Everful

Wholesale toe rings

Factory-direct selection, vetted for quality and ready to order.

Sign Up
Toe Rings

Find the perfect pieces: stainless steel rings, copper rings, alloy rings and more

All products in toe rings

filterShow Filters
Price Drop
Free Shipping
Best Seller
New Arrivals
Vintage Titanium Steel Leaf Shape Wave Ring Two Tone Gold Silver Hollow Band For Men Women Punk Jewelry Accessories
Vintage Titanium Steel Leaf Shape Wave Ring Two Tone Gold Silver Hollow Band For Men Women Punk Jewelry Accessories
like
Find Similar
Vintage leaf-shaped titanium steel ring with two-tone hollow wave design and polished finish - US 6 / Gold and Silver Two-tone
Vintage Titanium Steel Leaf Shape Wave Ring Two Tone Gold Silver Hollow Band For Men Women Punk Jewelry Accessories
$3.41
No MOQ
Free Shipping
Minimalist Irregular Molten Lava Texture Stainless Steel Ring For Men Retro Hip Hop Silver Band Ring Jewelry Gift
Minimalist Irregular Molten Lava Texture Stainless Steel Ring For Men Retro Hip Hop Silver Band Ring Jewelry Gift
like
Find Similar
Vintage irregular lava texture titanium steel ring for men with minimalist silver finish - US 7 / Silver
+5
Minimalist Irregular Molten Lava Texture Stainless Steel Ring For Men Retro Hip Hop Silver Band Ring Jewelry Gift
$3.41
No MOQ
Free Shipping
Fashion Men Titanium Steel Ring With Meteorite Texture Inlay Polished Industrial Style Band Ring For Women Men Unisex Jewelry Finger Accessories Gift
Fashion Men Titanium Steel Ring With Meteorite Texture Inlay Polished Industrial Style Band Ring For Women Men Unisex Jewelry Finger Accessories Gift
like
Find Similar
Titanium steel ring for men with gold polished edges and silver ice foil inlay - US 7 / Gold
Men's titanium steel ring with silver meteorite pattern inlay and polished finish - US 7 / Silver
Men's titanium ring featuring black band with silver meteorite inlay and polished edges - US 7 / Black
Blue titanium steel ring for men featuring silver grey meteorite textured inlay - US 7 / Blue
+28
Fashion Men Titanium Steel Ring With Meteorite Texture Inlay Polished Industrial Style Band Ring For Women Men Unisex Jewelry Finger Accessories Gift
-3%
$0.50
Mix MOQ : 2
 · 
83 sold recently
Minimalist Titanium Steel Signet Ring Square Mother Of Artificial Pearl Inlaid Geometric Finger Ring For Men Women Fashion Daily Jewelry Gold Silver Black
Minimalist Titanium Steel Signet Ring Square Mother Of Artificial Pearl Inlaid Geometric Finger Ring For Men Women Fashion Daily Jewelry Gold Silver Black
like
Find Similar
Polished titanium steel signet ring with square grey shell inlay for women - US 7 / Steel
Gold plated titanium steel ring with rectangular mother of pearl inlay on mirror surface - US 7 / Gold
Black titanium signet ring with square white mother of pearl inlay on gray background - US 7 / Black
+15
Minimalist Titanium Steel Signet Ring Square Mother Of Artificial Pearl Inlaid Geometric Finger Ring For Men Women Fashion Daily Jewelry Gold Silver Black
$3.41-3.67
No MOQ
Free Shipping
Minimalist Copper Zirconia Double Layer Open Ring For Women Adjustable Rose Gold Silver Plated Elegant Fashion Finger Ring Jewelry
Minimalist Copper Zirconia Double Layer Open Ring For Women Adjustable Rose Gold Silver Plated Elegant Fashion Finger Ring Jewelry
like
Find Similar
Elegant rose gold double-layered open ring with sparkling cubic zirconia inlay - Adjustable Open / Rose Gold
Elegant silver double-layer open ring with marquise and round zircon inlays for women - Adjustable Open / Silver
NewMinimalist Copper Zirconia Double Layer Open Ring For Women Adjustable Rose Gold Silver Plated Elegant Fashion Finger Ring Jewelry
$2.07
Mix MOQ : 2
Free Shipping
Vintage Stainless Steel Dragon Ring For Men Punk Retro Chinese Dragon Scale Wrap Finger Ring Masculine Fashion Jewelry Gift
Vintage Stainless Steel Dragon Ring For Men Punk Retro Chinese Dragon Scale Wrap Finger Ring Masculine Fashion Jewelry Gift
like
Find Similar
Vintage golden dragon wrap ring in punk style with detailed scales and dragon head - US 7 / Gold
Retro punk titanium steel dragon ring with silver distressed finish and scale textures - US 7 / Steel
+10
Vintage Stainless Steel Dragon Ring For Men Punk Retro Chinese Dragon Scale Wrap Finger Ring Masculine Fashion Jewelry Gift
$3.14-3.41
No MOQ
Free Shipping
Vintage 925 Sterling Silver Geometric Ring For Women Colored Gemstone Inlaid Finger Ring Rose Gold Plated Jewelry Accessory
Vintage 925 Sterling Silver Geometric Ring For Women Colored Gemstone Inlaid Finger Ring Rose Gold Plated Jewelry Accessory
like
Find Similar
Gold sterling silver ring with light blue topaz and small clear gemstones on white fabric - US 6 / Gold (KR1535)
S925 sterling silver ring with sky blue topaz and braided gold band for women - US 6 / Gold (KSR144)
925 sterling silver moonstone ring in rose gold with small diamond accents in a 45-degree view - US 6 / Rose Gold (KSR155)
Square cut pink topaz ring in rose gold with halo diamonds and beaded texture - US 6 / Rose Gold (KSR154)
+3
Vintage 925 Sterling Silver Geometric Ring For Women Colored Gemstone Inlaid Finger Ring Rose Gold Plated Jewelry Accessory
-31%
$11.20-21.65
No MOQ
 · 
17 views
Free Shipping
