Everful

Wholesale suction cups

Factory-direct selection, vetted for quality and ready to order.

Sign Up
Suction Cups

Find the perfect pieces: home decor, kitchen & dining, arts, crafts & sewing and more

All products in suction cups

filterShow Filters
Best Seller
New Arrivals
Price Drop
Free Shipping
Hawaiian Theme LED Luminous Party Glasses Tropical Summer Beach Pineapple Flamingo Decorative Holiday Photo Prop Eyewear
Hawaiian Theme LED Luminous Party Glasses Tropical Summer Beach Pineapple Flamingo Decorative Holiday Photo Prop Eyewear
like
Find Similar
Detail showing dimensions and LED controls of a Summer-themed party glasses frame - Coconut Juice Watermelon
Detail of LED Hawaii party glasses with Hello Summer motif and size dimensions - Hello Summer Surfboard
Detail view of Hawaiian party glasses with Hello Summer text and tropical bird design - Toucan Palm Leaf
Detail view of Hawaiian party LED glasses with flamingo and summer time design specifications - Summer Time Flamingo
+6
Hawaiian Theme LED Luminous Party Glasses Tropical Summer Beach Pineapple Flamingo Decorative Holiday Photo Prop Eyewear
-4%
$1.15
Mix MOQ : 2
Magnetic Phone Grip Stand For Magsafe Round Expanding Folding Acrylic Gradient Color Decorative Portable Holder
Magnetic Phone Grip Stand For Magsafe Round Expanding Folding Acrylic Gradient Color Decorative Portable Holder
like
Find Similar
Detail of a minimalist MagSafe phone grip on a light grey case with floral background - Magnetic Stand / Gradient Gray Black - Solid
Detail of magnetic phone case with transparent orange resin socket holding solid balm - Magnetic Stand / Gradient Orange Yellow - Solid
Detail of a pastel purple magnetic phone grip installed on a white smartphone - Magnetic Stand / Gradient Purple - Solid
Macro shot of colorful laser gradient collapsible phone grip with white daisy decoration - Magnetic Stand / Gradient Blue - Solid
+6
Magnetic Phone Grip Stand For Magsafe Round Expanding Folding Acrylic Gradient Color Decorative Portable Holder
-9%
$2.10
Mix MOQ : 2
Free Shipping
Ocean Theme Party Glasses Shark Seahorse Crab Glitter Eyewear For Birthday Summer Sea Party Costume Photo Props For Kids
Ocean Theme Party Glasses Shark Seahorse Crab Glitter Eyewear For Birthday Summer Sea Party Costume Photo Props For Kids
like
Find Similar
Novelty shark party glasses for ocean theme kids birthday with size 19.5x13.5cm - Black Shark Style
Ocean theme party glasses with turtle design and 'Cool' felt patch for birthday fun - Sea Turtle Oxygen Mask Style
Felt ocean party glasses featuring blue shark and orange surfboard with dimensions - Shark Surfboard Style
Blue glitter seahorse party glasses for kids with size dimensions 17.3cm x 8.5cm - Sea Horse Style
+2
Ocean Theme Party Glasses Shark Seahorse Crab Glitter Eyewear For Birthday Summer Sea Party Costume Photo Props For Kids
-4%
$0.43-0.80
Mix MOQ : 2
Kitchen Utensils Wall Sticker Retro Hand Drawn PVC Waterproof Oil Proof Self Adhesive Decorative Decal For Dining Room Home Decor
Kitchen Utensils Wall Sticker Retro Hand Drawn PVC Waterproof Oil Proof Self Adhesive Decorative Decal For Dining Room Home Decor
like
Find Similar
Self-adhesive kitchen wall sticker with spice jars and layout size 90x30cm - Kitchen Utensils / Standard Layout
Kitchen Utensils Wall Sticker Retro Hand Drawn PVC Waterproof Oil Proof Self Adhesive Decorative Decal For Dining Room Home Decor
$1.44
Mix MOQ : 4
Outdoor Camping Adventure Stickers Waterproof PVC Decals For Laptop Water Bottle Scrapbooking Nature Starry Sky Travel Theme
Outdoor Camping Adventure Stickers Waterproof PVC Decals For Laptop Water Bottle Scrapbooking Nature Starry Sky Travel Theme
like
Find Similar
50pcs outdoor camping stickers featuring starry sky adventure designs for laptops - Outdoor Camping Theme Style (T01040691)
Outdoor Camping Adventure Stickers Waterproof PVC Decals For Laptop Water Bottle Scrapbooking Nature Starry Sky Travel Theme
$0.86
Mix MOQ : 2
Galaxy Colorful Animal Illustration Stickers Oil Painting Art Decals For Suitcase Journal Phone Case Stationery Decor
Galaxy Colorful Animal Illustration Stickers Oil Painting Art Decals For Suitcase Journal Phone Case Stationery Decor
like
Find Similar
Collection of 60 colorful animal art stickers in impressionist oil painting style for decor - Animal Oil Painting Illustration Series (OPQ299)
Galaxy Colorful Animal Illustration Stickers Oil Painting Art Decals For Suitcase Journal Phone Case Stationery Decor
$1.27
No MOQ
 · 
11 views
Glitter Artificial Pearl Button Phone Pop Socket Grip Expandable Stand Resin Simple Shiny Smartphone Holder Aesthetic
Glitter Artificial Pearl Button Phone Pop Socket Grip Expandable Stand Resin Simple Shiny Smartphone Holder Aesthetic
like
Find Similar
Macro shot of white pearlescent 4-hole button on faux fur texture detail - Pearlescent White
