Stainless Steel Hexagonal Ring For Men Black Enamel Inlay Geometric Polished Brushed Band Ring Fashion Jewelry Gift
$3.35
No MOQ
Free Shipping
Minimalist Irregular Wavy Open Ring Titanium Steel 18K Gold Plated Liquid Metal Style Adjustable Finger Ring For Women Fashion Jewelry
Minimalist Irregular Wavy Open Ring Titanium Steel 18K Gold Plated Liquid Metal Style Adjustable Finger Ring For Women Fashion Jewelry
like
Find Similar
Minimalist silver irregular wave open ring in polished titanium steel on model's finger - US 7 / Steel
Irregular wave open ring for women in 18k gold plating on a model's finger - US 7 / Gold
Minimalist Irregular Wavy Open Ring Titanium Steel 18K Gold Plated Liquid Metal Style Adjustable Finger Ring For Women Fashion Jewelry
-5%
$3.36
No MOQ
Free Shipping
Minimalist 925 Sterling Silver Zirconia Ring For Women 18K Gold Plated Stackable Solitaire Band Elegant Jewelry Gift
Minimalist 925 Sterling Silver Zirconia Ring For Women 18K Gold Plated Stackable Solitaire Band Elegant Jewelry Gift
like
Find Similar
Elegant gold S925 sterling silver ring set with minimalist cubic zirconia stones - US 7 / Gold
Minimalist 925 Sterling Silver Zirconia Ring For Women 18K Gold Plated Stackable Solitaire Band Elegant Jewelry Gift
-12%
$10.74
No MOQ
Free Shipping
Vintage Stainless Steel Men Ring Retro Hip Hop Sun Starburst Totem Band Ring Polished Distressed Punk Finger Jewelry
Vintage Stainless Steel Men Ring Retro Hip Hop Sun Starburst Totem Band Ring Polished Distressed Punk Finger Jewelry
like
Find Similar
Vintage stainless steel ring with sunburst and Nordic weave patterns in silver - US 7 / Steel
+5
Vintage Stainless Steel Men Ring Retro Hip Hop Sun Starburst Totem Band Ring Polished Distressed Punk Finger Jewelry
$3.14
No MOQ
Free Shipping
Vintage Titanium Steel Eagle Signet Ring Black Zirconia Micro Pave Square Gold Plated Hip Hop Punk Jewelry For Men Women
Vintage Titanium Steel Eagle Signet Ring Black Zirconia Micro Pave Square Gold Plated Hip Hop Punk Jewelry For Men Women
like
Find Similar
Men's titanium steel square ring with black gemstones and golden eagle relief on black mirror - Number 8 / Black Gold
+4
Vintage Titanium Steel Eagle Signet Ring Black Zirconia Micro Pave Square Gold Plated Hip Hop Punk Jewelry For Men Women
$3.67
No MOQ
Free Shipping
Vintage Stainless Steel Number 13 Ring For Men Punk Hip Hop Wide Band Signet Ring Biker Jewelry Gold Black Silver Tone
Vintage Stainless Steel Number 13 Ring For Men Punk Hip Hop Wide Band Signet Ring Biker Jewelry Gold Black Silver Tone
like
Find Similar
Polished gold square signet ring with embossed number 13 for men, 45-degree angle view - US 7 / Gold
Matte black titanium steel ring for men featuring an engraved number 13 on wide band - US 7 / Black
Men's punk style stainless steel ring with embossed number 13 on a silver metal band - US 7 / Steel
+21
Vintage Stainless Steel Number 13 Ring For Men Punk Hip Hop Wide Band Signet Ring Biker Jewelry Gold Black Silver Tone
-4%
$2.74-2.99
No MOQ
Free Shipping
Minimalist Stainless Steel Irregular Lava Ring For Women 18K Gold Plated Organic Shaped Statement Wave Ring Fashion Jewelry Gift
Minimalist Stainless Steel Irregular Lava Ring For Women 18K Gold Plated Organic Shaped Statement Wave Ring Fashion Jewelry Gift
like
Find Similar
Irregular chunky 18k gold plated stainless steel ring with a wide streamlined design - US 6 / Gold
Polished silver stainless steel ring with wavy design, waterproof, size 6/7/8 - US 6 / Silver
+4
Minimalist Stainless Steel Irregular Lava Ring For Women 18K Gold Plated Organic Shaped Statement Wave Ring Fashion Jewelry Gift