Rotatable Stainless Steel Ring For Men Women Six Syllable Mantra Buddhist Retro Finger Ring Spinner Anxiety Jewelry
Rotatable Stainless Steel Ring For Men Women Six Syllable Mantra Buddhist Retro Finger Ring Spinner Anxiety Jewelry
like
Find Similar
12 options
Rotatable Stainless Steel Ring For Men Women Six Syllable Mantra Buddhist Retro Finger Ring Spinner Anxiety Jewelry
$2.49
No MOQ
Free Shipping
Minimalist Stainless Steel Open Adjustable Ring For Women Gold Plated Hollow Layered Square Artificial Stone Geometric Ring Jewelry
Minimalist Stainless Steel Open Adjustable Ring For Women Gold Plated Hollow Layered Square Artificial Stone Geometric Ring Jewelry
like
Find Similar
Minimalist gold stainless steel open ring featuring a green malachite stone inlay - Malachite Green (JZ21090A)
Multi-layer 18K gold plated stainless steel ring featuring a square blue turquoise stone - Marble Blue (JZ21090B)
Minimalist gold stainless steel tiered ring with square green gemstone and chain element - Turquoise Color (JZ21090D)
Gold plated stainless steel multi-layer open ring with square green gemstone inlay - Light Green (JZ21090E)
Minimalist Stainless Steel Open Adjustable Ring For Women Gold Plated Hollow Layered Square Artificial Stone Geometric Ring Jewelry
$2.83
No MOQ
 · 
12 views
Free Shipping
Women Open Rings Copper Zircon Faux Artificial Pearl Adjustable Geometric Heart Flower Bowknot Trendy Jewelry
Women Open Rings Copper Zircon Faux Artificial Pearl Adjustable Geometric Heart Flower Bowknot Trendy Jewelry
like
Find Similar
Elegant silver double-layer open ring featuring sparkling micro-paved cubic zirconia - J008 Micro-inlaid Flower Open Ring / Silver
Adjustable silver heart-shaped opal ring featuring a delicate band and iridescent finish - J815 Heart Opal Open Ring / Silver
Double-layered open ring with delicate white pearls and minimalist silver band - J953 Double-layer Pearl Silver Ring / Silver
Elegant silver pearl ring featuring a lustrous round white pearl in a minimalist design - J924 Single Pearl Geometric Silver Ring / Silver
+22
Women Open Rings Copper Zircon Faux Artificial Pearl Adjustable Geometric Heart Flower Bowknot Trendy Jewelry
-6%
$0.37-1.30
No MOQ
 · 
88 sold recently
Free Shipping
Handmade Colorful Gemstone Beaded Ring Metal Wire Wrapped Adjustable Open Fashion Jewelry For Women Niche Style
Handmade Colorful Gemstone Beaded Ring Metal Wire Wrapped Adjustable Open Fashion Jewelry For Women Niche Style
like
Find Similar
Adjustable silver star ring with twisted rope band worn on a finger for a trendy look - Star Ring
Rainbow tourmaline beaded open ring with handmade gold wire wrap design for women - Multi-gem Open Ring
Handmade Colorful Gemstone Beaded Ring Metal Wire Wrapped Adjustable Open Fashion Jewelry For Women Niche Style
$0.21-0.68
No MOQ
 · 
276 sold recently
Free Shipping
Vintage Ganesha Stainless Steel Ring For Men Retro Elephant God Lord Ganesha Signet Ring Religious Ethnic Jewelry Gift
Vintage Ganesha Stainless Steel Ring For Men Retro Elephant God Lord Ganesha Signet Ring Religious Ethnic Jewelry Gift
like
Find Similar
Retro stainless steel Ganesha ring for men with vintage finish on black reflection - US 7 / Large
Ethnic Ganesha ring in vintage stainless steel with a high-quality mirror reflection - US 7 / Small
+10
Vintage Ganesha Stainless Steel Ring For Men Retro Elephant God Lord Ganesha Signet Ring Religious Ethnic Jewelry Gift
$3.67
No MOQ
Free Shipping
925 Sterling Silver Ring Classic Plain Band Polished Finish 2mm 4mm 6mm Width Gold Silver Ring For Men Women Minimalist Jewelry
925 Sterling Silver Ring Classic Plain Band Polished Finish 2mm 4mm 6mm Width Gold Silver Ring For Men Women Minimalist Jewelry
like
Find Similar
Polished S925 sterling silver ring with 18k gold plating in a classic band style - Gold 6mm / US Size 8
Classic 925 sterling silver ring with polished gold finish, slim band design - US Size 5 / Gold 2mm
Classic high-polished S925 sterling silver band ring with a clean flat edge design - US Size 5 / Silver 2mm
Close-up of classic polished S925 silver band ring with inner 925 engraving - US Size 8 / Silver 6mm
+131
925 Sterling Silver Ring Classic Plain Band Polished Finish 2mm 4mm 6mm Width Gold Silver Ring For Men Women Minimalist Jewelry
$14.28-25.81
No MOQ
Free Shipping
Vintage Minimalist Pear Cut Zirconia Solitaire Ring Durable Titanium Steel Water Drop Gemstone Rings For Unisex Daily Jewelry
Vintage Minimalist Pear Cut Zirconia Solitaire Ring Durable Titanium Steel Water Drop Gemstone Rings For Unisex Daily Jewelry
like
Find Similar
Elegant pear-cut gemstone ring in silver-toned stainless steel with a minimalist finish - US 7 / Retro Silver
Elegant 18K gold-plated ring featuring a large pear-cut gemstone in a four-prong setting - US 7 / Retro Gold
+14
Vintage Minimalist Pear Cut Zirconia Solitaire Ring Durable Titanium Steel Water Drop Gemstone Rings For Unisex Daily Jewelry
-5%
$3.24-3.48
No MOQ
 · 
10 views
Free Shipping
Gothic Punk Skull Head Ring For Men Titanium Steel Bone Claw Design Vintage Hip Hop Party Jewelry Heavy Metal Men Accessories
Gothic Punk Skull Head Ring For Men Titanium Steel Bone Claw Design Vintage Hip Hop Party Jewelry Heavy Metal Men Accessories
like
