Everful

Wholesale toe rings

Factory-direct selection, vetted for quality and ready to order.

Sign Up
Toe Rings

Find the perfect pieces: stainless steel rings, copper rings, alloy rings and more

All products in toe rings

filterShow Filters
Price Drop
Free Shipping
Best Seller
New Arrivals
Vintage Stainless Steel Flame Pattern Ring For Men Two Tone Textured Punk Hip Hop Band Jewelry Finger Accessory Gift
Vintage Stainless Steel Flame Pattern Ring For Men Two Tone Textured Punk Hip Hop Band Jewelry Finger Accessory Gift
like
Find Similar
Men's hip hop style stainless steel ring with gold relief and silver brushed finish - US 7 / Gold
Men's titanium steel ring with matte silver finish and black flame patterns - US 7 / Black
+10
Vintage Stainless Steel Flame Pattern Ring For Men Two Tone Textured Punk Hip Hop Band Jewelry Finger Accessory Gift
-7%
$2.65
No MOQ
Free Shipping
Men Square Blue Gemstone Alloy Ring Gold And Silver Design With Rhinestone Domineering Punk Fashion Finger Jewelry
Men Square Blue Gemstone Alloy Ring Gold And Silver Design With Rhinestone Domineering Punk Fashion Finger Jewelry
like
Find Similar
Two-tone silver and gold sapphire ring for men with side accent diamonds - US 10 / Gold and Silver Two-tone
+5
Men Square Blue Gemstone Alloy Ring Gold And Silver Design With Rhinestone Domineering Punk Fashion Finger Jewelry
$1.26
No MOQ
 · 
17 sold recently
Free Shipping
Luxury Men Hexagon Hip Hop Ring Stainless Steel Gold Plated Iced Out Full Rhinestone Pave Band Ring Personalized Jewelry
Luxury Men Hexagon Hip Hop Ring Stainless Steel Gold Plated Iced Out Full Rhinestone Pave Band Ring Personalized Jewelry
like
Find Similar
Luxurious silver stainless steel signet ring with micro-pave hexagon cubic zirconia stones - Size 7 / Steel
Men's hip-hop gold plated ring featuring a square head fully paved with round zircons - Size 7 / Gold
+12
Luxury Men Hexagon Hip Hop Ring Stainless Steel Gold Plated Iced Out Full Rhinestone Pave Band Ring Personalized Jewelry
$4.19-4.72
No MOQ
Free Shipping
Minimalist Titanium Steel Beaded Stackable Ring For Women Simple Round Bead Texture Geometric Finger Jewelry Midi Ring
Minimalist Titanium Steel Beaded Stackable Ring For Women Simple Round Bead Texture Geometric Finger Jewelry Midi Ring
like
Find Similar
5 options
Minimalist Titanium Steel Beaded Stackable Ring For Women Simple Round Bead Texture Geometric Finger Jewelry Midi Ring
-5%
$2.24
No MOQ
Free Shipping
12Pcs Vintage Bohemian Alloy Ring Set For Women Gold Silver Rhinestone Eye Heart Butterfly Leaf Star Moon Open Rings Jewelry
12Pcs Vintage Bohemian Alloy Ring Set For Women Gold Silver Rhinestone Eye Heart Butterfly Leaf Star Moon Open Rings Jewelry
like
Find Similar
Close-up of golden lip-shaped ring and pearl-cluster band on hand with floral nail art - Lips Artificial Pearl Gold 3pcs Set (26614-gold)
11-piece gold ring set featuring moon, eye, and leaf motifs worn on hands with white nails - Star Moon Eye Gold 11pcs Set (22816-gold)
Close-up of gold ring set with minimalist geometric patterns and pearl accents - Butterfly Artificial Pearl Gold Set (24412-gold)
Golden metal ring set featuring stars butterflies and geometry on a plush background - Heart Bowknot Gold 11pcs Set (25313-gold)
+7
12Pcs Vintage Bohemian Alloy Ring Set For Women Gold Silver Rhinestone Eye Heart Butterfly Leaf Star Moon Open Rings Jewelry
$0.65-1.23
Mix MOQ : 2
 · 
32 views
Retro Stainless Steel Spinner Ring Six Word Mantra Engraved Buddhist Meditation Rotatable Relief Jewelry For Men Women
Retro Stainless Steel Spinner Ring Six Word Mantra Engraved Buddhist Meditation Rotatable Relief Jewelry For Men Women
like
Find Similar
Rotating stainless steel spinner ring with engraved Sanskrit mantra and vintage patterns - US 7 / Steel
Rotating stainless steel spinner ring with gold Greek key borders and Sanskrit mantra - US 7 / Two-tone (Gold & Silver)
+12
Retro Stainless Steel Spinner Ring Six Word Mantra Engraved Buddhist Meditation Rotatable Relief Jewelry For Men Women
$3.37-3.72
No MOQ
Free Shipping
Minimalist Stainless Steel Pear Cut Rhinestone Wave Ring For Women Elegant Gold Plated Geometric Finger Ring Fashion Jewelry
Minimalist Stainless Steel Pear Cut Rhinestone Wave Ring For Women Elegant Gold Plated Geometric Finger Ring Fashion Jewelry
like
Find Similar
Detailed view of pear-cut zircon gold ring with size and weight specifications - US 5 / White Rhinestone
Detail of gold teardrop ring showing 0.66cm green pear-cut zircon and 1g weight - US 5 / Green Zirconia
Detail view of 1g gold ring featuring a 0.66cm pear-cut blue zircon and dimensions - US 5 / Blue Rhinestone
+12
Minimalist Stainless Steel Pear Cut Rhinestone Wave Ring For Women Elegant Gold Plated Geometric Finger Ring Fashion Jewelry
$1.68
No MOQ
Free Shipping
Vintage Titanium Steel Ring For Men Industrial Bullet Base Design Black Rhinestone Inlaid Floral Relief Punk Jewelry
Vintage Titanium Steel Ring For Men Industrial Bullet Base Design Black Rhinestone Inlaid Floral Relief Punk Jewelry
like
Find Similar
