Everful

Wholesale suction cups

Factory-direct selection, vetted for quality and ready to order.

Sign Up
Suction Cups

Find the perfect pieces: home decor, kitchen & dining, arts, crafts & sewing and more

All products in suction cups

filterShow Filters
Best Seller
New Arrivals
Price Drop
Free Shipping
Cute Plush Rabbit Cell Phone Socket Grip Holder Telescopic Collapsible Phone Bracket Adhesive Teddy Fleece Soft Bunny
Cute Plush Rabbit Cell Phone Socket Grip Holder Telescopic Collapsible Phone Bracket Adhesive Teddy Fleece Soft Bunny
like
Find Similar
Cute gray plush rabbit phone grip with yellow bow on white aesthetic background - Grey Rabbit (Grey)
Cute white plush bunny phone socket with pink bow and soft embroidered rabbit details - White Rabbit (White)
Yellow fluffy rabbit phone socket mount with star detail and lamb wool texture - Yellow Rabbit (Yellow)
Cute brown plush rabbit phone grip with star detail on white satin background - Brown Rabbit (Brown)
+1
Cute Plush Rabbit Cell Phone Socket Grip Holder Telescopic Collapsible Phone Bracket Adhesive Teddy Fleece Soft Bunny
-9%
$0.73
No MOQ
Waterproof Baseball Sport Graffiti Decals For Laptop Skateboard Luggage Water Bottle Phone Case Decor Gift For Fans
Waterproof Baseball Sport Graffiti Decals For Laptop Skateboard Luggage Water Bottle Phone Case Decor Gift For Fans
like
Find Similar
52-piece set of creative baseball stickers with waterproof PVC decals for skateboards - Creative Baseball Theme
Waterproof Baseball Sport Graffiti Decals For Laptop Skateboard Luggage Water Bottle Phone Case Decor Gift For Fans
$0.95
No MOQ
Cartoon Clown Graffiti Stickers Waterproof PVC Circus Joker Decals For Laptop Luggage Guitar DIY Decorative Stickers
Cartoon Clown Graffiti Stickers Waterproof PVC Circus Joker Decals For Laptop Luggage Guitar DIY Decorative Stickers
like
Find Similar
Pack of 50 colorful cartoon clown graffiti stickers for DIY laptop and guitar decor - Clown Series
Cartoon Clown Graffiti Stickers Waterproof PVC Circus Joker Decals For Laptop Luggage Guitar DIY Decorative Stickers
$0.98
No MOQ
Watercolor Birds And Butterflies Static Cling Window Stickers Tree Branch Parrot Removable Glass Decals For Home Decoration
Watercolor Birds And Butterflies Static Cling Window Stickers Tree Branch Parrot Removable Glass Decals For Home Decoration
like
Find Similar
Double-sided bird and butterfly window stickers showing layout and size measurements - Watercolor Birds And Butterflies (JDT-A335)
Watercolor Birds And Butterflies Static Cling Window Stickers Tree Branch Parrot Removable Glass Decals For Home Decoration
$1.01
No MOQ
Watercolor Flower Butterfly Window Stickers PVC Static Cling Glass Decals Removable Floral Wall Stickers For Home Decor Living Room
Watercolor Flower Butterfly Window Stickers PVC Static Cling Glass Decals Removable Floral Wall Stickers For Home Decor Living Room
like
Find Similar
Detailed size guide for watercolor butterfly floral window stickers showing 88x57cm layout - Watercolor Floral Butterfly Set (DJ015-YW)
Watercolor Flower Butterfly Window Stickers PVC Static Cling Glass Decals Removable Floral Wall Stickers For Home Decor Living Room
$3.26
Mix MOQ : 2
Glitter Heart Shaped Phone Grip Expandable Griptok Adhesive Retractable Stand Bracket For Mobile Phone Tablet
Glitter Heart Shaped Phone Grip Expandable Griptok Adhesive Retractable Stand Bracket For Mobile Phone Tablet
like
Find Similar
Close-up of heart-shaped phone grip with peach glitter finish and pearlescent texture - Pearlescent Orange
Macro shot of a light yellow heart-shaped phone grip with glitter finish on a white surface - Pearlescent Yellow
Detailed macro shot of the glittery heart-shaped phone grip surface with silver sparkles - Pearlescent White
Macro shot of green heart phone grip with glitter resin finish and pearlescent effect - Pearlescent Fruit Green
+9
Glitter Heart Shaped Phone Grip Expandable Griptok Adhesive Retractable Stand Bracket For Mobile Phone Tablet
-9%
$0.76
No MOQ
Floral Static Window Stickers Tulip Sunflower Butterfly Pattern Removable PVC Decal For Glass Door Home Decoration Living Room Bedroom