Macro shot of glittery resin button phone grip with sparkling pink glitter textures - Pearlescent Orange
Close-up of pink glitter button phone grip on brown faux fur background - Pearlescent Pink
Detail of yellow pearlescent button phone grip with shiny glitter resin texture - Pearlescent Yellow
+7
Glitter Artificial Pearl Button Phone Pop Socket Grip Expandable Stand Resin Simple Shiny Smartphone Holder Aesthetic
-8%
$0.92
No MOQ
Gravity Automatic Open Close Oil Dispenser Bottle Borosilicate Glass Leak-proof Wide Mouth Japanese Style Kitchen Cruet Container
Gravity Automatic Open Close Oil Dispenser Bottle Borosilicate Glass Leak-proof Wide Mouth Japanese Style Kitchen Cruet Container
like
Find Similar
Black gravity glass oil dispenser bottle, 550ml automatic flip lid kitchen container - 550ml / Black
+4
Gravity Automatic Open Close Oil Dispenser Bottle Borosilicate Glass Leak-proof Wide Mouth Japanese Style Kitchen Cruet Container
-4%
$9.86
Mix MOQ : 2
 · 
10 sold recently
Cute Bear Head Phone Grip Collapsible Stand Adhesive Metal Plated Griptok Universal Smartphone Desktop Support Accessory
Cute Bear Head Phone Grip Collapsible Stand Adhesive Metal Plated Griptok Universal Smartphone Desktop Support Accessory
like
Find Similar
Close-up of a matte grey bear phone socket holder on white textured surface - Polished Bear Head / Silver Gray
Close-up of cute cream bear phone socket grip on a soft aesthetic background - Polished Bear Head / Gold
Cute Bear Head Phone Grip Collapsible Stand Adhesive Metal Plated Griptok Universal Smartphone Desktop Support Accessory
-9%
$0.73
No MOQ
Rainbow Suncatcher Window Stickers Prism Static Cling PVC Bee Flower Decals For Glass Home Decor Office Bedroom Decor
Rainbow Suncatcher Window Stickers Prism Static Cling PVC Bee Flower Decals For Glass Home Decor Office Bedroom Decor
like
Find Similar
Holographic flower and bee wall sticker set with sheet and finish size dimensions - 30x41cm Style 1 (HY-J013)
Sheet size and layout details for holographic bee and flower prism window decals - 30x41cm Style 2 (HY-J014)
Rainbow Suncatcher Window Stickers Prism Static Cling PVC Bee Flower Decals For Glass Home Decor Office Bedroom Decor
$1.59
No MOQ
Funny Cartoon Smiley Face Refrigerator Sticker Waterproof PVC Kitchen Wall Decal With Coffee Cup Pattern For Home Decor
Funny Cartoon Smiley Face Refrigerator Sticker Waterproof PVC Kitchen Wall Decal With Coffee Cup Pattern For Home Decor
like
Find Similar
Funny smiley face wall decal for fridge decoration with layout size and paste effect - Blinking Tongue Smiley Style (HMFX2015D)
Funny Cartoon Smiley Face Refrigerator Sticker Waterproof PVC Kitchen Wall Decal With Coffee Cup Pattern For Home Decor
$0.78
Mix MOQ : 5
Modern Coffee Butterfly Welcome To Our Home Wall Sticker PVC Self Adhesive Waterproof Kitchen Restaurant Art Mural Decor
Modern Coffee Butterfly Welcome To Our Home Wall Sticker PVC Self Adhesive Waterproof Kitchen Restaurant Art Mural Decor
like
Find Similar
Black Coffee Welcome home wall sticker with butterflies and coffee cup layout size - Coffee Butterfly - Welcome Home (60x30cm)
NewModern Coffee Butterfly Welcome To Our Home Wall Sticker PVC Self Adhesive Waterproof Kitchen Restaurant Art Mural Decor
$1.21
Mix MOQ : 4
3D Cartoon Squirrel Car Window Sticker Cute Animal PVC Decal Self-Adhesive UV Printing Wall Decor For Bathroom Vehicle Glass
3D Cartoon Squirrel Car Window Sticker Cute Animal PVC Decal Self-Adhesive UV Printing Wall Decor For Bathroom Vehicle Glass
like
Find Similar
Detailed sheet and finish dimensions for cute cartoon squirrel decorative wall sticker - 15*16cm (fun-f663 UV Transparent)
3D Cartoon Squirrel Car Window Sticker Cute Animal PVC Decal Self-Adhesive UV Printing Wall Decor For Bathroom Vehicle Glass
$0.81
No MOQ
Waterproof Colorful Alphabet Stickers Cartoon DIY Name Labels For Water Bottle Lunch Box Vinyl Letter Decals
Waterproof Colorful Alphabet Stickers Cartoon DIY Name Labels For Water Bottle Lunch Box Vinyl Letter Decals
like
Find Similar
Colorful macaron alphabet stickers for DIY water bottles with dimensions 136x186mm - Colorful Alphabet Basic Version
Waterproof Colorful Alphabet Stickers Cartoon DIY Name Labels For Water Bottle Lunch Box Vinyl Letter Decals
$2.07-4.15
No MOQ
Wall Mounted Chopstick Holder With Dustproof Lid PP Plastic Kitchen Utensil Drainage Storage Box Spoon Fork Rack No Drill
Wall Mounted Chopstick Holder With Dustproof Lid PP Plastic Kitchen Utensil Drainage Storage Box Spoon Fork Rack No Drill
like
Find Similar
Pink plastic cutlery holder with dust-proof lid and ventilation for kitchen storage - Pink
Grey wall-mounted plastic utensil holder with dustproof cover and drainage holes - Gray
Beige plastic chopstick holder with lid, featuring wooden utensils and drainage design - Apricot
Wall Mounted Chopstick Holder With Dustproof Lid PP Plastic Kitchen Utensil Drainage Storage Box Spoon Fork Rack No Drill
$0.58
Mix MOQ : 2
 · 
11 views