Retro stainless steel ring with black gemstone and floral embossed bullet shell design - US 7 / Antique Silver Black Zirconia
+5
Vintage Titanium Steel Ring For Men Industrial Bullet Base Design Black Rhinestone Inlaid Floral Relief Punk Jewelry
$4.14
No MOQ
Free Shipping
Women's Titanium Steel Eternity Ring Rhinestone Inlaid Minimalist Luxury Geometric Band Ring For Wedding Party Jewelry Gift
Women's Titanium Steel Eternity Ring Rhinestone Inlaid Minimalist Luxury Geometric Band Ring For Wedding Party Jewelry Gift
like
Find Similar
Macro detail of silver eternity ring featuring channel-set square-cut cubic zirconia gems - US 5 / Steel (One Row Square Zirconia)
Macro detail of rose gold eternity ring featuring square-cut sparkling cubic zirconia - US 5 / Rose Gold (Square Zirconia Row)
Macro detail of a gold-plated eternity ring with square-cut cubic zirconia stones - 12-b-1 Row Of Square Diamonds In Gold (refundable And Exchangeable If Faded) / Size 5
Macro view of rose gold double-row square zircon ring with polished stainless steel finish - US 5 / Rose Gold (Double Row Square Drill)
+172
Women's Titanium Steel Eternity Ring Rhinestone Inlaid Minimalist Luxury Geometric Band Ring For Wedding Party Jewelry Gift
$0.26-0.65
No MOQ
Free Shipping
Minimalist Love Knot Heart Ring Titanium Steel Polished High Luster Fashion Band Jewelry Gift For Women Men Unisex Simple
Minimalist Love Knot Heart Ring Titanium Steel Polished High Luster Fashion Band Jewelry Gift For Women Men Unisex Simple
like
Find Similar
Minimalist silver knot ring crafted in stainless steel with a polished tie knot design - US 4 / Silver - Love Knot
Minimalist knot ring in polished gold finish with an elegant heart knot design - US 4 / Gold - Love Knot
Polished rose gold stainless steel love knot ring with minimalist twisted design - US 4 / Rose Gold - Love Knot
Minimalist silver-tone hollow heart ring in titanium steel with a polished finish - US 4 / Silver - Heart
+27
Minimalist Love Knot Heart Ring Titanium Steel Polished High Luster Fashion Band Jewelry Gift For Women Men Unisex Simple
-4%
$1.37-1.62
No MOQ
 · 
41 sold recently
Free Shipping
925 Sterling Silver Zirconia Chain Link Ring For Women Minimalist Geometric Pave Zirconia Link Finger Ring Jewelry Gift
925 Sterling Silver Zirconia Chain Link Ring For Women Minimalist Geometric Pave Zirconia Link Finger Ring Jewelry Gift
like
Find Similar
S925 sterling silver cuban link ring featuring sparkling paved pavé zircons in silver - US Size 5 / Silver
+4
New925 Sterling Silver Zirconia Chain Link Ring For Women Minimalist Geometric Pave Zirconia Link Finger Ring Jewelry Gift
$17.98
No MOQ
Free Shipping
Vintage Men Titanium Steel Signet Ring Rectangular Black Gemstone Inlay Minimalist Gold Silver Polished Band Daily Jewelry
Vintage Men Titanium Steel Signet Ring Rectangular Black Gemstone Inlay Minimalist Gold Silver Polished Band Daily Jewelry
like
Find Similar
Minimalist titanium steel ring with a rectangular black gemstone and mirror reflection - US 7 / Steel
Mens gold stainless steel signet ring featuring a rectangular black onyx gemstone - US 7 / Gold
+12
Vintage Men Titanium Steel Signet Ring Rectangular Black Gemstone Inlay Minimalist Gold Silver Polished Band Daily Jewelry
$3.41-3.67
No MOQ
Free Shipping
Men Stainless Steel Cross Ring Iced Out Zirconia Hip Hop Jewelry 18K Gold Plated Band Religious Style Male Accessory
Men Stainless Steel Cross Ring Iced Out Zirconia Hip Hop Jewelry 18K Gold Plated Band Religious Style Male Accessory
like
Find Similar
Hip hop silver mens iced out stainless steel cross ring with white crystals - Size 7 / Steel
18K gold plated stainless steel hip hop ring for men featuring a crystal paved cross design - Size 7 / Gold
+12
Men Stainless Steel Cross Ring Iced Out Zirconia Hip Hop Jewelry 18K Gold Plated Band Religious Style Male Accessory
$3.67-4.19
No MOQ
Free Shipping
Hip Hop Stainless Steel Square Ring For Men Gold Silver Plated Greek Key Meander Pattern Rhinestone Inlaid Fashion Rock Jewelry
Hip Hop Stainless Steel Square Ring For Men Gold Silver Plated Greek Key Meander Pattern Rhinestone Inlaid Fashion Rock Jewelry
like
Find Similar
Mens silver signet ring with square 4x4 cubic zirconia and Greek Meander pattern engraving - Size 8 / Steel
Men's 18K gold plated square signet ring with Greek key pattern and CZ pavé setting - Size 8 / Gold
+8
Hip Hop Stainless Steel Square Ring For Men Gold Silver Plated Greek Key Meander Pattern Rhinestone Inlaid Fashion Rock Jewelry
$3.14-3.67
No MOQ
Free Shipping
Stainless Steel Gold Wrapped Open Ring For Women Minimalist Spiral Double Ball Fashion Jewelry Daily Wedding Party Ring
Stainless Steel Gold Wrapped Open Ring For Women Minimalist Spiral Double Ball Fashion Jewelry Daily Wedding Party Ring
like
Find Similar
3 options
Stainless Steel Gold Wrapped Open Ring For Women Minimalist Spiral Double Ball Fashion Jewelry Daily Wedding Party Ring
$2.43
No MOQ
Free Shipping
Men's Vintage Stainless Steel Signet Ring Gold Silver Plated Black Zirconia Inlaid Brick Wall Texture Industrial Jewelry Ring
Men's Vintage Stainless Steel Signet Ring Gold Silver Plated Black Zirconia Inlaid Brick Wall Texture Industrial Jewelry Ring