Floral Static Window Stickers Tulip Sunflower Butterfly Pattern Removable PVC Decal For Glass Door Home Decoration Living Room Bedroom
like
Find Similar
Detailed size chart for tulip and butterfly static window clings measuring 30x60cm - D20536--30*60cm*1pcs
Detail view of 30x90cm tropical leaves and birds static window sticker dimensions - Tropical Broadleaf Plant Colorful Birds Style (D20539)
Detail view of 30x90cm tropical monstera leaves window film with size dimensions - Monstera Tropical Greenery Bright Orange Flower Style (D20540)
Tropical green leaf static window stickers with palm leaves and monstera patterns - Rainforest Fern Palm Monstera Style (D20543)
+11
Floral Static Window Stickers Tulip Sunflower Butterfly Pattern Removable PVC Decal For Glass Door Home Decoration Living Room Bedroom
$1.30-2.48
Mix MOQ : 2
Waterproof Graffiti Stickers For Laptop Suitcase Skateboard Water Bottle Trendy American Street Style Decals For Teens
Waterproof Graffiti Stickers For Laptop Suitcase Skateboard Water Bottle Trendy American Street Style Decals For Teens
like
Find Similar
Set of 50 colorful waterproof street style stickers for laptops and skateboards - High Street Graffiti Style (T01041973)
Waterproof Graffiti Stickers For Laptop Suitcase Skateboard Water Bottle Trendy American Street Style Decals For Teens
$0.95
Mix MOQ : 2
Vintage Christmas PET Stickers Waterproof Transparent Hand-drawn Watercolor Decals For Scrapbooking Journal Laptop Decoration
Vintage Christmas PET Stickers Waterproof Transparent Hand-drawn Watercolor Decals For Scrapbooking Journal Laptop Decoration
like
Find Similar
Vintage Christmas PET stickers set featuring Santa, reindeer and snowman for scrapbooking - Christmas Theme
Vintage Christmas PET Stickers Waterproof Transparent Hand-drawn Watercolor Decals For Scrapbooking Journal Laptop Decoration
$1.04
No MOQ
Cute Couple Daily Cartoon Stickers Waterproof PVC Matte Decals For Journaling Phone Laptop DIY Decoration Stationery
Cute Couple Daily Cartoon Stickers Waterproof PVC Matte Decals For Journaling Phone Laptop DIY Decoration Stationery
like
Find Similar
60 pieces of waterproof cartoon couple stickers for phone cases and scrapbooks decoration - Couple Daily (SJS227)
Cute Couple Daily Cartoon Stickers Waterproof PVC Matte Decals For Journaling Phone Laptop DIY Decoration Stationery
$0.96
No MOQ
Transparent Crystal Ball Cloud Phone Grip Expandable Folding Airbag Stand Universal Mobile Phone Holder Resin Accessory
Transparent Crystal Ball Cloud Phone Grip Expandable Folding Airbag Stand Universal Mobile Phone Holder Resin Accessory
like
Find Similar
Transparent round phone socket with pink resin cloud decor on white desk background - Pink
Transparent round crystal ball phone socket with white cloud-like texture filling - White
Transparent cloud popsocket with white and blue fluffy filling for phones - Blue
Macro shot of a clear round phone grip featuring a yellow cloud resin design on a desk - Yellow
Transparent Crystal Ball Cloud Phone Grip Expandable Folding Airbag Stand Universal Mobile Phone Holder Resin Accessory
-9%
$0.89
No MOQ
 · 
17 views
Cute Red Panda Cartoon Stickers Waterproof PET Korean Style Decorative Decals For Journaling Scrapbooking DIY Phone Case
Cute Red Panda Cartoon Stickers Waterproof PET Korean Style Decorative Decals For Journaling Scrapbooking DIY Phone Case
like
Find Similar
Cute red panda sticker set with dessert motifs for scrapbooking and DIY crafts - Red Panda Style(RST017)
Cute Red Panda Cartoon Stickers Waterproof PET Korean Style Decorative Decals For Journaling Scrapbooking DIY Phone Case
$0.64
No MOQ
Kitchen Oil Proof Wall Sticker Self Adhesive Heat Resistant Transparent PVC Wallpaper Waterproof Cartoon Pattern Tile Decal For Dining Room Decoration
Kitchen Oil Proof Wall Sticker Self Adhesive Heat Resistant Transparent PVC Wallpaper Waterproof Cartoon Pattern Tile Decal For Dining Room Decoration
like
Find Similar
11 options
Kitchen Oil Proof Wall Sticker Self Adhesive Heat Resistant Transparent PVC Wallpaper Waterproof Cartoon Pattern Tile Decal For Dining Room Decoration
$1.59
No MOQ