Find Similar
Retro hip-hop skeleton skull ring in silver and gold dual-tone stainless steel - US 7 / Gold & Silver
Gothic silver skull and skeletal hand stainless steel ring with vintage finish on black base - US 7 / Steel
Vintage gothic skeleton hand and skull open ring in antique silver finish for men - US 7 / Antique Silver
+18
Gothic Punk Skull Head Ring For Men Titanium Steel Bone Claw Design Vintage Hip Hop Party Jewelry Heavy Metal Men Accessories
-5%
$2.94-3.43
Mix MOQ : 3
Free Shipping
Vintage Wide Band Ring Alloy Dragonfly Relief Hammered Texture Blue Rhinestone Antique Silver Finish Bohemian Jewelry For Women
Vintage Wide Band Ring Alloy Dragonfly Relief Hammered Texture Blue Rhinestone Antique Silver Finish Bohemian Jewelry For Women
like
Find Similar
Vintage dragonfly silver ring with blue gemstone on textured band among green succulents - US 8 / Antique Silver
+6
Vintage Wide Band Ring Alloy Dragonfly Relief Hammered Texture Blue Rhinestone Antique Silver Finish Bohemian Jewelry For Women
-4%
$0.80
No MOQ
 · 
16 sold recently
Free Shipping
Geometric Square Ring With Gold Plated Alloy And Champagne Black Cubic Zirconia For Men Women Retro Industrial Style
Geometric Square Ring With Gold Plated Alloy And Champagne Black Cubic Zirconia For Men Women Retro Industrial Style
like
Find Similar
Retro golden ring featuring a large rectangular black gemstone and side pave diamonds - US 7 / Black Large Version
Luxury two-tone ring with orange rectangle gemstone and black and white crystals - US 12 / Champagne Large Version
Vintage men's square black gemstone ring with two-tone gold and silver band - US 11 / Black Small Version
Two-tone gold plated ring with champagne rectangular zircon and 925 silver stamp - US 8 / Champagne Small Version
+28
Geometric Square Ring With Gold Plated Alloy And Champagne Black Cubic Zirconia For Men Women Retro Industrial Style
-12%
$0.92
No MOQ
 · 
31 sold recently
Free Shipping
French Romantic Enamel Rainbow Adjustable Open Ring Copper Zirconia Inlaid Bohemian Sweet Minimalist Rings For Women Jewelry
French Romantic Enamel Rainbow Adjustable Open Ring Copper Zirconia Inlaid Bohemian Sweet Minimalist Rings For Women Jewelry
like
Find Similar
Detail of gold enamel rainbow ring with white zircons on champagne silk fabric - Adjustable Open / Gold
Macro shot of silver wave ring with colorful enamel beads and white zircons - Adjustable Open / Silver
French Romantic Enamel Rainbow Adjustable Open Ring Copper Zirconia Inlaid Bohemian Sweet Minimalist Rings For Women Jewelry
$2.20
No MOQ
Free Shipping
Minimalist Titanium Steel Ring Brushed Diagonal Grooved Band Ring For Men Women Fashion Industrial Style Jewelry Accessories
Minimalist Titanium Steel Ring Brushed Diagonal Grooved Band Ring For Men Women Fashion Industrial Style Jewelry Accessories
like
Find Similar
Minimalist brushed titanium steel ring featuring gold trim and diagonal groove textures - US 7 / Mixed Gold and Silver
Modern black and silver stainless steel ring with geometric brushed metal texture - US 7 / Two-Tone Black and Silver
+10
Minimalist Titanium Steel Ring Brushed Diagonal Grooved Band Ring For Men Women Fashion Industrial Style Jewelry Accessories
-5%
$1.49
No MOQ
Free Shipping
Vintage Gothic Punk Rings For Men Women Alloy Antique Silver Skull Dragon Eagle Claw Adjustable Open Band Finger Jewelry
Vintage Gothic Punk Rings For Men Women Alloy Antique Silver Skull Dragon Eagle Claw Adjustable Open Band Finger Jewelry
like
Find Similar
Gothic skull ring in vintage silver finish with a faceted red gemstone center - Red Gemstone Skull (R-97)
Detailed macro view of vintage feather ring with deep red evil eye stone and silver finish - Red Evil Eye (R-99)
Detailed close-up of retro silver dragon-shaped open ring with intricate hollow wings - Winged Dragon (R-95)
Detail view of vintage peacock hollow ring with antique silver finish and open band - Hollow Peacock Tail (R-94)
+12
Vintage Gothic Punk Rings For Men Women Alloy Antique Silver Skull Dragon Eagle Claw Adjustable Open Band Finger Jewelry
-4%
$0.62
No MOQ
 · 
52 sold recently
925 Sterling Silver Minimalist Irregular Wave Line Open Ring For Women Vintage Polished Geometric Adjustable Finger Ring Jewelry
925 Sterling Silver Minimalist Irregular Wave Line Open Ring For Women Vintage Polished Geometric Adjustable Finger Ring Jewelry
like
Find Similar
Minimalist S925 sterling silver ring with abstract twisted lines and polished finish - Adjustable Open / Silver (JZB038)
New925 Sterling Silver Minimalist Irregular Wave Line Open Ring For Women Vintage Polished Geometric Adjustable Finger Ring Jewelry
-13%
$26.63
No MOQ
Free Shipping
Vintage Stainless Steel Compass Ring For Men Women Eight Pointed Star Nautical Poseidon Polished Two Tone Band Jewelry
Vintage Stainless Steel Compass Ring For Men Women Eight Pointed Star Nautical Poseidon Polished Two Tone Band Jewelry
like
Find Similar
Men's vintage titanium steel compass ring with zircon star design on white background - US 7 / Steel
Vintage stainless steel compass ring with gold star and engraved nautical directions - US 7 / Two-tone (Gold & Silver)
+10
Vintage Stainless Steel Compass Ring For Men Women Eight Pointed Star Nautical Poseidon Polished Two Tone Band Jewelry