like
Find Similar
Macro detail of men's gold stainless steel ring with rectangle black stone and brick patterns - US 7 / Gold
Men's silver stainless steel ring with square black gemstone and brick texture - US 7 / Steel
+14
Men's Vintage Stainless Steel Signet Ring Gold Silver Plated Black Zirconia Inlaid Brick Wall Texture Industrial Jewelry Ring
-4%
$2.99-3.24
No MOQ
Free Shipping
Vintage Titanium Steel Hexagram Skull Ring For Men Punk Gothic Eagle Wings Carved Band Antique Silver Retro Jewelry Gift
Vintage Titanium Steel Hexagram Skull Ring For Men Punk Gothic Eagle Wings Carved Band Antique Silver Retro Jewelry Gift
like
Find Similar
Men's stainless steel signet ring with hexagram star and eagle wings relief design - 23# / Antique Silver
+5
NewVintage Titanium Steel Hexagram Skull Ring For Men Punk Gothic Eagle Wings Carved Band Antique Silver Retro Jewelry Gift
$3.27
No MOQ
Free Shipping
Vintage Punk Stainless Steel Skull Ring Men Women Skeleton Wearing Sunglasses Dragon Claw Gothic Rock Biker Jewelry Antique Silver Band Ring
Vintage Punk Stainless Steel Skull Ring Men Women Skeleton Wearing Sunglasses Dragon Claw Gothic Rock Biker Jewelry Antique Silver Band Ring
like
Find Similar
Vintage punk silver dragon claw ring with skull wearing sunglasses in a hiphop style - US 8 / Dragon Claw Skull Ring
+4
Vintage Punk Stainless Steel Skull Ring Men Women Skeleton Wearing Sunglasses Dragon Claw Gothic Rock Biker Jewelry Antique Silver Band Ring
$3.93
No MOQ
 · 
15 sold recently
Free Shipping
European American Retro Geometric Stainless Steel Open Ring For Women Adjustable Gold Plated Hollow Chain Ring Jewelry Gift
European American Retro Geometric Stainless Steel Open Ring For Women Adjustable Gold Plated Hollow Chain Ring Jewelry Gift
like
Find Similar
Close-up of a gold-plated titanium steel chain bracelet with textured hammered finish - Chain Link Style (S-R743-A)
Detailed view of golden chain link ring featuring smooth and twisted textures on a pedestal - Woven Link Style (S-R743-B)
Vintage geometric open bangle in gold finish with hammered texture and hollow honeycomb design - Wide Hollow Honeycomb Design (S-R743-D)
European American Retro Geometric Stainless Steel Open Ring For Women Adjustable Gold Plated Hollow Chain Ring Jewelry Gift
$1.18
No MOQ
Free Shipping
Stainless Steel Multi Layer Rhinestone Stackable Rings For Women Ins Style Gold Silver Plated Full Drill Geometric Finger Ring Jewelry
Stainless Steel Multi Layer Rhinestone Stackable Rings For Women Ins Style Gold Silver Plated Full Drill Geometric Finger Ring Jewelry
like
Find Similar
Detail of multi-layered gold ring featuring sparkling pavé crystals and sandblasted texture - US 6 / Frosted Rhinestone Multi-Layer Style (RC-1006G)
Detail view of multi-layer gold plated ring with crystal inlay and size measurement - US 6 / Multi-Link Pavé Style (RC-1007G)
Close-up of interlocking multi-layer gold and silver rings with size and weight measurements - US 6 / Gold and Silver Interlocking Style (RC-1010GS)
+6
Stainless Steel Multi Layer Rhinestone Stackable Rings For Women Ins Style Gold Silver Plated Full Drill Geometric Finger Ring Jewelry
$1.47-1.52
No MOQ
 · 
11 views
Free Shipping
Vintage Stainless Steel Rabbit Ear Skull Ring For Men Women Punk Gothic Biker Jewelry Distressed Retro Skull Finger Ring
Vintage Stainless Steel Rabbit Ear Skull Ring For Men Women Punk Gothic Biker Jewelry Distressed Retro Skull Finger Ring
like
Find Similar
Retro stainless steel ring featuring a detailed rabbit ear skull in vintage punk style - US Size 7 / Large Style (BR8-758)
Vintage stainless steel skull ring with rabbit ears and a retro silver finish for men - US Size 7 / Large Retro Black Style (BR8-758)
Vintage stainless steel rabbit skull ring with dark gothic aesthetic and distressed finish - US Size 7 / Small Style (BR8-809)
+15
Vintage Stainless Steel Rabbit Ear Skull Ring For Men Women Punk Gothic Biker Jewelry Distressed Retro Skull Finger Ring
$3.35
No MOQ
Free Shipping
Minimalist Titanium Steel Frosted Ring For Women Simple Gold Rose Gold Silver Band Ring Fashion Commute Jewelry Thin 素圈
Minimalist Titanium Steel Frosted Ring For Women Simple Gold Rose Gold Silver Band Ring Fashion Commute Jewelry Thin 素圈
like
Find Similar
Simple women's titanium steel ring with elegant frosted finish in silver tone. - Size 5 / 2mm / Steel
Minimalist rose gold titanium steel ring with an elegant frosted finish for daily wear - Size 5 / 2mm / Gold
Minimalist rose gold titanium steel ring with a frosted sandblasted finish for women. - Size 5 / 2mm / Rose Gold
+18
Minimalist Titanium Steel Frosted Ring For Women Simple Gold Rose Gold Silver Band Ring Fashion Commute Jewelry Thin 素圈
$0.32-0.47
No MOQ
 · 
865 sold recently
Free Shipping
Minimalist Stainless Steel Horizontal Bar Ring For Women Men Geometric Geometric Jewelry Gold Silver Color Finger Ring Gift
Minimalist Stainless Steel Horizontal Bar Ring For Women Men Geometric Geometric Jewelry Gold Silver Color Finger Ring Gift
like
Find Similar