$3.80-4.19
No MOQ
Free Shipping
Vintage Stainless Steel 18K Gold Plated Locket Ring Openable Square Photo Box Ring Adjustable Rhinestone Star Clover Horseshoe Fortune Ring For Women Jewelry
Vintage Stainless Steel 18K Gold Plated Locket Ring Openable Square Photo Box Ring Adjustable Rhinestone Star Clover Horseshoe Fortune Ring For Women Jewelry
like
Find Similar
Detail of 18K gold stainless steel ring featuring a star pattern and sparkling stones - Star Moon Pattern (JDR0108015)
Detailed view of square 18K gold stainless steel ring with starburst pattern and zircon accents - Starburst Pattern (JDR0108016)
Detailed view of square gold stainless steel locket ring with green clover gemstones - Clover Pattern (JDR0308005)
Detail of waterproof stainless steel ring with horseshoe design and Fortune engraving - Horseshoe FORTUNE Pattern (JDR0308006)
Vintage Stainless Steel 18K Gold Plated Locket Ring Openable Square Photo Box Ring Adjustable Rhinestone Star Clover Horseshoe Fortune Ring For Women Jewelry
$6.16
No MOQ
 · 
76 views
Free Shipping
Vintage Hammered Texture Titanium Steel Ring For Men Women Natural Wood Inlay Inner Ring Retro Fashion Jewelry Band Ring Gift
Vintage Hammered Texture Titanium Steel Ring For Men Women Natural Wood Inlay Inner Ring Retro Fashion Jewelry Band Ring Gift
like
Find Similar
Macro shot of 8mm gold titanium ring with hammered honeycomb texture and wood inlay - US 6 / Gold
Detail of 8mm hammered honeycomb steel ring with natural wood inlay finish - US 6 / Silver
8mm black titanium ring with hammered texture and natural pear wood inlay for men - US 6 / Black
+21
Vintage Hammered Texture Titanium Steel Ring For Men Women Natural Wood Inlay Inner Ring Retro Fashion Jewelry Band Ring Gift
$4.45
No MOQ
Free Shipping
Vintage Virgin Mary Relief Signet Ring Stainless Steel Gold Plated Religious Oval Medallion Ring For Women Men Hip Hop
Vintage Virgin Mary Relief Signet Ring Stainless Steel Gold Plated Religious Oval Medallion Ring For Women Men Hip Hop
like
Find Similar
Golden Virgin Mary oval ring with religious embossing on a white display stand - US 8 / Gold
+4
Vintage Virgin Mary Relief Signet Ring Stainless Steel Gold Plated Religious Oval Medallion Ring For Women Men Hip Hop
$4.19
No MOQ
Free Shipping
Hip Hop Men Gold Plated Titanium Steel Egyptian Pharaoh Tutankhamun Mask Ring Vintage Retro Punk Biker Band Finger Jewelry
Hip Hop Men Gold Plated Titanium Steel Egyptian Pharaoh Tutankhamun Mask Ring Vintage Retro Punk Biker Band Finger Jewelry
like
Find Similar
Gold plated titanium steel ring featuring an Egyptian Pharaoh Tutankhamun mask relief - US 8 / Gold
+6
Hip Hop Men Gold Plated Titanium Steel Egyptian Pharaoh Tutankhamun Mask Ring Vintage Retro Punk Biker Band Finger Jewelry
$3.01
No MOQ
Free Shipping
Vintage 304 Stainless Steel Adjustable Ring Geometric Round Enamel Oil Texture Band Finger Ring For Women Elegant Jewelry Gift
Vintage 304 Stainless Steel Adjustable Ring Geometric Round Enamel Oil Texture Band Finger Ring For Women Elegant Jewelry Gift
like
Find Similar
Detail view of oval black enamel ring with bead edge on a soft beige silk fabric - Silver Band Black Dial
Detailed view of golden textured ring with marble enamel and dimension marks - Gold Color White
Detail of 304 stainless steel ring with black enamel inlay and rope texture band - Gold Color Black
Vintage 304 Stainless Steel Adjustable Ring Geometric Round Enamel Oil Texture Band Finger Ring For Women Elegant Jewelry Gift
$0.78-1.05
Mix MOQ : 2
Free Shipping