$3.41-3.93
No MOQ
Free Shipping
Men's Retro Gothic Stainless Steel Sword Ring Punk Style Cross Animal Relief Vintage Gold Silver Tone Jewelry Finger Ring
Men's Retro Gothic Stainless Steel Sword Ring Punk Style Cross Animal Relief Vintage Gold Silver Tone Jewelry Finger Ring
like
Find Similar
Retro stainless steel sword ring for men with vintage gothic aesthetic and textured details - US 7 / Steel
Retro golden sword shield ring for men with beast head relief and sunburst pattern - US 7 / Gold
+12
Men's Retro Gothic Stainless Steel Sword Ring Punk Style Cross Animal Relief Vintage Gold Silver Tone Jewelry Finger Ring
$3.35-3.62
No MOQ
Free Shipping
Minimalist S925 Sterling Silver Open Rings For Women Irregular Wavy Double Layer Texture Fashion Adjustable Finger Rings Jewelry
Minimalist S925 Sterling Silver Open Rings For Women Irregular Wavy Double Layer Texture Fashion Adjustable Finger Rings Jewelry
like
Find Similar
Detailed close-up of a silver-colored wide layered ring with linear texture on fabric - Wide Version
Macro view of multi-layer S925 sterling silver streamlined ring on elegant background - Narrow Version
Minimalist S925 Sterling Silver Open Rings For Women Irregular Wavy Double Layer Texture Fashion Adjustable Finger Rings Jewelry
$35.76-38.67
No MOQ
Free Shipping
Titanium Steel Leaf Pattern Ring Unisex Polished Nature Texture Band Ring For Sports Outdoor Casual Fashion Jewelry Gift
Titanium Steel Leaf Pattern Ring Unisex Polished Nature Texture Band Ring For Sports Outdoor Casual Fashion Jewelry Gift
like
Find Similar
Detail of matte black ring with emerald green background and leaf texture inlay - US 6 / Black/Black Leaf
Macro shot of gold stainless steel ring featuring blue glitter inlay and olive leaf texture - US 6 / Gold/Gold Leaf
Close-up of black stainless steel ring with natural green leaf pattern inlay detail - US 6 / Black/Green Leaf
Close-up of titanium steel ring featuring green leaf texture inlay and silver finish - US 6 / Silver/Green Leaf
+28
Titanium Steel Leaf Pattern Ring Unisex Polished Nature Texture Band Ring For Sports Outdoor Casual Fashion Jewelry Gift
$0.76-0.79
No MOQ
Punk Men Titanium Steel Wide Band Ring Oval Artificial Cat Eye Stone Geometric Signet Ring Exaggerated Turquoise Pattern Ring Jewelry
Punk Men Titanium Steel Wide Band Ring Oval Artificial Cat Eye Stone Geometric Signet Ring Exaggerated Turquoise Pattern Ring Jewelry
like
Find Similar
Close-up of wide silver band ring featuring a large oval translucent white cat eye stone - US 7 / Silver Tone White Stone
Macro detail of a wide band silver ring featuring a large oval blue cat's eye stone inlay - US 7 / Steel Color Blue Gemstone
Macro shot of silver wide-band ring featuring an oval flat-top turquoise with mesh texture - US 7 / Steel Blue Turquoise
Mens silver signet ring with large oval white turquoise stone on black mirror surface - US 7 / Steel White Turquoise
+101
Punk Men Titanium Steel Wide Band Ring Oval Artificial Cat Eye Stone Geometric Signet Ring Exaggerated Turquoise Pattern Ring Jewelry
$3.14-3.67
Mix MOQ : 3
Free Shipping
S925 Sterling Silver Infinite Love Couple Rings For Women Men Heart Zirconia Adjustable Open Rings Valentine's Day Jewelry Gift
S925 Sterling Silver Infinite Love Couple Rings For Women Men Heart Zirconia Adjustable Open Rings Valentine's Day Jewelry Gift
like
Find Similar
S925 sterling silver couple ring set with pink heart stone and adjustable open design - Adjustable Open / Men's And Women's Rings
Elegant S925 sterling silver infinity knot open ring for women in polished silver finish - Adjustable Open / Male Style
S925 silver adjustable open ring featuring a pink heart-shaped stone for women - Adjustable Open / Female Style
S925 Sterling Silver Infinite Love Couple Rings For Women Men Heart Zirconia Adjustable Open Rings Valentine's Day Jewelry Gift
-14%
$9.69-20.17
No MOQ
Free Shipping
Retro Stainless Steel Wolf Head Ring For Men Viking Punk Animal Design Oxidized Silver Antique Finish Biker Jewelry Gift
Retro Stainless Steel Wolf Head Ring For Men Viking Punk Animal Design Oxidized Silver Antique Finish Biker Jewelry Gift
like
Find Similar
7 options
Retro Stainless Steel Wolf Head Ring For Men Viking Punk Animal Design Oxidized Silver Antique Finish Biker Jewelry Gift
$3.35
No MOQ
 · 
10 sold recently
Free Shipping
Korean Minimalist S925 Sterling Silver Brushed Adjustable Open Ring For Women Vintage Niche Design Geometric Texture Finger Ring
Korean Minimalist S925 Sterling Silver Brushed Adjustable Open Ring For Women Vintage Niche Design Geometric Texture Finger Ring
like
Find Similar
Minimalist S925 sterling silver open ring featuring a vintage brushed matte finish texture - Minimalist Brushed Style(JZA156) / Adjustable Open
Korean Minimalist S925 Sterling Silver Brushed Adjustable Open Ring For Women Vintage Niche Design Geometric Texture Finger Ring
-9%
$34.58
No MOQ
Free Shipping
S925 Sterling Silver Hollow Heart Open Rings For Women Simple Niche Sweet Romantic Peach Heart Stacking Jewelry For Dating
S925 Sterling Silver Hollow Heart Open Rings For Women Simple Niche Sweet Romantic Peach Heart Stacking Jewelry For Dating
like
Find Similar