Leather Star Phone Grip Stand With Cartoon Eyes Smile Embossed Pattern Korean Style Portable Desk Griptok Bracket
Leather Star Phone Grip Stand With Cartoon Eyes Smile Embossed Pattern Korean Style Portable Desk Griptok Bracket
like
Find Similar
Detail of star-shaped faux leather phone socket with eyes, smile text and lychee texture - Leather Star Eyes Style / White
Deep blue star-shaped leather phone grip with big eyes and Smile text detail - Leather Star Eyes Style / Sapphire Blue
Pink star-shaped leather phone grip with cartoon eyes and Smile engraving on white desk - Leather Star Eyes Style / Pink
Detail of star-shaped leather phone grip with cute eye pattern and Smile engraving - Leather Star Eyes Style / Black
+12
Leather Star Phone Grip Stand With Cartoon Eyes Smile Embossed Pattern Korean Style Portable Desk Griptok Bracket
-9%
$0.68
No MOQ
Large Capacity Sports Water Bottle PC Plastic Leakproof With Tea Filter Portable Handle For Outdoor Fitness Gym
Large Capacity Sports Water Bottle PC Plastic Leakproof With Tea Filter Portable Handle For Outdoor Fitness Gym
like
Find Similar
Purple frosted sports water bottle placed on fitness equipment in a gym setting - 800ML / Matte Purple
800ml clear green portable sports water bottle with handle for outdoor fitness - 800ML / Fresh Green
1000ml green plastic sports water bottle with tea infuser for fitness and outdoor use - 1000ml / Fresh Green
Detail of 1.5L fresh green sports water bottle with tea infuser and leak-proof cap - 1500ml / Fresh Green
+6
Large Capacity Sports Water Bottle PC Plastic Leakproof With Tea Filter Portable Handle For Outdoor Fitness Gym
$3.03-3.46
No MOQ
 · 
12 views
Vintage Outdoor Camping Adventure Sticker Collection Waterproof PVC Decals For Laptop Luggage Car Bumper Travel Decoration
Vintage Outdoor Camping Adventure Sticker Collection Waterproof PVC Decals For Laptop Luggage Car Bumper Travel Decoration
like
Find Similar
Set of 48 vintage outdoor camping stickers featuring mountains, tents and wild adventure themes - Outdoor Camping Theme (WES002)
Vintage Outdoor Camping Adventure Sticker Collection Waterproof PVC Decals For Laptop Luggage Car Bumper Travel Decoration
$0.95
No MOQ
Watercolor Kingfisher Birds And Flowers Window Clings PVC Static Decor Stickers For Glass Window Living Room Bedroom Home Decoration
Watercolor Kingfisher Birds And Flowers Window Clings PVC Static Decor Stickers For Glass Window Living Room Bedroom Home Decoration
like
Find Similar
Colorful bird and flower wall stickers with product receive and finish size details - Single Sheet
Watercolor Kingfisher Birds And Flowers Window Clings PVC Static Decor Stickers For Glass Window Living Room Bedroom Home Decoration
$1.70
Mix MOQ : 2
Modern Acrylic Mirror Wall Stickers Square Round Corner DIY Reflective Decals For Home Living Room Bedroom Decorative Wall Art
Modern Acrylic Mirror Wall Stickers Square Round Corner DIY Reflective Decals For Home Living Room Bedroom Decorative Wall Art
like
Find Similar
Five-piece square acrylic mirror wall stickers set for modern living room home decoration - Silver
Set of 5 square yellow acrylic mirror wall stickers for creative living room decoration - Gold
5-piece set of blue square acrylic mirror wall stickers for creative living room decor - Blue
Detail of red square acrylic mirror wall stickers showing clear reflection on living room wall - Red
+1
Modern Acrylic Mirror Wall Stickers Square Round Corner DIY Reflective Decals For Home Living Room Bedroom Decorative Wall Art
-12%
$0.91
No MOQ
Butterfly Phone Ring Holder Stand Zinc Alloy Acrylic Colorful Rotating Foldable Universal Cellphone Grip Kickstand
Butterfly Phone Ring Holder Stand Zinc Alloy Acrylic Colorful Rotating Foldable Universal Cellphone Grip Kickstand
like
Find Similar
Detailed macro view of colorful butterfly phone ring holder with rotatable metal stand - Painted Butterfly 01
Detail of butterfly-shaped acrylic phone ring holder with green and purple gradient wing patterns - Painted Butterfly 02
Close-up of pink and white butterfly phone ring holder with a rose gold metal stand - Painted Butterfly 03
Detail of artistic butterfly phone ring holder with colorful patterns and metal kickstand - Painted Butterfly 04
+6
Butterfly Phone Ring Holder Stand Zinc Alloy Acrylic Colorful Rotating Foldable Universal Cellphone Grip Kickstand
-14%
$0.59
No MOQ
 · 
158 sold recently
Bear Shaped Phone Grip Tok Glitter Sequins Transparent Resin 3D Animal Retractable Desktop Stand For Smart Phones
Bear Shaped Phone Grip Tok Glitter Sequins Transparent Resin 3D Animal Retractable Desktop Stand For Smart Phones
like
Find Similar
Detailed view of glitter bear phone grip stand with shimmering resin texture and sequins - Colored Polka Dots Bear
Macro shot of 3D bear phone grip with black and white glitter in clear resin finish - Black and White Glitter Bear