Stainless Steel Seasoning Jar With Glass Window Adjustable Shaker Lid For Pepper Salt Spices Kitchen Storage Shaker Bottle
Stainless Steel Seasoning Jar With Glass Window Adjustable Shaker Lid For Pepper Salt Spices Kitchen Storage Shaker Bottle
like
Find Similar
1 option
Stainless Steel Seasoning Jar With Glass Window Adjustable Shaker Lid For Pepper Salt Spices Kitchen Storage Shaker Bottle
$0.42
Mix MOQ : 144
 · 
51 views
Butterfly Totem DIY Scrapbooking Stickers 8 Sheets PVC Waterproof Cartoon Elf Fairy Decals For Journal Phone Case Laptop Decoration
Butterfly Totem DIY Scrapbooking Stickers 8 Sheets PVC Waterproof Cartoon Elf Fairy Decals For Journal Phone Case Laptop Decoration
like
Find Similar
Detailed set of 8 waterproof butterfly stickers with anime girls for DIY craft scrapbooking - Default 8 Sheets/Bag
Butterfly Totem DIY Scrapbooking Stickers 8 Sheets PVC Waterproof Cartoon Elf Fairy Decals For Journal Phone Case Laptop Decoration
-9%
$0.86
No MOQ
Cartoon Pig Bacon Expression Stickers Cute Waterproof PVC Decals For DIY Scrapbook Notebook Journal Album Gift Kids Students
Cartoon Pig Bacon Expression Stickers Cute Waterproof PVC Decals For DIY Scrapbook Notebook Journal Album Gift Kids Students
like
Find Similar
66pcs cute pig bacon cartoon stickers for laptops and scrapbooks waterproof vinyl decals - Pig Bacon Expressions
NewCartoon Pig Bacon Expression Stickers Cute Waterproof PVC Decals For DIY Scrapbook Notebook Journal Album Gift Kids Students
-4%
$0.69
No MOQ
Ins Style Flower Stickers Waterproof Vinyl Floral Graffiti Decals For Laptop Luggage Motorcycle Scrapbooking Decoration DIY Aesthetic Botanical Stickers
Ins Style Flower Stickers Waterproof Vinyl Floral Graffiti Decals For Laptop Luggage Motorcycle Scrapbooking Decoration DIY Aesthetic Botanical Stickers
like
Find Similar
50pcs waterproof floral stickers set featuring sunflowers and roses for luggage and laptop - Flower Series
Ins Style Flower Stickers Waterproof Vinyl Floral Graffiti Decals For Laptop Luggage Motorcycle Scrapbooking Decoration DIY Aesthetic Botanical Stickers
$1.30
No MOQ
Acrylic Mirror Wall Sticker Modern Minimalist Self Adhesive DIY Geometric Decorative Border Strips For Home Wall Decor
Acrylic Mirror Wall Sticker Modern Minimalist Self Adhesive DIY Geometric Decorative Border Strips For Home Wall Decor
like
Find Similar
Set of 10 silver acrylic mirror wall stickers in long rectangular strips for TV background - Narrow Style / Silver
Detailed view of ten yellow mirror acrylic decorative strips with high gloss surface - Narrow Style / Gold
Detail of ten self-adhesive red acrylic mirror strips for wall and ceiling decoration - Narrow Style / Red
Detail of 10-piece black acrylic mirror wall decals showing reflective surface strips - Narrow Style / Black
+16
Acrylic Mirror Wall Sticker Modern Minimalist Self Adhesive DIY Geometric Decorative Border Strips For Home Wall Decor
-8%
$0.11-0.24
No MOQ
Halloween Cartoon Stickers Waterproof Graffiti Decals Pumpkin Ghost Bat For Water Bottle Laptop Scrapbooking DIY Decoration
Halloween Cartoon Stickers Waterproof Graffiti Decals Pumpkin Ghost Bat For Water Bottle Laptop Scrapbooking DIY Decoration
like
Find Similar
100-piece Halloween stickers pack with pumpkins, ghosts and mummies for decoration - Mixed Halloween Styles (BP-1986+1987)
Macro shot of Halloween stickers with pumpkin, skull, and ghost designs for party decoration - T01041986（50）
Detailed close-up of various waterproof Halloween stickers featuring pumpkins and ghosts - Doodle Halloween Elements Style (T01041987)
Halloween Cartoon Stickers Waterproof Graffiti Decals Pumpkin Ghost Bat For Water Bottle Laptop Scrapbooking DIY Decoration
$0.95-1.73
Mix MOQ : 5
Cute Animal Wizard Stickers Waterproof PVC Cartoon Magic Theme Decor For Laptop Scrapbook Stationery Diary Decoration Gift
Cute Animal Wizard Stickers Waterproof PVC Cartoon Magic Theme Decor For Laptop Scrapbook Stationery Diary Decoration Gift
like
Find Similar
56-piece cute cartoon animal wizard stickers with witch hats for DIY decoration - Animal Wizard Theme Style (T01042970)
Cute Animal Wizard Stickers Waterproof PVC Cartoon Magic Theme Decor For Laptop Scrapbook Stationery Diary Decoration Gift