Vintage Stainless Steel Handshake Ring For Women Men Artistic Hand Open Adjustable Ring Distressed Fashion Finger Jewelry
Vintage Stainless Steel Handshake Ring For Women Men Artistic Hand Open Adjustable Ring Distressed Fashion Finger Jewelry
like
Find Similar
Artistic vintage silver-tone handshake open ring with detailed hand-carved design - US 7 / Steel
Retro gold handshake ring with realistic hand design and textured metal finish - US 7 / Gold
+10
Vintage Stainless Steel Handshake Ring For Women Men Artistic Hand Open Adjustable Ring Distressed Fashion Finger Jewelry
$3.41-3.93
No MOQ
Free Shipping
Luxury Stainless Steel Heart Resin Ring Boxed Multicolor Glitter Inlaid Jewelry Fashion Rings For Women Party Accessories
Luxury Stainless Steel Heart Resin Ring Boxed Multicolor Glitter Inlaid Jewelry Fashion Rings For Women Party Accessories
like
Find Similar
36-piece colorful heart resin gold rings set neatly displayed in a white jewelry gift box - 17-20 / Multicolor
Luxury Stainless Steel Heart Resin Ring Boxed Multicolor Glitter Inlaid Jewelry Fashion Rings For Women Party Accessories
$17.03
No MOQ
Men Retro Punk Titanium Steel Ring With Rectangle Iridescent Rhinestone Polished Gothic Biker Finger Ring Jewelry Gift
Men Retro Punk Titanium Steel Ring With Rectangle Iridescent Rhinestone Polished Gothic Biker Finger Ring Jewelry Gift
like
Find Similar
Vintage punk silver ring for men with a large rectangular colorful gem and zircons - US 7 / Vintage Steel Silver
+6
Men Retro Punk Titanium Steel Ring With Rectangle Iridescent Rhinestone Polished Gothic Biker Finger Ring Jewelry Gift
$3.93
No MOQ
Free Shipping
18K Gold Plated Stainless Steel Open Ring For Women Minimalist Bow Flower Adjustable Index Finger Ring Premium Fashion Jewelry Gift
18K Gold Plated Stainless Steel Open Ring For Women Minimalist Bow Flower Adjustable Index Finger Ring Premium Fashion Jewelry Gift
like
Find Similar
Adjustable 18k gold plated stainless steel floral ring with a central white pearl - Gold Floral Pearl Style (TR4297)
Elegant 18k gold plated stainless steel open ring with 15mm flower design, weight 2.9g - Gold Small Flower Style (TR4298)
Elegant 18k gold plated stainless steel bowknot open ring with 22mm flower design detail - Gold Bow Style (TR4300)
Polished 18k gold butterfly bow open ring made of durable titanium steel, 25mm size - Gold Large Bow Style (TR4303)
18K Gold Plated Stainless Steel Open Ring For Women Minimalist Bow Flower Adjustable Index Finger Ring Premium Fashion Jewelry Gift
$1.83-2.39
No MOQ
Free Shipping
Vintage Gothic Skull Ring For Men Stainless Steel Punk Rock Biker Band Ring Carved Skeleton Heavy Metal Jewelry Gift
Vintage Gothic Skull Ring For Men Stainless Steel Punk Rock Biker Band Ring Carved Skeleton Heavy Metal Jewelry Gift
like
Find Similar
6 options
Vintage Gothic Skull Ring For Men Stainless Steel Punk Rock Biker Band Ring Carved Skeleton Heavy Metal Jewelry Gift
$2.62
No MOQ
Free Shipping
Vintage Men Stainless Steel Celtic Knot Signet Ring Black Enamel Inlay Punk Gothic Industrial Style Ring Jewelry For Him
Vintage Men Stainless Steel Celtic Knot Signet Ring Black Enamel Inlay Punk Gothic Industrial Style Ring Jewelry For Him
like
Find Similar
Retro men's stainless steel signet ring with black enamel inlay and engraved details - US 7 / Steel
+6
Vintage Men Stainless Steel Celtic Knot Signet Ring Black Enamel Inlay Punk Gothic Industrial Style Ring Jewelry For Him
-5%
$3.61
No MOQ
Free Shipping
S999 Fine Silver Starry Ring For Women Minimalist Sandblasted Stackable Finger Ring Gold Silver Stardust Texture Jewelry Gift