Close-up of a bear-shaped phone grip filled with colorful confetti on a clean white desk - Colorful Black and White Bear
Bear Shaped Phone Grip Tok Glitter Sequins Transparent Resin 3D Animal Retractable Desktop Stand For Smart Phones
-8%
$1.05
No MOQ
Cool Colorful Rainbow Drip Graffiti Stickers Mixed Waterproof Decorative Stickers For Laptop Phone Scrapbook Journaling
Cool Colorful Rainbow Drip Graffiti Stickers Mixed Waterproof Decorative Stickers For Laptop Phone Scrapbook Journaling
like
Find Similar
56-piece colorful rainbow graffiti stickers with cool drip effect for phone and journals - Colorful Graffiti Style (T01043084)
Cool Colorful Rainbow Drip Graffiti Stickers Mixed Waterproof Decorative Stickers For Laptop Phone Scrapbook Journaling
$0.86
Mix MOQ : 2
Cute Cartoon Girl Dress Up Stickers DIY Decorative Decals For Phone Case Tablet Scrapbooking Educational Character Toys
Cute Cartoon Girl Dress Up Stickers DIY Decorative Decals For Phone Case Tablet Scrapbooking Educational Character Toys
like
Find Similar
Set of original cartoon girl dress-up stickers for DIY phone cases and tablet decoration - Cartoon Girl Dress Up Stickers (8ZD042)
Cute Cartoon Girl Dress Up Stickers DIY Decorative Decals For Phone Case Tablet Scrapbooking Educational Character Toys
$0.86
No MOQ
Pink Green Witch Stickers Gothic Magic Aesthetic PVC Waterproof Decals For Laptop Guitar Luggage DIY Decoration Accessory
Pink Green Witch Stickers Gothic Magic Aesthetic PVC Waterproof Decals For Laptop Guitar Luggage DIY Decoration Accessory
like
Find Similar
100pcs pink and green cartoon witch stickers for laptop and guitar decoration - Pink Green Witch Style
Pink Green Witch Stickers Gothic Magic Aesthetic PVC Waterproof Decals For Laptop Guitar Luggage DIY Decoration Accessory
$2.48
No MOQ
Free Shipping
Cartoon Little Yellow Duck Pond Play Window Sticker Static Cling PVC Glass Decal For Bedroom Living Room Home Decoration
Cartoon Little Yellow Duck Pond Play Window Sticker Static Cling PVC Glass Decal For Bedroom Living Room Home Decoration
like
Find Similar
Detail view of cartoon yellow duck glass sticker showing dimensions 14.9 by 11.9 inches - Cartoon Duck Pond Play (JDT-A368)
Cartoon Little Yellow Duck Pond Play Window Sticker Static Cling PVC Glass Decal For Bedroom Living Room Home Decoration
$0.86
No MOQ
3D Cartoon Bear Phone Socket Griptok Iridescent Electroplated Resin Retractable Phone Holder Desktop Stand Kawaii
3D Cartoon Bear Phone Socket Griptok Iridescent Electroplated Resin Retractable Phone Holder Desktop Stand Kawaii
like
Find Similar
Gummy bear phone grip with holographic orange aurora finish and retractable base - Electroplated Yellow (Gold)
3D transparent green bear folding grip stand with high-gloss jelly resin finish - Electroplated Black
Translucent orange iridescent teddy bear collapsible grip stand for smartphones - Electroplated Orange
Red iridescent bear pop socket phone grip with gradient rainbow finish on brown card - Electroplated Red
+1
3D Cartoon Bear Phone Socket Griptok Iridescent Electroplated Resin Retractable Phone Holder Desktop Stand Kawaii
-9%
$0.86
No MOQ
Magnetic Adhesive Mobile Phone Airbag Stand Retractable Plastic Colorful Good Luck Lettering Grip Holder Universal
Magnetic Adhesive Mobile Phone Airbag Stand Retractable Plastic Colorful Good Luck Lettering Grip Holder Universal
like
Find Similar
Macro view of a round transparent magnetic phone socket with red Good Luck text on a desk - goodluck Magnetic - Adhesive Top / White
Top view of a round yellow Good Luck adhesive phone grip base on a clean white office desk - goodluck Magnetic - Adhesive Top / Orange
Pink circular MagSafe phone stand with Good Luck text shown next to a laptop - goodluck Magnetic - Adhesive Top / Pink
Detail of DIY magnetic phone grip with Good Luck text on a clean desktop with laptop - goodluck Magnetic - Adhesive Top / Black
+7
Magnetic Adhesive Mobile Phone Airbag Stand Retractable Plastic Colorful Good Luck Lettering Grip Holder Universal
-9%
$1.39
No MOQ
Free Shipping
Gothic Mystery Stickers Black White Line Art Vinyl Decals For Laptop Skateboard Luggage Water Bottle Phone Waterproof Decoration
Gothic Mystery Stickers Black White Line Art Vinyl Decals For Laptop Skateboard Luggage Water Bottle Phone Waterproof Decoration
like
Find Similar
Set of 50 black and white Gothic stickers featuring mystical animals and nature designs - Gothic Black and White Style
Gothic Mystery Stickers Black White Line Art Vinyl Decals For Laptop Skateboard Luggage Water Bottle Phone Waterproof Decoration
$0.95
No MOQ
Watercolor Bird Flower Butterfly Nest Static Window Cling Removable PVC Sticker Decal For Glass Living Room Home Decor
Watercolor Bird Flower Butterfly Nest Static Window Cling Removable PVC Sticker Decal For Glass Living Room Home Decor
like
Find Similar
Detailed sheet of watercolor flower and bird wall stickers with size measurements - 30x38cm