$0.86
Mix MOQ : 2
Kawaii Bow Waterproof PVC Stickers For Laptop Guitar Luggage DIY Decorative Decals For Kids Teens Girls Scrapbooking Journal
Kawaii Bow Waterproof PVC Stickers For Laptop Guitar Luggage DIY Decorative Decals For Kids Teens Girls Scrapbooking Journal
like
Find Similar
50 pieces of waterproof cartoon bow stickers for DIY laptops and luggage in macaron colors - Bow Styles Collection
Kawaii Bow Waterproof PVC Stickers For Laptop Guitar Luggage DIY Decorative Decals For Kids Teens Girls Scrapbooking Journal
$0.98
No MOQ
50Pcs Be Kind Motivational Stickers Waterproof PVC Graffiti Decals For Laptop Suitcase Water Bottle Scrapbooking Decoration
50Pcs Be Kind Motivational Stickers Waterproof PVC Graffiti Decals For Laptop Suitcase Water Bottle Scrapbooking Decoration
like
Find Similar
Set of 50 colorful Be Kind inspirational stickers for laptops, water bottles and luggage - Kindness Theme Set (50 Sheets)
50Pcs Be Kind Motivational Stickers Waterproof PVC Graffiti Decals For Laptop Suitcase Water Bottle Scrapbooking Decoration
$0.96
No MOQ
Floral Butterfly Dragonfly Static Cling Window Sticker Removable PVC Decorative Decal For Glass Door Refrigerator Home Decor
Floral Butterfly Dragonfly Static Cling Window Sticker Removable PVC Decorative Decal For Glass Door Refrigerator Home Decor
like
Find Similar
Watercolor blue floral wall stickers with butterflies and dragonflies in 30x60cm size - Blue Flowers (KSJ-13)
Floral Butterfly Dragonfly Static Cling Window Sticker Removable PVC Decorative Decal For Glass Door Refrigerator Home Decor
-4%
$1.07
No MOQ
Waterproof Transparent PET Firework Stickers Multicolor Watercolor Decorative Decals For Journal Scrapbooking Laptop Guitar
Waterproof Transparent PET Firework Stickers Multicolor Watercolor Decorative Decals For Journal Scrapbooking Laptop Guitar
like
Find Similar
Pack of 50 colorful transparent watercolor firework stickers made of waterproof PET material - Mixed Multicolor Firework Style
Waterproof Transparent PET Firework Stickers Multicolor Watercolor Decorative Decals For Journal Scrapbooking Laptop Guitar
$1.04
No MOQ
Heart Shape Magnetic Phone Grip Glitter Shimmer Expandable Griptok Folding Mobile Support Holder With Gold Smile Lettering
Heart Shape Magnetic Phone Grip Glitter Shimmer Expandable Griptok Folding Mobile Support Holder With Gold Smile Lettering
like
Find Similar
Macro shot of white glitter heart MagSafe phone stand with gold Smile lettering details - Magnetic Large Crooked Heart Glitter Gold Smile / White
Detail of pink heart-shaped glitter MagSafe phone grip with gold Smile lettering - Magnetic Large Crooked Heart Glitter Gold Smile / Orange
Detail of pink glitter heart phone grip with gold Smile metal inlay on laptop surface - Magnetic Large Crooked Heart Glitter Gold Smile / Pink
Macro detail of heart-shaped glitter phone grip with a golden Smile metallic lettering - Magnetic Large Crooked Heart Glitter Gold Smile / Fruit Green
+7
Heart Shape Magnetic Phone Grip Glitter Shimmer Expandable Griptok Folding Mobile Support Holder With Gold Smile Lettering
-9%
$1.96
No MOQ
Free Shipping
Daisy Bee Static Cling Window Stickers Floral Bee Wall Decals For Home Bedroom Decoration Removable No Glue PVC Sticker
Daisy Bee Static Cling Window Stickers Floral Bee Wall Decals For Home Bedroom Decoration Removable No Glue PVC Sticker
like
Find Similar
Daisy and bee wall decals layout showing size 38x30cm 15x11.8 inches for home decoration - Daisy Bee Static Sticker (HY-F252)
Daisy Bee Static Cling Window Stickers Floral Bee Wall Decals For Home Bedroom Decoration Removable No Glue PVC Sticker
$1.21
No MOQ
Funny 3D Horse Head Peeking Window Wall Sticker PVC Waterproof Art Decal Creative Animal Home Decor For Glass Door Living Room
Funny 3D Horse Head Peeking Window Wall Sticker PVC Waterproof Art Decal Creative Animal Home Decor For Glass Door Living Room
like
Find Similar
Detailed size information for funny horse head wall decal measuring 30x24cm and 11.8x9.4inch - 24*30cm
Funny 3D Horse Head Peeking Window Wall Sticker PVC Waterproof Art Decal Creative Animal Home Decor For Glass Door Living Room