S999 Fine Silver Starry Ring For Women Minimalist Sandblasted Stackable Finger Ring Gold Silver Stardust Texture Jewelry Gift
like
Find Similar
Minimalist S925 sterling silver ring with sparkling sandblasted finish and inner S925 hallmark - US Size 5.5 / Nail Sand Frosted Silver
Minimalist S925 sterling silver gold plated ring with a sparkling sandblasted finish - US Size 5.5 / Nail Sand Frosted Gold
Minimalist S999 sterling silver ring featuring a high-end matte sandblasted texture - US Size 5.5 / Sandblasted Silver
Minimalist S999 gold ring with a matte sandblasted finish and internal hallmark - US Size 5.5 / Sandblasted Gold
+28
S999 Fine Silver Starry Ring For Women Minimalist Sandblasted Stackable Finger Ring Gold Silver Stardust Texture Jewelry Gift
$17.99-18.64
No MOQ
Free Shipping
Retro Titanium Steel Hexagram Star Ring For Men Vintage Baroque Carved Symbol Hip Hop Punk Finger Ring Religious Jewelry
Retro Titanium Steel Hexagram Star Ring For Men Vintage Baroque Carved Symbol Hip Hop Punk Finger Ring Religious Jewelry
like
Find Similar
Vintage silver titanium steel hexagram signet ring with baroque engraved detailing - US 7 / Silver
Vintage titanium steel ring for men featuring a gold hexagram and intricate side textures - US 7 / Gold
+10
Retro Titanium Steel Hexagram Star Ring For Men Vintage Baroque Carved Symbol Hip Hop Punk Finger Ring Religious Jewelry
$3.67-3.93
No MOQ
Free Shipping
Vintage Dragon Head Titanium Steel Ring For Men Gothic Punk Hip Hop Ring With Red Black Rhinestone Inlaid Masculine Jewelry
Vintage Dragon Head Titanium Steel Ring For Men Gothic Punk Hip Hop Ring With Red Black Rhinestone Inlaid Masculine Jewelry
like
Find Similar
Retro dragon head ring in titanium steel featuring a large red crystal gemstone - US 7 / Steel Red Zircon
Vintage dragon head stainless steel ring for men featuring a black gemstone and scales - US 7 / Steel Color Black Zircon
+12
Vintage Dragon Head Titanium Steel Ring For Men Gothic Punk Hip Hop Ring With Red Black Rhinestone Inlaid Masculine Jewelry
-4%
$5.03
Mix MOQ : 3
Free Shipping
18K Gold Plated Stainless Steel Open Ring For Women Waterproof Fashion Jewelry Adjustable Hollow Leaf Heart Finger Ring
18K Gold Plated Stainless Steel Open Ring For Women Waterproof Fashion Jewelry Adjustable Hollow Leaf Heart Finger Ring
like
Find Similar
Golden crown hollow stainless steel adjustable ring with dimensions and 3.3g weight detail - Hollow Dot Crown Style (JZ21084)
Adjustable 18k gold plated stainless steel heart ring with hammered texture finish - Hammered Heart Open Style (JZ21087)
Elegant 18K gold leaf style adjustable stainless steel ring in a polished finish - Hollow Leaf Open Style (JZ21088)
18K Gold Plated Stainless Steel Open Ring For Women Waterproof Fashion Jewelry Adjustable Hollow Leaf Heart Finger Ring
$1.70-2.15
No MOQ
Free Shipping
Minimalist Stainless Steel Rings For Men Brushed Polished Grooved Band Rings Fashion Jewelry Gift For Daily Wear Party
Minimalist Stainless Steel Rings For Men Brushed Polished Grooved Band Rings Fashion Jewelry Gift For Daily Wear Party
like
Find Similar
Men's titanium ring in brushed black finish with a sleek gold-tone center inlay - US 7 / Black Gold Style (JWR1535-BKGO)
Modern two-tone titanium steel ring with brushed silver exterior and gold polished inner band - US 7 / Gold Silver Two Tone (JWR1535-GOSI)
Men's titanium ring with black brushed surface and blue mirror-polished inner band - US 7 / Black Blue Two Tone (JWR1535-BKBU)
Men's titanium steel ring featuring silver brushed finish and black center groove - US 7 / Silver Black Groove Style (JWR1535-ZJH)
+92