NewWatercolor Bird Flower Butterfly Nest Static Window Cling Removable PVC Sticker Decal For Glass Living Room Home Decor
$1.44
No MOQ
Romantic Heart Valentine Stickers For Wedding Gift Decoration Love Couple Rose Cupid Waterproof Vinyl Decal For Laptop Water Bottle Helmet
Romantic Heart Valentine Stickers For Wedding Gift Decoration Love Couple Rose Cupid Waterproof Vinyl Decal For Laptop Water Bottle Helmet
like
Find Similar
50pcs romantic Valentine's Day stickers with hearts, cupid, and roses for gift decoration - Valentine's Day Series (T01042210)
Romantic Heart Valentine Stickers For Wedding Gift Decoration Love Couple Rose Cupid Waterproof Vinyl Decal For Laptop Water Bottle Helmet
$0.86
Mix MOQ : 2
Strawberry Phone Socket 3D Fruit Shape Retractable Stand Resin Foldable Grip Tok Desktop Holder Cute Gradient Ins Style
Strawberry Phone Socket 3D Fruit Shape Retractable Stand Resin Foldable Grip Tok Desktop Holder Cute Gradient Ins Style
like
Find Similar
Close-up of a light green 3D strawberry phone grip with realistic textured seed details - Light Green (Baiyu)
Macro shot of 3D minimalist white strawberry phone grip with realistic seed texture detail - White (White Pearl)
Macro shot of 3D strawberry phone grip featuring realistic gradient and bumpy texture - Pink White Gradient (First Love)
Detailed macro view of 3D pink strawberry phone grip with realistic textured seed finish - Pink Gradient (Light Snow)
+5
NewStrawberry Phone Socket 3D Fruit Shape Retractable Stand Resin Foldable Grip Tok Desktop Holder Cute Gradient Ins Style
-9%
$1.00
No MOQ
50Pcs Retro Showgirl Stickers Pack PVC Waterproof Orange Graffiti Decorative Decals For Laptop Guitar Suitcase Stationery Decor
50Pcs Retro Showgirl Stickers Pack PVC Waterproof Orange Graffiti Decorative Decals For Laptop Guitar Suitcase Stationery Decor
like
Find Similar
Detailed grid view of 50 orange retro style showgirl and music era themed vinyl stickers - Orange (50 Sheets/Pack)
50Pcs Retro Showgirl Stickers Pack PVC Waterproof Orange Graffiti Decorative Decals For Laptop Guitar Suitcase Stationery Decor
$0.86
No MOQ
Cute Cartoon Dog Bathroom Toilet Lid Sticker Waterproof PVC Mural Decal For Glass Mirror Wall Decor Removable Bathroom Ornament
Cute Cartoon Dog Bathroom Toilet Lid Sticker Waterproof PVC Mural Decal For Glass Mirror Wall Decor Removable Bathroom Ornament
like
Find Similar
Cartoon dog on toilet static sticker for bathroom decor, 20x29cm waterproof PVC decal - Using Phone / Static Cling No Glue
Cartoon dog toilet lid sticker sitting with phone design for bathroom decor, 20x29cm - Using Phone / Self-Adhesive Backing
Cute cartoon puppy on heart pillow static sticker decal for glass and mirrors, 11x7 inch - Flower Pillow / Static Cling No Glue
Cartoon golden retriever dog wall sticker with pink flowers and cloud background decor - Flower Pillow / Self-Adhesive Backing
+2
Cute Cartoon Dog Bathroom Toilet Lid Sticker Waterproof PVC Mural Decal For Glass Mirror Wall Decor Removable Bathroom Ornament
$0.86
No MOQ
Y2K Girlhood Pink Theme Graffiti Stickers Waterproof PVC Decorative Decals For Guitar Laptop Luggage Scrapbooking DIY Stickers
Y2K Girlhood Pink Theme Graffiti Stickers Waterproof PVC Decorative Decals For Guitar Laptop Luggage Scrapbooking DIY Stickers
like
Find Similar
Set of 50 Y2K pink girlhood waterproof stickers for laptops and guitar decoration - Y2K Girlhood Style (YCK114)
Y2K Girlhood Pink Theme Graffiti Stickers Waterproof PVC Decorative Decals For Guitar Laptop Luggage Scrapbooking DIY Stickers
$0.98
No MOQ
Magnetic Phone Griptok Stand Retractable Resin Rhinestone Faux Artificial Pearl Korean Ins Style Cute Expanding Socket Support For Women
Magnetic Phone Griptok Stand Retractable Resin Rhinestone Faux Artificial Pearl Korean Ins Style Cute Expanding Socket Support For Women
like
Find Similar
Detail of magnetic phone grip with pearl, rhinestone, and marble shell design - Retro Green Series - Green Speckled Square
Detail shot of magnetic phone grip with pink resin gems and pearl decoration - Retro Pink Series - Bean Paste Pink Square
Macro detail of magnetic phone grip with resin pearls and purple stones in ins style - Retro Pink Series - Pink Bean Paste
Detail of magnetic Griptok with gemstone, pearl and rhinestone on a phone holder - Retro Pink Series - Pink Yellow Speckled
+3
Magnetic Phone Griptok Stand Retractable Resin Rhinestone Faux Artificial Pearl Korean Ins Style Cute Expanding Socket Support For Women
-9%
$2.10
No MOQ
Free Shipping
Cute Cartoon Journal Stickers DIY Scrapbooking Album Water Cup Decoration Waterproof PVC Decorative Stickers For Kids Students
Cute Cartoon Journal Stickers DIY Scrapbooking Album Water Cup Decoration Waterproof PVC Decorative Stickers For Kids Students
like
Find Similar
65pcs cute cartoon stickers set for DIY journals and planners on light blue background - Xuanxuan Entries