$1.15
No MOQ
Ice World Fantasy PVC Waterproof Stickers For Phone Case Laptop Water Cup DIY Decorative Animal Floral Crystal Stickers
Ice World Fantasy PVC Waterproof Stickers For Phone Case Laptop Water Cup DIY Decorative Animal Floral Crystal Stickers
like
Find Similar
50 pieces of fantasy ice world waterproof PVC stickers for DIY phone cases and luggage - Ice World (50 Pieces)
Ice World Fantasy PVC Waterproof Stickers For Phone Case Laptop Water Cup DIY Decorative Animal Floral Crystal Stickers
$0.96
No MOQ
Watercolor Transparent PET Stickers Vintage Floral Cat Decals For Scrapbooking Journal Laptop Guitar Decoration Supplies
Watercolor Transparent PET Stickers Vintage Floral Cat Decals For Scrapbooking Journal Laptop Guitar Decoration Supplies
like
Find Similar
50pcs transparent watercolor floral girl stickers set for journals and laptops - Watercolor Garden Collection
Watercolor Transparent PET Stickers Vintage Floral Cat Decals For Scrapbooking Journal Laptop Guitar Decoration Supplies
$1.04
No MOQ
 · 
16 views
Cartoon Capybara Graffiti Stickers Waterproof PVC Cute Animal DIY Decals For Laptop Luggage Skateboard Phone Case
Cartoon Capybara Graffiti Stickers Waterproof PVC Cute Animal DIY Decals For Laptop Luggage Skateboard Phone Case
like
Find Similar
Pack of 50 waterproof cartoon capybara stickers for DIY luggage and skateboard decor - 50Pcs Non-repeating Capybara Stickers
Cartoon Capybara Graffiti Stickers Waterproof PVC Cute Animal DIY Decals For Laptop Luggage Skateboard Phone Case
$0.96
No MOQ
 · 
35 views
PVC Blackboard Labels Self Adhesive Waterproof Removable Kitchen Storage Stickers For Jars Bottles Containers Organize
PVC Blackboard Labels Self Adhesive Waterproof Removable Kitchen Storage Stickers For Jars Bottles Containers Organize
like
Find Similar
1 option
PVC Blackboard Labels Self Adhesive Waterproof Removable Kitchen Storage Stickers For Jars Bottles Containers Organize
-4%
$1.37
No MOQ
3D Gummy Bear Phone Grip Expandable Airbag Bracket Semi Transparent Jelly Resin Cartoon Folding Stand For Smartphone
3D Gummy Bear Phone Grip Expandable Airbag Bracket Semi Transparent Jelly Resin Cartoon Folding Stand For Smartphone
like
Find Similar
Detailed close-up of a pink jelly translucent bear phone grip on a laptop background - Light Jelly Dark Red
Close-up of a white jelly bear phone grip stand on a minimalist white desk setup - Light Jelly White
Macro shot of an orange translucent gummy bear phone grip on a white desk - Light Jelly Orange
Macro detail of a translucent pink jelly bear phone grip mounted on a laptop edge - Light Jelly Pink
+9
3D Gummy Bear Phone Grip Expandable Airbag Bracket Semi Transparent Jelly Resin Cartoon Folding Stand For Smartphone
-9%
$1.00
No MOQ
Watercolor Magic Animal Fantasy Stickers Waterproof Vinyl Decorative Decals For Scrapbook Journal Laptop DIY Decor
Watercolor Magic Animal Fantasy Stickers Waterproof Vinyl Decorative Decals For Scrapbook Journal Laptop DIY Decor
like
Find Similar
49-piece set of colorful watercolor magic creature stickers with white borders - Magic Fantasy Theme Style (RXHB0256)
Watercolor Magic Animal Fantasy Stickers Waterproof Vinyl Decorative Decals For Scrapbook Journal Laptop DIY Decor
$0.86
Mix MOQ : 5
Golden 3D Bear Phone Socket Grip Holder Foldable Retractable Desktop Stand Mirror Luxury Electroplated Korean Style
Golden 3D Bear Phone Socket Grip Holder Foldable Retractable Desktop Stand Mirror Luxury Electroplated Korean Style
like
Find Similar
Close-up of golden bear relief on lavender base with pearl background details - Gold Ring Stand-Fat Bear-White Base
Close-up of golden 3D bear phone grip with vintage metal texture and pearl details - Gold Ring Stand-Fat Bear-Black Base
Detail of 3D bear gold phone socket grip on book with high-gloss electroplated finish - Gold Ring Stand-Fat Bear-Mirror Gold
Macro detail of golden bear phone stand with mirror surface and beaded edge texture - Gold Ring Stand-Fat Bear-Mirror Silver
+2
Golden 3D Bear Phone Socket Grip Holder Foldable Retractable Desktop Stand Mirror Luxury Electroplated Korean Style
-8%
$0.79
No MOQ