Elegant S925 sterling silver hollow heart open ring on a wooden jewelry display tray - Adjustable Open / Hollow Large Heart Style (D553)
Elegant S925 sterling silver open ring featuring a minimalist hollow heart pattern design - Adjustable Open / Row Heart Style (D584)
S925 Sterling Silver Hollow Heart Open Rings For Women Simple Niche Sweet Romantic Peach Heart Stacking Jewelry For Dating
$7.20-9.96
No MOQ
Free Shipping
Punk Stainless Steel Revolver Signet Ring For Men Vintage Biker Hip Hop 3D Pistol Relief Jewelry Gold Silver Ring
Punk Stainless Steel Revolver Signet Ring For Men Vintage Biker Hip Hop 3D Pistol Relief Jewelry Gold Silver Ring
like
Find Similar
Men's vintage steel square ring with a silver finish and revolver pistol relief pattern - US 7 / Steel
Gold men's punk ring featuring a black honeycomb background and revolver relief design - US 7 / Gold
+12
Punk Stainless Steel Revolver Signet Ring For Men Vintage Biker Hip Hop 3D Pistol Relief Jewelry Gold Silver Ring
$2.85-3.11
No MOQ
Free Shipping
Vintage Artistic Female Body Sculpture Ring For Men Titanium Steel Punk Rock Distressed Matte Silver Sculpted Finger Ring Jewelry
Vintage Artistic Female Body Sculpture Ring For Men Titanium Steel Punk Rock Distressed Matte Silver Sculpted Finger Ring Jewelry
like
Find Similar
6 options
Vintage Artistic Female Body Sculpture Ring For Men Titanium Steel Punk Rock Distressed Matte Silver Sculpted Finger Ring Jewelry
-4%
$3.19
No MOQ
Free Shipping
Vintage Men Stainless Steel Celtic Knot Signet Ring Black Enamel Inlay Punk Gothic Industrial Style Ring Jewelry For Him
Vintage Men Stainless Steel Celtic Knot Signet Ring Black Enamel Inlay Punk Gothic Industrial Style Ring Jewelry For Him
like
Find Similar
Retro men's stainless steel signet ring with black enamel inlay and engraved details - US 7 / Steel
+6
Vintage Men Stainless Steel Celtic Knot Signet Ring Black Enamel Inlay Punk Gothic Industrial Style Ring Jewelry For Him
-5%
$3.61
No MOQ
Free Shipping
Gothic Punk Butterfly Spider Heart Cross Rings Alloy Rhinestone Red Enamel Jewelry Dark Aesthetic Vintage For Women
Gothic Punk Butterfly Spider Heart Cross Rings Alloy Rhinestone Red Enamel Jewelry Dark Aesthetic Vintage For Women
like
Find Similar
Claw-style silver ring with pear-cut deep red gemstones and textured finish - Red Cat Paw Style (J478)
Silver rings set featuring deep red heart gemstones and irregular molten texture on hand - Red Textured Gem (J477)
Silver gothic spider ring featuring a large red gemstone and white zircon accents - Red Spider Style (J479)
Gothic liquid metal ring in silver finish with red enamel heart detail on finger - Red Oil Drip Cross (J475)
+6
Gothic Punk Butterfly Spider Heart Cross Rings Alloy Rhinestone Red Enamel Jewelry Dark Aesthetic Vintage For Women
$0.18-1.14
No MOQ
 · 
69 sold recently
Men Personalized Titanium Steel Thorns Vine Ring Hollow Branch Woven Texture Punk Gothic Polished Ring For Men Women Jewelry
Men Personalized Titanium Steel Thorns Vine Ring Hollow Branch Woven Texture Punk Gothic Polished Ring For Men Women Jewelry
like
Find Similar
Close-up of golden thorn vine woven ring showing polished hollow design details - US 7 / Gold
Matte black stainless steel ring with hollow thorn vine design and gothic branch texture - US 7 / Black
Detailed close-up of a silver thorn vine ring featuring intricate hollow woven design - US 7 / Steel
+18
Men Personalized Titanium Steel Thorns Vine Ring Hollow Branch Woven Texture Punk Gothic Polished Ring For Men Women Jewelry
-4%
$2.74-3.11
No MOQ
Free Shipping
Hip Hop Titanium Steel Gold Plated Indian Chief Ring For Men Rhinestone Inlaid Punk Ethnic Style Signet Finger Ring Jewelry
Hip Hop Titanium Steel Gold Plated Indian Chief Ring For Men Rhinestone Inlaid Punk Ethnic Style Signet Finger Ring Jewelry
like
Find Similar
Mens iced out Native American Indian Chief ring in silver tone with white crystals - US 7 / Steel
Gold plated hip hop ring featuring a detailed Indian chief head with sparkling crystals - US 7 / Gold
+12
Hip Hop Titanium Steel Gold Plated Indian Chief Ring For Men Rhinestone Inlaid Punk Ethnic Style Signet Finger Ring Jewelry
$3.01-3.27
No MOQ
Free Shipping
S925 Sterling Silver Minimalist Smooth Thin Band Ring For Women Dainty Stackable Plain Finger Ring Gold Silver Plated Jewelry Gift
S925 Sterling Silver Minimalist Smooth Thin Band Ring For Women Dainty Stackable Plain Finger Ring Gold Silver Plated Jewelry Gift
like
Find Similar
Minimalist S925 sterling silver thin band ring with polished finish and S925 hallmark - US Size 3.5 / Silver
Minimalist S925 sterling silver ultra-thin stacking ring with 18K gold plated finish - US Size 3.5 / Gold
+12
S925 Sterling Silver Minimalist Smooth Thin Band Ring For Women Dainty Stackable Plain Finger Ring Gold Silver Plated Jewelry Gift
$6.90
No MOQ
Free Shipping
Vintage Moonstone Ring Retro Metal Carved Pattern Bohemian Ethnic Jewelry For Men And Women
Vintage Moonstone Ring Retro Metal Carved Pattern Bohemian Ethnic Jewelry For Men And Women
like
Find Similar
Retro moonstone wide band ring with silver branch design and gold accents - US 5 / Branch Moonstone-AJZ117XS