Minimalist silver titanium steel ring with vertical bar design on white background - US 5 / Steel
Minimalist gold titanium steel ring featuring a geometric rectangular bar design - US 5 / Gold
+4
Minimalist Stainless Steel Horizontal Bar Ring For Women Men Geometric Geometric Jewelry Gold Silver Color Finger Ring Gift
$1.36-1.60
No MOQ
Free Shipping
Vintage Titanium Steel Signet Ring For Men Square Cutting Red Blue Yellow Black Gemstone Punk Hip Hop Fashion Jewelry
Vintage Titanium Steel Signet Ring For Men Square Cutting Red Blue Yellow Black Gemstone Punk Hip Hop Fashion Jewelry
like
Find Similar
Vintage men's titanium steel ring with a large red square gemstone and intricate carvings - US 7 / Steel Red Stone
Retro titanium steel ring with large square yellow gemstone and woven texture band - US 7 / Steel Yellow Stone
Vintage titanium steel ring with a large square faceted blue gemstone and woven texture - US 7 / Steel Blue Stone
+15
Vintage Titanium Steel Signet Ring For Men Square Cutting Red Blue Yellow Black Gemstone Punk Hip Hop Fashion Jewelry
-5%
$3.73
No MOQ
Free Shipping
Vintage Leopard Head Stainless Steel Ring For Men Women Distressed Cracked Punk Gothic Animal Jewelry Band
Vintage Leopard Head Stainless Steel Ring For Men Women Distressed Cracked Punk Gothic Animal Jewelry Band
like
Find Similar
Vintage stainless steel tiger head ring with cracked texture and antique finish for men - US 7 / Steel
+6
Vintage Leopard Head Stainless Steel Ring For Men Women Distressed Cracked Punk Gothic Animal Jewelry Band
$3.41
No MOQ
Free Shipping
Stainless Steel Ring With Multiple Row Pave Rhinestone Shiny Luxury Statement Jewelry For Men Women
Stainless Steel Ring With Multiple Row Pave Rhinestone Shiny Luxury Statement Jewelry For Men Women
like
Find Similar
Titanium steel ring in silver finish with five rows of pavé crystals and arched surface - US 6 / 5 Row Pavé White Clay Diamond Steel Color
Close-up of golden titanium steel ring featuring five rows of pavé crystals and polished edge - US 6 / 5 Row Pavé White Clay Diamond Gold Color
Black square suspension display box for titanium steel ring with flexible clear film - US 7 / Film Suspension Jewelry Box
+18
Stainless Steel Ring With Multiple Row Pave Rhinestone Shiny Luxury Statement Jewelry For Men Women
-5%
$0.21-0.72
No MOQ
 · 
43 sold recently
Free Shipping
Minimalist Stainless Steel Gold Plated Open Ring For Women Heart Hollow Leaf Wave Adjustable Finger Jewelry Waterproof Hypoallergenic Ring
Minimalist Stainless Steel Gold Plated Open Ring For Women Heart Hollow Leaf Wave Adjustable Finger Jewelry Waterproof Hypoallergenic Ring
like
Find Similar
Minimalist gold leaf branch open ring in stainless steel for women style JZ21010 - Irregular Leaf Splicing (JZ21010)
Gold stainless steel heart ring with waterproof and hypoallergenic features for women - Hollow Heart Style (JZ21017)
Golden stainless steel open ring featuring a hollow leaf design with detailed measurements - Hollow Botanical Leaf (JZ21018)
Minimalist gold stainless steel wavy multi-layer ring showing 19.86mm inner diameter size - Multi-layer Wave Beaded (JZ21019)
Minimalist Stainless Steel Gold Plated Open Ring For Women Heart Hollow Leaf Wave Adjustable Finger Jewelry Waterproof Hypoallergenic Ring
$1.44-3.09
No MOQ
Free Shipping
Heart Ring 18K Gold Plated Titanium Steel Jewelry Hollow Chain Link Geometric Band Elegant Finger Rings For Women Girls Fashion
Heart Ring 18K Gold Plated Titanium Steel Jewelry Hollow Chain Link Geometric Band Elegant Finger Rings For Women Girls Fashion
like
Find Similar
Elegant gold hollow heart chain ring for women shown on a hand with lace background - US 7 / Gold
+5
Heart Ring 18K Gold Plated Titanium Steel Jewelry Hollow Chain Link Geometric Band Elegant Finger Rings For Women Girls Fashion
-4%
$2.12
No MOQ
Free Shipping
Vintage Stainless Steel Open Ring For Women Gold Plated Bold Hammered Liquid Metal Style Adjustable Chubby Statement Ring
Vintage Stainless Steel Open Ring For Women Gold Plated Bold Hammered Liquid Metal Style Adjustable Chubby Statement Ring
like
Find Similar
Chubby hammered stainless steel open ring with 9.1g weight and dimension labels - Steel Color Wide Hammered (R693_2 Steel Color)
Detailed view of wide hammered texture gold ring with dimension and weight measurements - Hammered Bumpy Style (R693_1)
Detailed dimensions of wide hammered gold dome ring showing width, height and weight - Polished Liquid Wave Pattern (R692_1)
Chunky stainless steel open ring with detailed dimension markings and 14.8g weight info - Steel Color Oval Hammered (R692_2 Steel Color)
Vintage Stainless Steel Open Ring For Women Gold Plated Bold Hammered Liquid Metal Style Adjustable Chubby Statement Ring
$3.35
No MOQ
Free Shipping
Men Band Ring Stainless Steel With Wood Grain Inlay High Polished Fashion Jewelry For Male Comfort Fit
Men Band Ring Stainless Steel With Wood Grain Inlay High Polished Fashion Jewelry For Male Comfort Fit
like
Find Similar
Men's matte black stainless steel ring featuring dual wood grain inlay accents - US 8 / Black
Mens 304 stainless steel ring with double wood grain inlay and polished silver finish - US 8 / Silver