Waterproof PVC Animal Decorative Stickers Realistic Cartoon Wildlife Decals For Laptop Luggage Phone Case DIY Journaling Supplies
Waterproof PVC Animal Decorative Stickers Realistic Cartoon Wildlife Decals For Laptop Luggage Phone Case DIY Journaling Supplies
like
Find Similar
50 mixed animal stickers featuring panda, fox and giraffe for DIY luggage and laptop decor - Animal World
Waterproof PVC Animal Decorative Stickers Realistic Cartoon Wildlife Decals For Laptop Luggage Phone Case DIY Journaling Supplies
$0.96
No MOQ
Christmas Capybara Stickers Waterproof Cartoon Animal Decals For Laptop Luggage Diy Decoration Stickers For Kids Teens
Christmas Capybara Stickers Waterproof Cartoon Animal Decals For Laptop Luggage Diy Decoration Stickers For Kids Teens
like
Find Similar
50 pieces of waterproof Christmas Capybara stickers for laptop and DIY holiday decoration - 50 Sheets/Pack
Christmas Capybara Stickers Waterproof Cartoon Animal Decals For Laptop Luggage Diy Decoration Stickers For Kids Teens
$1.26
No MOQ
Pink Ribbon Breast Cancer Awareness Stickers Waterproof PVC Matte Decals For Water Bottle Laptop Luggage DIY Decoration
Pink Ribbon Breast Cancer Awareness Stickers Waterproof PVC Matte Decals For Water Bottle Laptop Luggage DIY Decoration
like
Find Similar
Pink ribbon breast cancer awareness stickers set for laptops and water bottles decoration - Pink Ribbon Series
Pink Ribbon Breast Cancer Awareness Stickers Waterproof PVC Matte Decals For Water Bottle Laptop Luggage DIY Decoration
$0.96
No MOQ
Smiley Face Mobile Phone Grip Stand Acrylic Mirror Retractable Cloud Shape Foldable Bracket Cute Cartoon Desktop Holder
Smiley Face Mobile Phone Grip Stand Acrylic Mirror Retractable Cloud Shape Foldable Bracket Cute Cartoon Desktop Holder
like
Find Similar
Close-up of a silver cloud-shaped mirror phone stand with a smiley face in a pink tray - White
Close-up of pink smile mirror phone grip resting in a colorful ceramic bowl - Pink
Cute ghost shaped mirror phone grip displayed on a vibrant pink and yellow tray - Black
Close-up of a yellow banana-shaped mirror phone socket with a minimalist smile face - Yellow
+6
Smiley Face Mobile Phone Grip Stand Acrylic Mirror Retractable Cloud Shape Foldable Bracket Cute Cartoon Desktop Holder
-9%
$0.76
No MOQ
Stainless Steel Insulated Water Bottle Vacuum Flask With Handle Lid Cute Cartoon Cherry Dog Patterns Portable Drinking Cup
Stainless Steel Insulated Water Bottle Vacuum Flask With Handle Lid Cute Cartoon Cherry Dog Patterns Portable Drinking Cup
like
Find Similar
Close-up of cream stainless steel bottle with cute line art and ergonomic handle - 750ml / Graffiti
Detail of cream stainless steel bottle with cute dog prints and portable handle - 750ml / Dog
Stainless Steel Insulated Water Bottle Vacuum Flask With Handle Lid Cute Cartoon Cherry Dog Patterns Portable Drinking Cup
$7.12
No MOQ
 · 
27 views
Cartoon Mushroom Wall Stickers PVC Self-Adhesive Switch Stickers For Living Room Bedroom Kitchen Creative Home Decor
Cartoon Mushroom Wall Stickers PVC Self-Adhesive Switch Stickers For Living Room Bedroom Kitchen Creative Home Decor
like
Find Similar
Detailed dimension guide for 3D mushroom wall sticker HY-KG161 with realistic pattern - 13*16cm (HY-KG161)
Cartoon Mushroom Wall Stickers PVC Self-Adhesive Switch Stickers For Living Room Bedroom Kitchen Creative Home Decor
$0.58
No MOQ
Transparent Gradient Circular Phone Grip Holder Retractable Folding Airbag Stand Adhesive Plastic Smartphone Accessory
Transparent Gradient Circular Phone Grip Holder Retractable Folding Airbag Stand Adhesive Plastic Smartphone Accessory
like
Find Similar
Collapsible phone socket grip in translucent gradient blue-green and pink resin - Blue Green Gradient
Universal gradient telescopic cell phone socket grip in black glossy circular finish - Black Grey Gradient
Universal orange gradient telescopic phone socket grip on a mint green smartphone - Orange Yellow Gradient
Pink translucent expandable circular phone grip stand with multi-stage folding structure - Red-Pink Gradient
+2
Transparent Gradient Circular Phone Grip Holder Retractable Folding Airbag Stand Adhesive Plastic Smartphone Accessory