Cute Cartoon Journal Stickers DIY Scrapbooking Album Water Cup Decoration Waterproof PVC Decorative Stickers For Kids Students
-4%
$0.69
No MOQ
Cute Cartoon Squirrel Waterproof PVC Stickers Animal Decals For DIY Laptop Luggage Skateboard Journaling Decoration
Cute Cartoon Squirrel Waterproof PVC Stickers Animal Decals For DIY Laptop Luggage Skateboard Journaling Decoration
like
Find Similar
50 pieces of cute waterproof squirrel stickers for DIY scrapbooking and luggage decoration - Original Squirrel Set (SJS086)
Cute Cartoon Squirrel Waterproof PVC Stickers Animal Decals For DIY Laptop Luggage Skateboard Journaling Decoration
$0.96
No MOQ
Heart Shaped Phone Stand Retractable Airbag Grip Griptok With Miniature Beer Bottle Models Transparent Resin Creative Cute
Heart Shaped Phone Stand Retractable Airbag Grip Griptok With Miniature Beer Bottle Models Transparent Resin Creative Cute
like
Find Similar
Set of mini beer bottle phone grips and beverage models in a heart tray for desk - Clear Base Beer Beverage
Heart-shaped phone grip with miniature beer and soju bottle charms inside - Yellow Base Beer Beverage
Heart Shaped Phone Stand Retractable Airbag Grip Griptok With Miniature Beer Bottle Models Transparent Resin Creative Cute
-8%
$0.84
No MOQ
Waterproof Transparent PET Butterfly Stickers For Scrapbooking Journaling DIY Arts Crafts Decorative Aesthetic Decals
Waterproof Transparent PET Butterfly Stickers For Scrapbooking Journaling DIY Arts Crafts Decorative Aesthetic Decals
like
Find Similar
50 pieces of colorful transparent PET butterfly stickers for journals and scrapbooks - Orange
Detailed close-up of colorful vintage butterfly stickers with intricate wing patterns - Purple
Close-up of 50 vintage colorful butterfly stickers with intricate watercolor textures - Blue
Waterproof Transparent PET Butterfly Stickers For Scrapbooking Journaling DIY Arts Crafts Decorative Aesthetic Decals
-10%
$0.93
No MOQ
Neon Skeleton Stickers Purple Aesthetic Cartoon Skull Stickers For Laptop Water Bottle Skateboard Gothic Heart Decoration Stickers
Neon Skeleton Stickers Purple Aesthetic Cartoon Skull Stickers For Laptop Water Bottle Skateboard Gothic Heart Decoration Stickers
like
Find Similar
Neon purple skull stickers pack with creative cartoon professions and heart shapes - Neon Skeleton Style (T01043255)
Neon Skeleton Stickers Purple Aesthetic Cartoon Skull Stickers For Laptop Water Bottle Skateboard Gothic Heart Decoration Stickers
$0.86
Mix MOQ : 2
3D Mirror Acrylic Coffee Cup Wall Sticker Heart Pattern Self Adhesive DIY Decal For Kitchen Dining Room Coffee Shop Decor
3D Mirror Acrylic Coffee Cup Wall Sticker Heart Pattern Self Adhesive DIY Decal For Kitchen Dining Room Coffee Shop Decor
like
Find Similar
Modern 3D acrylic mirror coffee cup wall stickers set with heart patterns in silver finish - Silver
Golden 3D mirror coffee cup wall stickers for kitchen and cafe wall decoration - Gold
3D red acrylic mirror wall stickers with coffee cup and heart designs for cafe decor - Red
Detail of blue acrylic mirror wall stickers showing coffee cup shape with heart and steam - Blue
+1
3D Mirror Acrylic Coffee Cup Wall Sticker Heart Pattern Self Adhesive DIY Decal For Kitchen Dining Room Coffee Shop Decor
-5%
$1.26
No MOQ
Retro Video Game Pixel Art Stickers Y2K Neon Waterproof Decorative Stickers For Laptop Water Bottle Scrapbooking Collection
Retro Video Game Pixel Art Stickers Y2K Neon Waterproof Decorative Stickers For Laptop Water Bottle Scrapbooking Collection
like
Find Similar
Set of 50 retro Y2K pixel art stickers featuring gaming icons and neon vintage gadgets - Retro Pixel Art Sticker Pack (RXHY0067)
NewRetro Video Game Pixel Art Stickers Y2K Neon Waterproof Decorative Stickers For Laptop Water Bottle Scrapbooking Collection
$0.86
Mix MOQ : 5
Cartoon Round Cell Phone Grip Tok Expandable Stand Holder For Desk Cute Clear Acrylic Telescopic Phone Support
Cartoon Round Cell Phone Grip Tok Expandable Stand Holder For Desk Cute Clear Acrylic Telescopic Phone Support
like
Find Similar
Detail of round yellow phone grip featuring a cute cartoon fried egg on a white surface - White Base Stand / Egg Yolk Expression
Detail of round phone socket with cute cartoon girl and yellow RICH text on a phone - White Base Stand / Rich Girl
Detail shot of a round phone grip featuring a cute potato chips packet design on a tray - White Base Stand / Potato Chips
+3
Cartoon Round Cell Phone Grip Tok Expandable Stand Holder For Desk Cute Clear Acrylic Telescopic Phone Support
-9%
$0.42-0.50
No MOQ
Halloween Static Window Clings Ghost Bat Pumpkin Gnomes Double Sided Halloween Window Decorations For Glass Windows Home Decor
Halloween Static Window Clings Ghost Bat Pumpkin Gnomes Double Sided Halloween Window Decorations For Glass Windows Home Decor
like
Find Similar
Halloween window decals set including ghosts, bats, and pumpkins with dimensions specs - 20x30cm