+10
Men Band Ring Stainless Steel With Wood Grain Inlay High Polished Fashion Jewelry For Male Comfort Fit
-4%
$0.80
No MOQ
 · 
185 sold recently
Free Shipping
Vintage Titanium Steel Braided Open Ring For Men Retro Hip Hop Adjustable Twisted Geometric Texture Finger Ring Jewelry Gift
Vintage Titanium Steel Braided Open Ring For Men Retro Hip Hop Adjustable Twisted Geometric Texture Finger Ring Jewelry Gift
like
Find Similar
5 options
Vintage Titanium Steel Braided Open Ring For Men Retro Hip Hop Adjustable Twisted Geometric Texture Finger Ring Jewelry Gift
-4%
$3.14
No MOQ
Free Shipping
Minimalist Titanium Steel Band Ring For Men Women Polished Stainless Steel Plain Ring Comfort Fit High Shine Jewelry Accessory
Minimalist Titanium Steel Band Ring For Men Women Polished Stainless Steel Plain Ring Comfort Fit High Shine Jewelry Accessory
like
Find Similar
Minimalist polished rose gold ring for men and women with a sleek plain band design - US 5 / Rose Gold
Classic gold mirror polished ring with a minimalist flat band design for unisex daily wear - US 5 / Gold
Minimalist silver-colored band ring with a polished metallic finish on a white background - US 5 / Silver
Minimalist ring in brilliant blue plated titanium steel with a sleek polished finish - US 5 / Blue
+41
Minimalist Titanium Steel Band Ring For Men Women Polished Stainless Steel Plain Ring Comfort Fit High Shine Jewelry Accessory
-6%
$0.20-0.47
No MOQ
Free Shipping
Gothic Punk Alloy Rings For Men Women Hip Hop Streetwear Crossbones Spider Butterfly Angel Wings Vintage Jewelry
Gothic Punk Alloy Rings For Men Women Hip Hop Streetwear Crossbones Spider Butterfly Angel Wings Vintage Jewelry
like
Find Similar
Gothic asymmetric wing open ring featuring feathered and bat wings with vintage silver finish - Lost Angel Wings - Size 7
Gothic spider and butterfly wing ring in silver metal with web textures and dark style - Spider Butterfly - Size 8
Hip hop style crossed bones ring with polished silver finish and gothic punk design - Crossed Bones - Size 7
+6
Gothic Punk Alloy Rings For Men Women Hip Hop Streetwear Crossbones Spider Butterfly Angel Wings Vintage Jewelry
-4%
$1.00
Mix MOQ : 2
 · 
14 sold recently
Free Shipping
Stainless Steel Hammered Texture Heart Open Ring For Women Waterproof Hypoallergenic Hip Hop Rock Personalized Gold Silver Iridescent Finger Ring
Stainless Steel Hammered Texture Heart Open Ring For Women Waterproof Hypoallergenic Hip Hop Rock Personalized Gold Silver Iridescent Finger Ring
like
Find Similar
Macro view of gold-plated heart ring featuring a hammered texture and sizing details - Hammered Heart Shape (YYR023294-G) / Gold (YYR023294-G)
Macro detail of waterproof iridescent heart ring showing its textured surface - Dot Textured Heart Style (YYR023294-C) / Iridescent (YYR023294-C)
Detail of waterproof stainless steel heart ring with unique textured hammered finish surface - Hammered Heart Shape (YYR023294-P) / Silver (YYR023294-P)
Stainless Steel Hammered Texture Heart Open Ring For Women Waterproof Hypoallergenic Hip Hop Rock Personalized Gold Silver Iridescent Finger Ring
$1.30-1.53
No MOQ
Free Shipping
Vintage Stainless Steel Heart Cross Wings Ring For Men Women Gothic Punk Hip Hop Distressed Hollow Out Band Jewelry Gift
Vintage Stainless Steel Heart Cross Wings Ring For Men Women Gothic Punk Hip Hop Distressed Hollow Out Band Jewelry Gift
like
Find Similar
Vintage silver stainless steel cross heart ring with hollowed hip hop design - US 8 / Heart Ring
+4
NewVintage Stainless Steel Heart Cross Wings Ring For Men Women Gothic Punk Hip Hop Distressed Hollow Out Band Jewelry Gift
$3.93
Mix MOQ : 2
Free Shipping
Retro Punk Fuck Off Letter Signet Ring For Men Alloy Vintage Distressed Finish Streetwear Hip Hop Jewelry Accessory
Retro Punk Fuck Off Letter Signet Ring For Men Alloy Vintage Distressed Finish Streetwear Hip Hop Jewelry Accessory
like
Find Similar
Retro punk style wide stainless steel ring with Fuck Off relief on a rustic background - US 6 / Silver
+6
Retro Punk Fuck Off Letter Signet Ring For Men Alloy Vintage Distressed Finish Streetwear Hip Hop Jewelry Accessory
-3%
$0.25
No MOQ
 · 
172 sold recently
Vintage Chinese Dragon Pattern Stainless Steel Ring For Men Punk Hip Hop Mirror Polished Enamel Finger Ring Jewelry
Vintage Chinese Dragon Pattern Stainless Steel Ring For Men Punk Hip Hop Mirror Polished Enamel Finger Ring Jewelry
like
Find Similar
1 option
NewVintage Chinese Dragon Pattern Stainless Steel Ring For Men Punk Hip Hop Mirror Polished Enamel Finger Ring Jewelry
$1.70
No MOQ
Free Shipping
Eye Of Horus Ankh Ring Men Titanium Steel Vintage Retro Gothic Hollow Out Ancient Egyptian Religious Band Finger Ring Jewelry
Eye Of Horus Ankh Ring Men Titanium Steel Vintage Retro Gothic Hollow Out Ancient Egyptian Religious Band Finger Ring Jewelry
like
Find Similar
5 options
NewEye Of Horus Ankh Ring Men Titanium Steel Vintage Retro Gothic Hollow Out Ancient Egyptian Religious Band Finger Ring Jewelry
-5%
$3.36
No MOQ
Free Shipping