Macro shot of oval moonstone ring featuring vintage angel relief carving on silver band - US 5 / Angel Moonstone-AJZ2320XS
+11
Vintage Moonstone Ring Retro Metal Carved Pattern Bohemian Ethnic Jewelry For Men And Women
$0.92-1.00
No MOQ
 · 
57 sold recently
Free Shipping
Gothic Stainless Steel Skull Claw Evil Eye Ring Men Vintage Punk Rock Biker Jewelry Retro Silver Blue Grey Eyeball Finger Ring
Gothic Stainless Steel Skull Claw Evil Eye Ring Men Vintage Punk Rock Biker Jewelry Retro Silver Blue Grey Eyeball Finger Ring
like
Find Similar
Gothic silver beast claw ring with a blue demon eye pupil for men in retro punk style - US Size 7 / Grey Rope With Evil Eye
Gothic punk men's silver claw ring featuring a detailed blue eyeball centerpiece - US Size 7 / Blue Eye
+7
Gothic Stainless Steel Skull Claw Evil Eye Ring Men Vintage Punk Rock Biker Jewelry Retro Silver Blue Grey Eyeball Finger Ring
$3.88
No MOQ
Free Shipping
Vintage Stainless Steel Flower Open Ring Gold Plated Rhinestone Inlaid Adjustable Floral Ring For Women Individual Jewelry
Vintage Stainless Steel Flower Open Ring Gold Plated Rhinestone Inlaid Adjustable Floral Ring For Women Individual Jewelry
like
Find Similar
Gold stainless steel floral open ring featuring blue turquoise bead and embossed flowers - Blue Inlaid Style (R-0054)
Adjustable golden flower ring with pearl inlay and radial brushed metal texture - White Inlaid Style (R-0054)
Adjustable gold stainless steel ring featuring 3D floral designs with red center stones - Red Inlaid Style (R-0054)
Macro detail of adjustable gold flower ring with matte finish and black center inlay - Black Inlaid Style (R-0054)
Vintage Stainless Steel Flower Open Ring Gold Plated Rhinestone Inlaid Adjustable Floral Ring For Women Individual Jewelry
-49%
$1.00
Mix MOQ : 2
Free Shipping
Vintage Stainless Steel Men Signet Ring Hip Hop Pentagram Enamel Confederate Flag Motif Polished Scale Texture Finger Ring
Vintage Stainless Steel Men Signet Ring Hip Hop Pentagram Enamel Confederate Flag Motif Polished Scale Texture Finger Ring
like
Find Similar
Polished stainless steel ring with red blue enamel star pattern and scale texture - US 7 / Steel
+6
Vintage Stainless Steel Men Signet Ring Hip Hop Pentagram Enamel Confederate Flag Motif Polished Scale Texture Finger Ring
$3.41
No MOQ
Free Shipping
Vintage Dragon Head Titanium Steel Ring For Men Gothic Punk Hip Hop Ring With Red Black Rhinestone Inlaid Masculine Jewelry
Vintage Dragon Head Titanium Steel Ring For Men Gothic Punk Hip Hop Ring With Red Black Rhinestone Inlaid Masculine Jewelry
like
Find Similar
Retro dragon head ring in titanium steel featuring a large red crystal gemstone - US 7 / Steel Red Zircon
Vintage dragon head stainless steel ring for men featuring a black gemstone and scales - US 7 / Steel Color Black Zircon
+12
Vintage Dragon Head Titanium Steel Ring For Men Gothic Punk Hip Hop Ring With Red Black Rhinestone Inlaid Masculine Jewelry
-4%
$5.03
Mix MOQ : 3
Free Shipping
Vintage Butterfly Flower Enamel Ring Gold Plated Open Adjustable Jewelry Accessory For Women Gift
Vintage Butterfly Flower Enamel Ring Gold Plated Open Adjustable Jewelry Accessory For Women Gift
like
Find Similar
Detailed macro shot of a gold butterfly ring with teal enamel and red rhinestones - Red Diamond Green Butterfly
Elegant gold butterfly ring with pearl and fan-shaped shell detail on hand - Pink Pearl Fan
Golden butterfly open ring with white mother-of-pearl wings and small crystals - MOP Butterfly
Gold open butterfly ring with cow print faux nails and elegant brushed metal finish - Gold 3-Stone
+66
Vintage Butterfly Flower Enamel Ring Gold Plated Open Adjustable Jewelry Accessory For Women Gift
-5%
$0.87-1.12
No MOQ
 · 
119 sold recently
Free Shipping
Vintage Stainless Steel Tiger Head Ring For Men Domineering Punk Rock Animal Signet Ring Gold Silver Color Biker Jewelry
Vintage Stainless Steel Tiger Head Ring For Men Domineering Punk Rock Animal Signet Ring Gold Silver Color Biker Jewelry
like
Find Similar
Retro tiger head ring in vintage silver stainless steel with detailed textures on white background - US 7 / Steel / 【product Attributes】this Product Is A 【tiger Head Ring】 Featuring A 【retro Silver】 Finish. The Surface Has Undergone A Fine 【blackened And Aged】 Process Making The Tiger's Fur Texture Eyes And Roaring Mouth Details More Three-dimensional And Lifelike. The Material Appears To Be 【alloy Or Stainless Steel】 Possessing A Strong Rugged Metallic Texture. 【visual Presentation】the Image Was Photographed Against A Standard E-commerce 【pure White Background】 With A Centered Composition And A Natural 【mirror Reflection】 At The Bottom. Image Quality Is 【high】 With Precise Focus And Crystal-clear Metallic Details. Aesthetic Appeal Is 【medium】 With An Overall Score Of 【7.5】. The Main Issue Is The Overly Conventional Presentation Method; While Clear It Lacks Brand Identity And Visual Impact. 【text Content】the Entire Image Contains No Printed Text Overlaid Text Or Brand Logos. 【logistics Labels】none. 【infringement Risk】product Infringement: None; Background Infringement: None. This Design Uses Common Biological Motifs And Does Not Exhibit Any Specific Brand Copyright Characteristics. 【product Parameters】tiger Head Design Retro Silver Finish.