-10%
$0.52
Mix MOQ : 5
Gothic Aesthetic Witch Skull Potion Stickers Waterproof PVC Decals For Laptop Luggage Skateboard Water Bottle Guitar
Gothic Aesthetic Witch Skull Potion Stickers Waterproof PVC Decals For Laptop Luggage Skateboard Water Bottle Guitar
like
Find Similar
Set of 50 spooky aesthetic stickers featuring witch potions, skulls, and gothic art themes - 50 Sheets/Pack
Gothic Aesthetic Witch Skull Potion Stickers Waterproof PVC Decals For Laptop Luggage Skateboard Water Bottle Guitar
-10%
$0.86
No MOQ
Coffee Theme PVC Wall Sticker Heart Latte Art Cup Beans Decal For Kitchen Cafe Shop Home Decor Minimalist Brown Mural
Coffee Theme PVC Wall Sticker Heart Latte Art Cup Beans Decal For Kitchen Cafe Shop Home Decor Minimalist Brown Mural
like
Find Similar
Detail of coffee wall sticker set with cup heart latte art and coffee beans 30x20cm - Simple Coffee Style (fun-f285)
Coffee Theme PVC Wall Sticker Heart Latte Art Cup Beans Decal For Kitchen Cafe Shop Home Decor Minimalist Brown Mural
$0.72
No MOQ
Cute Cartoon Blue Animal Stickers Waterproof PVC Vinyl Decal For Laptop Guitar Luggage DIY Scrapbooking Stationery Stickers
Cute Cartoon Blue Animal Stickers Waterproof PVC Vinyl Decal For Laptop Guitar Luggage DIY Scrapbooking Stationery Stickers
like
Find Similar
50 pieces of blue cartoon animal waterproof stickers for laptops and luggage DIY decor - Blue Cartoon Animal Series
NewCute Cartoon Blue Animal Stickers Waterproof PVC Vinyl Decal For Laptop Guitar Luggage DIY Scrapbooking Stationery Stickers
$0.98
No MOQ
Scorpio Constellation Stickers Waterproof Vinyl Scorpion Decals For Laptop Phone Luggage DIY Journal Decorative Stickers
Scorpio Constellation Stickers Waterproof Vinyl Scorpion Decals For Laptop Phone Luggage DIY Journal Decorative Stickers
like
Find Similar
50 pieces of waterproof Scorpio constellation stickers in various artistic cartoon styles - Scorpio Series (T01042662)
Scorpio Constellation Stickers Waterproof Vinyl Scorpion Decals For Laptop Phone Luggage DIY Journal Decorative Stickers
$0.86
Mix MOQ : 2
Waterproof PET Translucent Flower Stickers For Scrapbooking Pink Floral Decorative Stickers For Laptop Guitar Journal Phone Case
Waterproof PET Translucent Flower Stickers For Scrapbooking Pink Floral Decorative Stickers For Laptop Guitar Journal Phone Case
like
Find Similar
Pack of 50 waterproof transparent PET floral stickers with pink roses and daisies - Default
Waterproof PET Translucent Flower Stickers For Scrapbooking Pink Floral Decorative Stickers For Laptop Guitar Journal Phone Case
$1.04
No MOQ
Cute Peach Theme Cartoon Stickers For Scrapbooking Waterproof PVC Decorative Decals For Phone Case Tablet DIY Art Crafts
Cute Peach Theme Cartoon Stickers For Scrapbooking Waterproof PVC Decorative Decals For Phone Case Tablet DIY Art Crafts
like
Find Similar
1 option
NewCute Peach Theme Cartoon Stickers For Scrapbooking Waterproof PVC Decorative Decals For Phone Case Tablet DIY Art Crafts
-4%
$0.69
No MOQ
Watercolor Animal Stickers Vintage Cartoon Decorative Decals For Laptop Water Bottle Scrapbooking Phone Case DIY Stickers
Watercolor Animal Stickers Vintage Cartoon Decorative Decals For Laptop Water Bottle Scrapbooking Phone Case DIY Stickers
like
Find Similar
50 pieces of watercolor animal stickers set for laptop and scrapbooking decoration - Animal Watercolor Style (T01042586)
Watercolor Animal Stickers Vintage Cartoon Decorative Decals For Laptop Water Bottle Scrapbooking Phone Case DIY Stickers
$0.86
No MOQ
Space Aluminum Desk Side Bag Hook Portable No Drill Table Edge Backpack Umbrella Holder For School Office Home
Space Aluminum Desk Side Bag Hook Portable No Drill Table Edge Backpack Umbrella Holder For School Office Home
like
Find Similar
Black U-shaped metal bag hook for desk edge mounting without drilling holes - Matte Black (1 Pack)
White minimalist U-shaped metal bag hook for desk edge with 30mm clamping capacity - Pearl White (1 Pack)
Industrial grey aluminum desk side bag hook with matte finish for hanging backpacks - Gunmetal Gray (1 Pack)
2-pack black metal U-shaped desk bag hooks with precise dimension measurements - Matte Black (2 Pack)