Vintage Stainless Steel Iron Cross Square Ring For Men Hip Hop Punk Gothic Blackened Distressed Flame Pattern Biker Ring
Vintage Stainless Steel Iron Cross Square Ring For Men Hip Hop Punk Gothic Blackened Distressed Flame Pattern Biker Ring
like
Find Similar
Men's punk stainless steel square ring with iron cross relief and flame side details - US 10 / Cross Square Style
+4
Vintage Stainless Steel Iron Cross Square Ring For Men Hip Hop Punk Gothic Blackened Distressed Flame Pattern Biker Ring
$3.67
Mix MOQ : 2
Free Shipping
Vintage Stainless Steel Tree of Life Open Ring For Women Colorful Beaded Hollow Finger Ring Exquisite Adjustable Jewelry Gift
Vintage Stainless Steel Tree of Life Open Ring For Women Colorful Beaded Hollow Finger Ring Exquisite Adjustable Jewelry Gift
like
Find Similar
Detail of gold life tree open ring featuring red crystal beads on a white rock surface - Red
Detail of golden life tree ring featuring green crystal beads and vintage metal design - Green
Macro shot of French vintage life tree open ring with golden wire and white beads - White
Detailed close-up of adjustable tree of life ring with colorful beads and vintage gold finish - Champagne
+2
Vintage Stainless Steel Tree of Life Open Ring For Women Colorful Beaded Hollow Finger Ring Exquisite Adjustable Jewelry Gift
$2.23
No MOQ
Free Shipping
S925 Sterling Silver Chain Link Adjustable Open Ring For Women Minimalist Hollow Out Index Finger Ring Cool Fashion Jewelry
S925 Sterling Silver Chain Link Adjustable Open Ring For Women Minimalist Hollow Out Index Finger Ring Cool Fashion Jewelry
like
Find Similar
S925 sterling silver hollow chain ring in silver finish with adjustable open design - Open Size 14 (Adjustable 12-17) / White Gold
Minimalist S925 sterling silver hollow chain open ring in a gold finish for women - Open Size 14 (Adjustable 12-17) / 18K Gold
S925 Sterling Silver Chain Link Adjustable Open Ring For Women Minimalist Hollow Out Index Finger Ring Cool Fashion Jewelry
-15%
$29.17
Mix MOQ : 2
Free Shipping
925 Sterling Silver Moonstone Zirconia Ring Elegant Minimalist Double Stone Ring For Women Daily Fashion Jewelry Accessory
925 Sterling Silver Moonstone Zirconia Ring Elegant Minimalist Double Stone Ring For Women Daily Fashion Jewelry Accessory
like
Find Similar
5 options
925 Sterling Silver Moonstone Zirconia Ring Elegant Minimalist Double Stone Ring For Women Daily Fashion Jewelry Accessory
-14%
$12.15
No MOQ
Free Shipping
Minimalist Titanium Steel Ring Gold Plated Enamel Striped Band Geometric Mirror Polish Trendy Jewelry Accessory For Couples
Minimalist Titanium Steel Ring Gold Plated Enamel Striped Band Geometric Mirror Polish Trendy Jewelry Accessory For Couples
like
Find Similar
Gold titanium steel ring featuring double white ceramic bands and diamond-cut texture - US 6 / White
Minimalist wide gold ceramic ring with pink enamel inlay and geometric diamond pattern - US 7 / Pink
Golden titanium steel wide ceramic ring featuring white enamel and faceted textures - US 6 / Blue
+9
Minimalist Titanium Steel Ring Gold Plated Enamel Striped Band Geometric Mirror Polish Trendy Jewelry Accessory For Couples
$1.31
No MOQ
 · 
268 sold recently
Free Shipping
Stainless Steel Ring Matte Brushed Finish Beveled Edge Simple Fashion Comfort Fit Band For Men Women
Stainless Steel Ring Matte Brushed Finish Beveled Edge Simple Fashion Comfort Fit Band For Men Women
like
Find Similar
8mm matte blue brushed stainless steel ring with polished inner lining and flat edge - 8mm / US 6 / Blue
8mm matte silver stainless steel ring with brushed finish and polished edges for men - 8mm / US 6 / Silver
8mm matte black stainless steel ring with brushed surface and polished beveled edges - 8mm / US 13 / Black
Minimalist 8mm golden matte stainless steel ring with brushed finish and polished edges - 8mm / US 13 / Gold
+57
Stainless Steel Ring Matte Brushed Finish Beveled Edge Simple Fashion Comfort Fit Band For Men Women
$0.29-0.34
No MOQ
 · 
1K+ sold recently
Top 10% Best Sellers
in Rings
Minimalist Punk Stainless Steel Signet Ring High Polished Smooth Round Surface Titanium Steel Band Ring For Men Women Jewelry
Minimalist Punk Stainless Steel Signet Ring High Polished Smooth Round Surface Titanium Steel Band Ring For Men Women Jewelry
like
Find Similar
Polished stainless steel punk style dome ring with smooth round signet top on wood background - US 7 / Steel
Polished gold stainless steel signet ring with a flat oval surface on black reflection - US 7 / Gold
Macro shot of polished black stainless steel signet ring with a smooth circular surface - US 7 / Black
Gold polished stainless steel oval signet ring with smooth mirror finish for men and women - US 7 / Rose Gold
+31
Minimalist Punk Stainless Steel Signet Ring High Polished Smooth Round Surface Titanium Steel Band Ring For Men Women Jewelry
$3.14-3.41
Mix MOQ : 3
Free Shipping
Vintage Stainless Steel Carbon Fiber Inlay Signet Ring For Men Women Gold Silver Polished Round Finger Ring Fashion Jewelry
Vintage Stainless Steel Carbon Fiber Inlay Signet Ring For Men Women Gold Silver Polished Round Finger Ring Fashion Jewelry
like
Find Similar