Gold titanium steel tiger head ring for men with detailed roaring tiger face and fur texture - US 7 / Gold
+12
Vintage Stainless Steel Tiger Head Ring For Men Domineering Punk Rock Animal Signet Ring Gold Silver Color Biker Jewelry
$3.27-3.54
No MOQ
Free Shipping
Bohemian Copper Rings For Women Colorful Enamel Moon Star Adjustable Open Finger Ring Zirconia Vintage Jewelry Gift
Bohemian Copper Rings For Women Colorful Enamel Moon Star Adjustable Open Finger Ring Zirconia Vintage Jewelry Gift
like
Find Similar
Adjustable 18K gold plated ring with red enamel celestial moon and star pattern - Adjustable Open / Red Enamel Style (10427)
Detailed macro view of 18K gold star and moon ring with blue enamel and colorful zircons - Adjustable Open / Blue Enamel Style (10428)
Bohemian Copper Rings For Women Colorful Enamel Moon Star Adjustable Open Finger Ring Zirconia Vintage Jewelry Gift
$1.57
No MOQ
Free Shipping
Vintage Stainless Steel Carved Wizard Ring For Men Distressed Gothic Punk Biker Finger Ring Mythological Hooded Figure Jewelry
Vintage Stainless Steel Carved Wizard Ring For Men Distressed Gothic Punk Biker Finger Ring Mythological Hooded Figure Jewelry
like
Find Similar
Gothic Gandalf Wizard Ring with Nordic Wolf and Feather Details in Antique Silver Finish - US 7 / Wizard Head Style
+5
Vintage Stainless Steel Carved Wizard Ring For Men Distressed Gothic Punk Biker Finger Ring Mythological Hooded Figure Jewelry
-4%
$2.99
No MOQ
Free Shipping
Retro Oval Gemstone Signet Ring For Women 304 Stainless Steel Gold Plated Artificial Stone Maillard Style Fashion Jewelry
Retro Oval Gemstone Signet Ring For Women 304 Stainless Steel Gold Plated Artificial Stone Maillard Style Fashion Jewelry
like
Find Similar
Vintage gold-plated signet ring with a large oval turquoise stone and mineral texture - US 7 / Gold-Green Turquoise Texture (1)
Retro gold stainless steel signet ring featuring a marble textured oval stone inlay - US 7 / Gold-Colorful Marble Texture (2)
Vintage gold plated stainless steel ring with oval green marble stone and geometric facets - US 7 / Gold-Dark Green Marble Texture (3)
Vintage gold chunky ring featuring a large oval blue sea stone with wave patterns - US 7 / Gold-Ocean Blue Texture (4)
+80
Retro Oval Gemstone Signet Ring For Women 304 Stainless Steel Gold Plated Artificial Stone Maillard Style Fashion Jewelry
$4.19-4.45
No MOQ
 · 
11 views
Free Shipping
Minimalist 304 Stainless Steel Heart Enamel Drip Oil Open Ring Adjustable Geometric Niche Finger Jewelry Gift For Women
Minimalist 304 Stainless Steel Heart Enamel Drip Oil Open Ring Adjustable Geometric Niche Finger Jewelry Gift For Women
like
Find Similar
Detailed view of silver stainless steel ring with black enamel heart motifs and dimensions - Silver Ring + Black Heart (J638-S-B)
Detail of 304 stainless steel gold heart ring with white enamel and product dimensions - Gold Ring + White Heart (J638-G-W)
Detailed view of golden heart ring with size markings 0.5cm width and 1.7cm diameter - Gold Ring + Black Heart (J638-G-B)
Minimalist 304 Stainless Steel Heart Enamel Drip Oil Open Ring Adjustable Geometric Niche Finger Jewelry Gift For Women
$0.78-1.05
No MOQ
Free Shipping
Vintage Spartan Helmet Ring Stainless Steel Warrior Mask Punk Hip Hop Biker Jewelry For Men Women Party Cool Ring
Vintage Spartan Helmet Ring Stainless Steel Warrior Mask Punk Hip Hop Biker Jewelry For Men Women Party Cool Ring
like
Find Similar
Spartan warrior helmet ring in polished stainless steel for punk hip hop style - US 8 / Silver
Golden Spartan helmet mask ring for men in punk hip-hop style stainless steel finish - US 8 / Gold
+8
Vintage Spartan Helmet Ring Stainless Steel Warrior Mask Punk Hip Hop Biker Jewelry For Men Women Party Cool Ring
$3.67
Mix MOQ : 2
Free Shipping
Vintage Alloy Serpent Feather Open Ring For Men Women Antique Silver Rhinestone Red Eye Adjustable Gothic Punk Accessory
Vintage Alloy Serpent Feather Open Ring For Men Women Antique Silver Rhinestone Red Eye Adjustable Gothic Punk Accessory
like
Find Similar
Vintage snake ring with red gemstone and scales pattern in antique silver finish - Serpent Feather Open Style (Ring-266) / Silver
Vintage Alloy Serpent Feather Open Ring For Men Women Antique Silver Rhinestone Red Eye Adjustable Gothic Punk Accessory
$0.73
Mix MOQ : 2
Vintage Alloy Feather Open Ring For Men Women Retro Adjustable Silver Color Street Fashion Jewelry Punk Style Finger Ring
Vintage Alloy Feather Open Ring For Men Women Retro Adjustable Silver Color Street Fashion Jewelry Punk Style Finger Ring
like
Find Similar
Vintage silver feather ring with detailed texture measuring 25mm high and 14mm wide - Silver
Vintage Alloy Feather Open Ring For Men Women Retro Adjustable Silver Color Street Fashion Jewelry Punk Style Finger Ring
$0.73
Mix MOQ : 2
Free Shipping
Trendy Alloy Multi-layer Spiral Branch Statement Ring With Faux Artificial Pearl Fashion Geometric Exaggerated Jewelry For Women
Trendy Alloy Multi-layer Spiral Branch Statement Ring With Faux Artificial Pearl Fashion Geometric Exaggerated Jewelry For Women
like
Find Similar
Detailed view of a multi-layer gold branch ring featuring six elegant white pearls - One Size / Gold
Silver geometric organic branch ring with white pearls in a modern creative design - One Size / Silver
Spiral gold ring with six purple pearls and minimalist metallic bead accents - One Size / Purple
Fashion gold layered wire ring featuring elegant dark red pearls in a spiral design - One Size / Red
+6
Trendy Alloy Multi-layer Spiral Branch Statement Ring With Faux Artificial Pearl Fashion Geometric Exaggerated Jewelry For Women