Halloween Static Window Clings Ghost Bat Pumpkin Gnomes Double Sided Halloween Window Decorations For Glass Windows Home Decor
$1.70
Mix MOQ : 2
Bear Phone Grip Holder Transparent Resin With Gold Foil Flakes Cartoon Expandable Griptok Cute Stand For Smartphone
Bear Phone Grip Holder Transparent Resin With Gold Foil Flakes Cartoon Expandable Griptok Cute Stand For Smartphone
like
Find Similar
Close-up of transparent bear phone grip with decorative gold foil flakes on white surface - White (Gold Foil Transparent Bear)
Detail of blue transparent bear phone grip with gold foil sequins on a desk - Royal Blue (Gold Foil Transparent Bear)
Detailed macro view of amber resin bear phone grip with decorative gold foil flakes - Orange (Gold Foil Transparent Bear)
Pink translucent bear phone grip with gold foil details and resin sparkle aesthetic - Pink (Gold Foil Transparent Bear)
+9
Bear Phone Grip Holder Transparent Resin With Gold Foil Flakes Cartoon Expandable Griptok Cute Stand For Smartphone
-9%
$0.76
No MOQ
3D Bear Mobile Phone Grip Telescopic Magnetic Resin Colorful Glitter Cute Cartoon Desktop Stand For Women Girls
3D Bear Mobile Phone Grip Telescopic Magnetic Resin Colorful Glitter Cute Cartoon Desktop Stand For Women Girls
like
Find Similar
Close-up of a translucent glitter bear phone grip with decorative purple flower accent - Transparent Air Cushion Version / Pink
Detailed view of yellow glitter bear magnetic phone grip on a white ceramic tray - Transparent Air Cushion Version / Yellow
Detail of glittery bear phone grip with magnetic base on a white ceramic plate - Transparent Air Cushion Version / Blue
Magnetic glitter bear phone socket holder in mint green and light blue resin finish - Transparent Air Cushion Version / Green
+8
3D Bear Mobile Phone Grip Telescopic Magnetic Resin Colorful Glitter Cute Cartoon Desktop Stand For Women Girls
-9%
$1.05-1.96
No MOQ
Waterproof Vinyl Dance Theme Stickers For Laptop Skateboard Luggage Guitar Ballet Modern Dance Music Scrapbooking Decor
Waterproof Vinyl Dance Theme Stickers For Laptop Skateboard Luggage Guitar Ballet Modern Dance Music Scrapbooking Decor
like
Find Similar
50pcs dance themed waterproof stickers for guitar laptop and skateboard decoration - Dance Theme
Waterproof Vinyl Dance Theme Stickers For Laptop Skateboard Luggage Guitar Ballet Modern Dance Music Scrapbooking Decor
$0.95
Mix MOQ : 2
Stainless Steel Vacuum Insulated Tumbler Eggshell Shape Double Wall Coffee Mug With Lid For Home Office Outdoor Travel
Stainless Steel Vacuum Insulated Tumbler Eggshell Shape Double Wall Coffee Mug With Lid For Home Office Outdoor Travel
like
Find Similar
12oz insulated stainless steel wine tumbler egg cup in original silver metal finish - 12oz / Original Steel Color (Without Lid)
12oz double-walled stainless steel tumbler wine cup with realistic wood grain finish - 12oz / Wood Grain Teak Brown
12oz insulated stainless steel egg-shaped wine tumbler with realistic wood grain finish - 12oz / Wood Grain White Wood
Insulated 12oz blue water-patterned stainless steel wine tumbler egg cup with clear lid - 12oz / Wood Grain Blue Water Drop
+5
Stainless Steel Vacuum Insulated Tumbler Eggshell Shape Double Wall Coffee Mug With Lid For Home Office Outdoor Travel
$2.59-4.61
No MOQ
Heart Shaped Phone Grip Griptok With Resin Gummy Bears Glitter Expandable Socket Bracket For Smartphone Kawaii Candy Color Ins Style
Heart Shaped Phone Grip Griptok With Resin Gummy Bears Glitter Expandable Socket Bracket For Smartphone Kawaii Candy Color Ins Style
like
Find Similar
Macro detail of heart-shaped glitter phone grip with colorful resin bear charms - Rainbow Bear-Orange
Close-up of glittery heart phone grip with colorful gummy bear decorations - Rainbow Bear-Blue
Detail of heart-shaped glitter phone grip featuring four colorful gummy bear decorations - Rainbow Bear-Red
Heart Shaped Phone Grip Griptok With Resin Gummy Bears Glitter Expandable Socket Bracket For Smartphone Kawaii Candy Color Ins Style
-9%
$0.89
No MOQ
Dreamy Heart Rose Scrapbooking Stickers Waterproof PVC Y2K Aesthetic Holographic Laser Decals For Phone Case DIY Decor
Dreamy Heart Rose Scrapbooking Stickers Waterproof PVC Y2K Aesthetic Holographic Laser Decals For Phone Case DIY Decor
like
Find Similar
60 PCS Y2K holographic crystal heart stickers for DIY guitar and laptop decoration - Holographic Rose Heart Style
Dreamy Heart Rose Scrapbooking Stickers Waterproof PVC Y2K Aesthetic Holographic Laser Decals For Phone Case DIY Decor
$0.86
No MOQ
Waterproof Ins Style Flower Glass Bottle Stickers For Phone Case Laptop Water Bottle Scrapbooking Decorative Decals
Waterproof Ins Style Flower Glass Bottle Stickers For Phone Case Laptop Water Bottle Scrapbooking Decorative Decals
like
Find Similar
50 pieces of waterproof watercolor flower stickers in glass bottles for laptop and luggage - Flower Glass Bottle Stickers (PMS225)