Men's stainless steel ring featuring a black carbon fiber inlay on a polished silver band - US 7 / Steel
Polished gold signet ring for men featuring a round face with black carbon fiber inlay - US 7 / Gold
+10
Vintage Stainless Steel Carbon Fiber Inlay Signet Ring For Men Women Gold Silver Polished Round Finger Ring Fashion Jewelry
-4%
$3.73
No MOQ
Free Shipping
Men Titanium Steel Signet Ring Minimalist Circular Black Enamel Polished Brushed Finish Western Style Punk Jewelry For Daily Wear
Men Titanium Steel Signet Ring Minimalist Circular Black Enamel Polished Brushed Finish Western Style Punk Jewelry For Daily Wear
like
Find Similar
Polished silver titanium steel signet ring with a round black enamel face on white background - US 7 / Polished
Minimalist round signet ring in polished silver stainless steel with black enamel inlay - US 7 / Brushed Finish
+10
Men Titanium Steel Signet Ring Minimalist Circular Black Enamel Polished Brushed Finish Western Style Punk Jewelry For Daily Wear
-5%
$3.48
No MOQ
Free Shipping
Men Titanium Steel Wide Band Ring With Rectangular Zirconia Brushed Finish Hip Hop Punk Style Fashion Jewelry Gift For Men
Men Titanium Steel Wide Band Ring With Rectangular Zirconia Brushed Finish Hip Hop Punk Style Fashion Jewelry Gift For Men
like
Find Similar
Men's wide brushed titanium steel ring featuring a large rectangular cubic zirconia inlay - US 7 / Steel
Men's gold titanium steel ring with brushed finish and inlaid rectangular zircon stone - US 7 / Gold
+8
Men Titanium Steel Wide Band Ring With Rectangular Zirconia Brushed Finish Hip Hop Punk Style Fashion Jewelry Gift For Men
-4%
$2.99-3.24
Mix MOQ : 3
Free Shipping
Retro Men's Stainless Steel Square Rhinestone Ring Dominant Geometric Greek Key Pattern Band Ring Jewelry For Men Gift
Retro Men's Stainless Steel Square Rhinestone Ring Dominant Geometric Greek Key Pattern Band Ring Jewelry For Men Gift
like
Find Similar
Vintage stainless steel ring for men featuring an emerald-cut green stone and Greek key pattern - US 7 / Steel Green
Men's square signet ring in silver steel with blue sapphire stone and Greek key pattern - US 7 / Steel Blue
Vintage stainless steel ring for men featuring a square red gemstone and Greek key patterns - US 7 / Red
+15
NewRetro Men's Stainless Steel Square Rhinestone Ring Dominant Geometric Greek Key Pattern Band Ring Jewelry For Men Gift
-5%
$3.73
No MOQ
Free Shipping
Stainless Steel Band Rings Two Tone Gold Silver Color Frosted Sandblasted Design For Couples Men Women Minimalist
Stainless Steel Band Rings Two Tone Gold Silver Color Frosted Sandblasted Design For Couples Men Women Minimalist
like
Find Similar
Frosted titanium steel ring with gold-plated inner lining and diamond accent - US 8 / Plain Style
Frosted titanium steel ring with three diamonds and polished gold inner band finish - US 6 / Inlay
+12
Stainless Steel Band Rings Two Tone Gold Silver Color Frosted Sandblasted Design For Couples Men Women Minimalist
$0.52-0.65
No MOQ
 · 
86 sold recently
Free Shipping
925 Sterling Silver Ring Classic Plain Band Polished Finish 2mm 4mm 6mm Width Gold Silver Ring For Men Women Minimalist Jewelry
925 Sterling Silver Ring Classic Plain Band Polished Finish 2mm 4mm 6mm Width Gold Silver Ring For Men Women Minimalist Jewelry
like
Find Similar
Polished S925 sterling silver ring with 18k gold plating in a classic band style - Gold 6mm / US Size 8
Classic 925 sterling silver ring with polished gold finish, slim band design - US Size 5 / Gold 2mm
Classic high-polished S925 sterling silver band ring with a clean flat edge design - US Size 5 / Silver 2mm
Close-up of classic polished S925 silver band ring with inner 925 engraving - US Size 8 / Silver 6mm
+131
925 Sterling Silver Ring Classic Plain Band Polished Finish 2mm 4mm 6mm Width Gold Silver Ring For Men Women Minimalist Jewelry
$14.28-25.81
No MOQ
Free Shipping
Korean Design 925 Sterling Silver Zirconia Ring For Women Minimalist Vintage Geometric Electroplated Inlaid Finger Ring Jewelry
Korean Design 925 Sterling Silver Zirconia Ring For Women Minimalist Vintage Geometric Electroplated Inlaid Finger Ring Jewelry
like
Find Similar
4 options
Korean Design 925 Sterling Silver Zirconia Ring For Women Minimalist Vintage Geometric Electroplated Inlaid Finger Ring Jewelry
$18.02
No MOQ
Free Shipping
Flower Resin Crystal Ring Alloy Rhinestone Adjustable Open Ring Vintage Fashion Jewelry For Women Colorful Multi Elements
Flower Resin Crystal Ring Alloy Rhinestone Adjustable Open Ring Vintage Fashion Jewelry For Women Colorful Multi Elements
like
Find Similar
Golden flower and butterfly cocktail ring with white rose and crystal stones - White
Adjustable gold ring featuring purple resin rose and colorful crystal flower design - Purple
Exquisite gold floral ring featuring dark green crystal center and emerald gemstones - Green
Floral cluster open ring with black resin rose, smoke grey crystal and gold band - Black
+4
Flower Resin Crystal Ring Alloy Rhinestone Adjustable Open Ring Vintage Fashion Jewelry For Women Colorful Multi Elements
-5%
$0.95
No MOQ
 · 
33 sold recently