$0.73
No MOQ
 · 
54 sold recently
Free Shipping
925 Sterling Silver Zirconia Ring Niche Design Korean Minimalist Geometric Open Ring For Women Fashion Jewelry Accessories
925 Sterling Silver Zirconia Ring Niche Design Korean Minimalist Geometric Open Ring For Women Fashion Jewelry Accessories
like
Find Similar
Minimalist S925 sterling silver ring featuring baguette-cut zircon stones on a wooden box - 14# / Silver Influencer Style (JZH121)
925 Sterling Silver Zirconia Ring Niche Design Korean Minimalist Geometric Open Ring For Women Fashion Jewelry Accessories
-12%
$14.68
No MOQ
Free Shipping
S925 Sterling Silver Evil Eye Ring Marquise Blue Zirconia Adjustable Open Ring Minimalist Jewelry For Women Original Design
S925 Sterling Silver Evil Eye Ring Marquise Blue Zirconia Adjustable Open Ring Minimalist Jewelry For Women Original Design
like
Find Similar
S925 sterling silver open ring with marquise-cut blue evil eye stone centerpiece - Adjustable Open / Blue
S925 Sterling Silver Evil Eye Ring Marquise Blue Zirconia Adjustable Open Ring Minimalist Jewelry For Women Original Design
-4%
$12.78
No MOQ
Free Shipping
Men Stainless Steel Punk Thorns Ring Vintage Gothic Hollow Out Hip Hop Jewelry Retro Thistle Biker Finger Ring Accessory
Men Stainless Steel Punk Thorns Ring Vintage Gothic Hollow Out Hip Hop Jewelry Retro Thistle Biker Finger Ring Accessory
like
Find Similar
Punk style stainless steel thorn ring with dimensions 23mm width and 14mm height - US 7 / Silver
+6
NewMen Stainless Steel Punk Thorns Ring Vintage Gothic Hollow Out Hip Hop Jewelry Retro Thistle Biker Finger Ring Accessory
$3.22
Mix MOQ : 3
Free Shipping
Double Sided Rotatable Natural Mother Of Pearl Abalone Shell Brass Gold Plated Niche Design Fashion Jewelry Ring For Women Men
Double Sided Rotatable Natural Mother Of Pearl Abalone Shell Brass Gold Plated Niche Design Fashion Jewelry Ring For Women Men
like
Find Similar
Minimalist double-sided rotating gold ring with white shell and colorful abalone shell inlay - US 6 / Gold
Double Sided Rotatable Natural Mother Of Pearl Abalone Shell Brass Gold Plated Niche Design Fashion Jewelry Ring For Women Men
-5%
$8.71
No MOQ
 · 
67 sold recently
Free Shipping
Stainless Steel Flower Ring Colorful Dopamine Crystal Resin Adjustable Open Finger Ring For Women Light Luxury Jewelry
Stainless Steel Flower Ring Colorful Dopamine Crystal Resin Adjustable Open Finger Ring For Women Light Luxury Jewelry
like
Find Similar
Detailed close-up of a colorful floral ring with a gold adjustable band on a display stand - Five-Color Flower Cluster Style (S-R832)
Detail of colorful resin flower ring with matte petals and adjustable gold band - Colorful Frosted Petal Style (S-R833)
Macro detail of colorful flower ring with crystal core and golden petal edges - Painted Gold-Rimmed 3D Flower Style (S-R834)
Detail of colorful crystal flower ring with pear-cut petals and adjustable gold band - Multi-Color Faceted Crystal Flower Style (S-R835)
Stainless Steel Flower Ring Colorful Dopamine Crystal Resin Adjustable Open Finger Ring For Women Light Luxury Jewelry
$1.83-2.31
No MOQ
Free Shipping
S925 Sterling Silver Chain Ring Vintage Minimalist Korean Design Matte Finish Finger Ring For Women Fashion Jewelry
S925 Sterling Silver Chain Ring Vintage Minimalist Korean Design Matte Finish Finger Ring For Women Fashion Jewelry
like
Find Similar
Three-piece S925 sterling silver chain ring set with vintage matte finish on knit fabric - US 13 / Vintage Chain Band Ring (JZC068)
S925 Sterling Silver Chain Ring Vintage Minimalist Korean Design Matte Finish Finger Ring For Women Fashion Jewelry
-12%
$19.91-21.16
No MOQ
Free Shipping
Men's Punk Titanium Steel Number 13 Ring Retro Brushed Black Gold Silver Color Signet Band Ring Hip Hop Jewelry Gift
Men's Punk Titanium Steel Number 13 Ring Retro Brushed Black Gold Silver Color Signet Band Ring Hip Hop Jewelry Gift
like
Find Similar
Vintage stainless steel punk ring for men featuring an engraved number 13 square face - US 7 / Steel
Close-up of a gold punk ring with an engraved number 13 on a flat square surface - US 7 / Gold
Men's punk style black matte titanium steel ring with number 13 embossed on square top - US 7 / Black
+21
Men's Punk Titanium Steel Number 13 Ring Retro Brushed Black Gold Silver Color Signet Band Ring Hip Hop Jewelry Gift
-4%
$2.74-2.99
No MOQ
Free Shipping
304 Stainless Steel Square Base Adjustable Open Ring 18K Gold Silver Plated DIY Jewelry Making Handmade Ring Findings Accessory
304 Stainless Steel Square Base Adjustable Open Ring 18K Gold Silver Plated DIY Jewelry Making Handmade Ring Findings Accessory
like
Find Similar
Detailed size specifications for square stainless steel ring base with dimensions and weight - Silver
Macro detail of adjustable square ring base for DIY crafts with precise measurements - Gold
304 Stainless Steel Square Base Adjustable Open Ring 18K Gold Silver Plated DIY Jewelry Making Handmade Ring Findings Accessory
$0.24-0.42
Mix MOQ : 2
Free Shipping
Go to

More in jewelry

Lab-Created Gemstone Jewelry

Explore more in toe rings

openfoot jewelryfingersimplewhiteplasticinlaiddesignbodyplated stainless steel
footgold platedsteelartificialpolishedgirlsgold plated adjustableturquoise18k gold platedcolor ring

Ready to source like an insider

Get a direct line to the factory floor — no minimums, no middlemen, no guesswork.
iconReal factory pricing, no markup in betweeniconEvery order hand-inspected before it shipsicon5,000+ new products added daily
Get Inside Access