Waterproof Ins Style Flower Glass Bottle Stickers For Phone Case Laptop Water Bottle Scrapbooking Decorative Decals
$0.96
No MOQ
Cloud Shaped Expanding Phone Grip Stand Iridescent Pearlescent Resin Adhesive Collapsible Finger Holder Desktop Support
Cloud Shaped Expanding Phone Grip Stand Iridescent Pearlescent Resin Adhesive Collapsible Finger Holder Desktop Support
like
Find Similar
Pink iridescent cloud-shaped retractable phone grip holder for desk, minimalist style - Cloud Stand / Ice Silk Pink
Cloud shaped mother of pearl phone grip with iridescent finish on a silk background - Cloud Stand / Ice Silk White
Cloud Shaped Expanding Phone Grip Stand Iridescent Pearlescent Resin Adhesive Collapsible Finger Holder Desktop Support
-9%
$0.86
No MOQ
Waterproof PVC Stickers Grunge Aesthetic Decals For Laptop Suitcase Skateboard Guitar DIY Black Retro Punk Rock Stickers
Waterproof PVC Stickers Grunge Aesthetic Decals For Laptop Suitcase Skateboard Guitar DIY Black Retro Punk Rock Stickers
like
Find Similar
Set of 49 black grunge wall collage stickers with rock aesthetic and punk graphics - Default
Waterproof PVC Stickers Grunge Aesthetic Decals For Laptop Suitcase Skateboard Guitar DIY Black Retro Punk Rock Stickers
$0.98
No MOQ
Peeking Black Cat And Fish Wall Sticker PVC Waterproof Refrigerator Decal For Kitchen Fridge Door Cartoon Home Decor
Peeking Black Cat And Fish Wall Sticker PVC Waterproof Refrigerator Decal For Kitchen Fridge Door Cartoon Home Decor
like
Find Similar
Cartoon black cat wall sticker set layout size 40x30cm and paste effect 36x39cm stickers - 30x40cm
Peeking Black Cat And Fish Wall Sticker PVC Waterproof Refrigerator Decal For Kitchen Fridge Door Cartoon Home Decor
$0.98
Mix MOQ : 4
Self Love Motivational Vinyl Stickers Waterproof Matte Positive Quotes Decals For Laptop Water Bottle Suitcase Journaling Decoration
Self Love Motivational Vinyl Stickers Waterproof Matte Positive Quotes Decals For Laptop Water Bottle Suitcase Journaling Decoration
like
Find Similar
50pcs self love vinyl stickers for laptops and suitcases in warm pink tones - Self Love Style
NewSelf Love Motivational Vinyl Stickers Waterproof Matte Positive Quotes Decals For Laptop Water Bottle Suitcase Journaling Decoration
$0.98
No MOQ
 · 
15 views
Bohemian Kitchen Wall Sticker PVC Waterproof Teapot Fruit Cake Pattern DIY Cabinet Removable Creative Home Decoration
Bohemian Kitchen Wall Sticker PVC Waterproof Teapot Fruit Cake Pattern DIY Cabinet Removable Creative Home Decoration
like
Find Similar
DIY tea cup and fruit wall decals with Persian style teapot and citrus patterns - 30*60CM/FX-B279
Bohemian Kitchen Wall Sticker PVC Waterproof Teapot Fruit Cake Pattern DIY Cabinet Removable Creative Home Decoration
$1.21
No MOQ
Vintage Botanical Flower Stickers PVC Waterproof Decals For Scrapbooking Laptop Suitcase Journaling Floral Stamp Style Decorative Sticker Pack
Vintage Botanical Flower Stickers PVC Waterproof Decals For Scrapbooking Laptop Suitcase Journaling Floral Stamp Style Decorative Sticker Pack
like
Find Similar
50pcs vintage botanical flower doodle stickers for laptop and guitar decoration - Vintage Botanical Flower Series
Vintage Botanical Flower Stickers PVC Waterproof Decals For Scrapbooking Laptop Suitcase Journaling Floral Stamp Style Decorative Sticker Pack
$0.93
No MOQ
 · 
12 views
Vintage Furniture Waterproof PVC Stickers For Scrapbooking Laptop Luggage Guitar DIY Retro Illustration Decorative Decals
Vintage Furniture Waterproof PVC Stickers For Scrapbooking Laptop Luggage Guitar DIY Retro Illustration Decorative Decals
like
Find Similar
50pcs vintage furniture stickers for DIY luggage and laptop waterproof decorative decals - Vintage Furniture
NewVintage Furniture Waterproof PVC Stickers For Scrapbooking Laptop Luggage Guitar DIY Retro Illustration Decorative Decals
$0.98
No MOQ
Vintage Hand Gesture Resin Ashtray Creative Phone Holder Tablet Stand For Desk Office Home Decor Bronze Silver Ornament
Vintage Hand Gesture Resin Ashtray Creative Phone Holder Tablet Stand For Desk Office Home Decor Bronze Silver Ornament
like
Find Similar
Creative hand-shaped ashtray and phone holder with retro silver-black finish on wood table - Hand Ashtray (With Phone Holder) / Silver
Creative vintage bronze hand sculpture ashtray on a wooden desk in office setting - Hand Ashtray (With Phone Holder) / Bronze (Gold)
Vintage Hand Gesture Resin Ashtray Creative Phone Holder Tablet Stand For Desk Office Home Decor Bronze Silver Ornament
$5.19
Mix MOQ : 2
Go to

More in home & kitchen

Explore more in suction cups

wallplasticwindowbabystainlessadjustableholidaypartyroundstorage rack
hangingracksteelshapewarmcleaningfoothomeopenpet

Ready to source like an insider

Get a direct line to the factory floor — no minimums, no middlemen, no guesswork.
iconReal factory pricing, no markup in betweeniconEvery order hand-inspected before it shipsicon5,000+ new products added daily
Get Inside Access