Free Shipping
Ancient Egyptian Ankh Ring Stainless Steel Key Of Life Cross Ring Vintage Religious Jewelry For Men Women Gold Silver
Ancient Egyptian Ankh Ring Stainless Steel Key Of Life Cross Ring Vintage Religious Jewelry For Men Women Gold Silver
like
Find Similar
Polished stainless steel Egyptian Ankh ring on stone background for men and women - US 7 / Steel
Polished gold Egyptian Ankh cross stainless steel ring displayed on natural stone - US 7 / Gold
+12
NewAncient Egyptian Ankh Ring Stainless Steel Key Of Life Cross Ring Vintage Religious Jewelry For Men Women Gold Silver
-4%
$2.94-3.19
No MOQ
Free Shipping
Titanium Steel Poker Ace Of Spades Signet Ring For Men Vintage Punk Spade Ace Gold Steel Color Polished Fashion Jewelry Band Ring
Titanium Steel Poker Ace Of Spades Signet Ring For Men Vintage Punk Spade Ace Gold Steel Color Polished Fashion Jewelry Band Ring
like
Find Similar
Men's Ace of Spades signet ring in gold finish with black enamel poker card motif - US 7 / Gold
Polished stainless steel punk style square ring featuring a black Ace of Spades enamel design - US 7 / Steel
+10
Titanium Steel Poker Ace Of Spades Signet Ring For Men Vintage Punk Spade Ace Gold Steel Color Polished Fashion Jewelry Band Ring
-5%
$3.24-3.48
No MOQ
Free Shipping
Birthstone Stainless Steel Ring For Women Thin Gold Rose Gold Silver Rhinestone Inlaid Geometric Daily Jewelry Finger Ring
Birthstone Stainless Steel Ring For Women Thin Gold Rose Gold Silver Rhinestone Inlaid Geometric Daily Jewelry Finger Ring
like
Find Similar
Minimalist 14K gold stainless steel ring with 2mm round emerald birthstone detail - US5 / May-Emerald/Green / Gold
Minimalist stainless steel ring featuring 2mm purple amethyst and 14K gold plating finish - US5 / June-Amethyst/Purple / Gold
Gold stainless steel ring with 2mm yellow citrine stone, US sizes 5 6 7 available - US5 / November-Jonquil/Light Yellow / Gold
Minimalist 14K gold plated stainless steel ring with 2mm blue aquamarine stone - US5 / December-Aquamarine/Lake Blue / Gold
+75
Birthstone Stainless Steel Ring For Women Thin Gold Rose Gold Silver Rhinestone Inlaid Geometric Daily Jewelry Finger Ring
-5%
$0.64-0.84
No MOQ
 · 
11 views
Free Shipping
Vintage Knights Templar Cross Signet Ring Men Stainless Steel Latin Engraved Rhinestone Gothic Religious Shield Jewelry
Vintage Knights Templar Cross Signet Ring Men Stainless Steel Latin Engraved Rhinestone Gothic Religious Shield Jewelry
like
Find Similar
7 options
Vintage Knights Templar Cross Signet Ring Men Stainless Steel Latin Engraved Rhinestone Gothic Religious Shield Jewelry
-5%
$3.43
No MOQ
Free Shipping
Fashion Minimalist Stainless Steel Gold Plated Heart Irregular Adjustable Open Rings Set For Women Trendy Jewelry Gift
Fashion Minimalist Stainless Steel Gold Plated Heart Irregular Adjustable Open Rings Set For Women Trendy Jewelry Gift
like
Find Similar
Elegant gold plated heart shaped open rings with textured and polished finishes - Gold Style (C7313)
Minimalist silver gold-plated snake chain heart open ring set with polished liquid texture - Silver Style (C7314)
Fashion Minimalist Stainless Steel Gold Plated Heart Irregular Adjustable Open Rings Set For Women Trendy Jewelry Gift
$0.78-1.05
Mix MOQ : 2
Free Shipping
Stainless Steel Hugging Hands Open Ring For Men Women Vintage Gothic Wrap Band Fashion Jewelry Thumb Finger Ring Gift
Stainless Steel Hugging Hands Open Ring For Men Women Vintage Gothic Wrap Band Fashion Jewelry Thumb Finger Ring Gift
like
Find Similar
Fashionable men's black stainless steel embrace hands ring on white background - US 7 / Black
Vintage stainless steel open ring featuring a gothic hands design in antique finish - US 7 / Steel
Minimalist gold hugging hands stainless steel ring with detailed arm texture engraving - US 7 / Gold
+18
Stainless Steel Hugging Hands Open Ring For Men Women Vintage Gothic Wrap Band Fashion Jewelry Thumb Finger Ring Gift
$3.35-3.77
No MOQ
Free Shipping
Men Vintage Stainless Steel Freemasonry Ring Compass Square Letter G Seal Ring Gold Silver Polished Biker Fashion Jewelry
Men Vintage Stainless Steel Freemasonry Ring Compass Square Letter G Seal Ring Gold Silver Polished Biker Fashion Jewelry
like
Find Similar
Vintage stainless steel Freemasonry ring with gold G symbol and compass square icon - US 7 / Steel
Golden Masonic signet ring with engraved compass and square on a polished steel band - US 7 / Gold
+10
Men Vintage Stainless Steel Freemasonry Ring Compass Square Letter G Seal Ring Gold Silver Polished Biker Fashion Jewelry
$3.67-3.93
No MOQ
Free Shipping
Go to

More in jewelry

Lab-Created Gemstone Jewelry

Explore more in toe rings

openfoot jewelryfingersimplewhiteplasticinlaiddesignbodyplated stainless steel
footgold platedsteelartificialpolishedgirlsgold plated adjustableturquoise18k gold platedcolor ring

Ready to source like an insider

Get a direct line to the factory floor — no minimums, no middlemen, no guesswork.
iconReal factory pricing, no markup in betweeniconEvery order hand-inspected before it shipsicon5,000+ new products added daily
Get Inside Access