Minimalist Stainless Steel Rings For Men Brushed Polished Grooved Band Rings Fashion Jewelry Gift For Daily Wear Party
-5%
$0.23-4.03
No MOQ
Free Shipping
Men Titanium Steel USA Russia National Emblem Signet Ring Stainless Steel Punk Biker Band Ring Fashion Jewelry For Men
Men Titanium Steel USA Russia National Emblem Signet Ring Stainless Steel Punk Biker Band Ring Fashion Jewelry For Men
like
Find Similar
30 options
NewMen Titanium Steel USA Russia National Emblem Signet Ring Stainless Steel Punk Biker Band Ring Fashion Jewelry For Men
$2.83-3.09
No MOQ
Free Shipping
Minimalist Geometric Metal Ball Open Ring For Women 14K Gold Plated Copper Adjustable Spiral Finger Ring Personality Fashion Jewelry
Minimalist Geometric Metal Ball Open Ring For Women 14K Gold Plated Copper Adjustable Spiral Finger Ring Personality Fashion Jewelry
like
Find Similar
Minimalist gold spiral open ring featuring a geometric metallic bead and polished finish - Adjustable Open / Minimalist Bead Style (JZ0103-单颗铜珠)
Detailed macro view of a gold double-band ring featuring three polished geometric spheres - Adjustable Open / Multi-Bead Spiral Style (JZ0103-三颗铜珠)
Minimalist Geometric Metal Ball Open Ring For Women 14K Gold Plated Copper Adjustable Spiral Finger Ring Personality Fashion Jewelry
$1.78-2.04
No MOQ
Free Shipping
Vintage Chinese Dragon Stainless Steel Ring For Men Retro Distressed Gothic Punk Dragon Head Animal Motif Men Band Ring Jewelry
Vintage Chinese Dragon Stainless Steel Ring For Men Retro Distressed Gothic Punk Dragon Head Animal Motif Men Band Ring Jewelry
like
Find Similar
Vintage oxidized silver dragon and leaf wrap ring in retro punk style for men - US 7 / Steel
Retro golden dragon head ring in stainless steel with detailed scales and carved textures - US 7 / Gold
+10
Vintage Chinese Dragon Stainless Steel Ring For Men Retro Distressed Gothic Punk Dragon Head Animal Motif Men Band Ring Jewelry
$3.41-3.67
No MOQ
Free Shipping
Minimalist Stainless Steel Open Ring For Women Men Geometric Spiral Rope Texture Adjustable Vintage Fashion Jewelry Finger Ring
Minimalist Stainless Steel Open Ring For Women Men Geometric Spiral Rope Texture Adjustable Vintage Fashion Jewelry Finger Ring
like
Find Similar
Detail view of adjustable stainless steel spiral rope ring with dimension labels - Silver
Detailed dimension guide for the gold braided open ring with size measurements in cm and inches - Gold
Detail of colorful iridescent stainless steel ring showing spiral texture and 1.1cm width - Colorful
Minimalist Stainless Steel Open Ring For Women Men Geometric Spiral Rope Texture Adjustable Vintage Fashion Jewelry Finger Ring
$0.52-0.78
No MOQ
Free Shipping
Vintage Hollow Heart Open Ring Stainless Steel Geometric Adjustable Heart Finger Ring For Women Light Luxury Party Jewelry
Vintage Hollow Heart Open Ring Stainless Steel Geometric Adjustable Heart Finger Ring For Women Light Luxury Party Jewelry
like
Find Similar
1 option
Vintage Hollow Heart Open Ring Stainless Steel Geometric Adjustable Heart Finger Ring For Women Light Luxury Party Jewelry
$1.57
Mix MOQ : 2
Free Shipping
Go to

More in jewelry

Lab-Created Gemstone Jewelry

Explore more in toe rings

openfoot jewelryfingersimplewhiteplasticinlaiddesignbodyplated stainless steel
footgold platedsteelartificialpolishedgirlsgold plated adjustableturquoise18k gold platedcolor ring

Ready to source like an insider

Get a direct line to the factory floor — no minimums, no middlemen, no guesswork.
iconReal factory pricing, no markup in betweeniconEvery order hand-inspected before it shipsicon5,000+ new products added daily
Get Inside Access