+2
Space Aluminum Desk Side Bag Hook Portable No Drill Table Edge Backpack Umbrella Holder For School Office Home
-5%
$2.05-2.88
No MOQ
 · 
15 views
Cute Cartoon Animal Stickers Waterproof DIY Scrapbooking Journal Decorative Decals For Laptop Phone Case Luggage
Cute Cartoon Animal Stickers Waterproof DIY Scrapbooking Journal Decorative Decals For Laptop Phone Case Luggage
like
Find Similar
1 option
Cute Cartoon Animal Stickers Waterproof DIY Scrapbooking Journal Decorative Decals For Laptop Phone Case Luggage
$0.75
No MOQ
Cartoon Chef Wall Mounted Toothbrush Holder Resin Adhesive Hook Bathroom Storage Rack Cute Home Kitchen Decor Ornaments
Cartoon Chef Wall Mounted Toothbrush Holder Resin Adhesive Hook Bathroom Storage Rack Cute Home Kitchen Decor Ornaments
like
Find Similar
Cute cartoon chef toothbrush holder with bread figurine in resin for bathroom storage - Bread Style
Cartoon chef toothbrush holder with white hat and red scarf for wall decoration - Noodle Bowl Style
Cartoon resin chef welcome figurine with hat and red scarf for restaurant home decor - Welcome Style
Cute cartoon chef toothbrush holder in white resin with red scarf and hands up - Waiter Style
Cartoon Chef Wall Mounted Toothbrush Holder Resin Adhesive Hook Bathroom Storage Rack Cute Home Kitchen Decor Ornaments
$1.01
Mix MOQ : 2
Vacuum Insulated Water Bottle 316 Stainless Steel Thermos With Tea Infuser Portable Carry Strap Pop Up Lid Leakproof Modern
Vacuum Insulated Water Bottle 316 Stainless Steel Thermos With Tea Infuser Portable Carry Strap Pop Up Lid Leakproof Modern
like
Find Similar
Vibrant orange 350ml stainless steel insulated bottle with silver lid and hand strap - 350ml / With Carry Rope / Vibrant Orange
Ivory white 600ml stainless steel vacuum flask with matte finish and portable lanyard - 600ml / With Carry Rope / Ivory
Ivory white 350ml stainless steel insulated bottle with gray woven carrying strap - 350ml / With Carry Rope / Ivory
Handheld 350ml stainless steel insulated bottle in matte starry black with grey lanyard - 350ml / With Carry Rope / Starry Black
+8
Vacuum Insulated Water Bottle 316 Stainless Steel Thermos With Tea Infuser Portable Carry Strap Pop Up Lid Leakproof Modern
$8.41-9.51
No MOQ
Greek Mythology Stickers Waterproof PVC Vinyl Decals For Laptop Guitar Luggage DIY Decorative Stickers For Kids Adults
Greek Mythology Stickers Waterproof PVC Vinyl Decals For Laptop Guitar Luggage DIY Decorative Stickers For Kids Adults
like
Find Similar
50pcs waterproof ancient Greek Mythology stickers for laptop guitar and DIY decoration - Greek Mythology Series
Greek Mythology Stickers Waterproof PVC Vinyl Decals For Laptop Guitar Luggage DIY Decorative Stickers For Kids Adults
$0.98
No MOQ
Coffee Cup Flower Vine Wall Sticker PVC Removable DIY Art Decal For Kitchen Dining Room Cafe Modern Home Decor Wall Mural
Coffee Cup Flower Vine Wall Sticker PVC Removable DIY Art Decal For Kitchen Dining Room Cafe Modern Home Decor Wall Mural
like
Find Similar
Creative coffee cup wall sticker with heart vine patterns for room decoration 30x50cm - Standard Size
Coffee Cup Flower Vine Wall Sticker PVC Removable DIY Art Decal For Kitchen Dining Room Cafe Modern Home Decor Wall Mural
$1.15
Mix MOQ : 2
Realistic Dog Stickers Waterproof PET Transparent Animal Decals For DIY Scrapbook Water Bottle Laptop Decoration Journaling
Realistic Dog Stickers Waterproof PET Transparent Animal Decals For DIY Scrapbook Water Bottle Laptop Decoration Journaling
like
Find Similar
1 option
Realistic Dog Stickers Waterproof PET Transparent Animal Decals For DIY Scrapbook Water Bottle Laptop Decoration Journaling
$0.93
No MOQ
Vintage Gothic Witch Magic PET Stickers Waterproof Dark Academia Scrapbooking Material Decals For Journal DIY Decoration
Vintage Gothic Witch Magic PET Stickers Waterproof Dark Academia Scrapbooking Material Decals For Journal DIY Decoration
like
Find Similar
Detailed macro view showing a collection of vintage dark magic witch stickers and elements - Vintage Magic Witch
Vintage Gothic Witch Magic PET Stickers Waterproof Dark Academia Scrapbooking Material Decals For Journal DIY Decoration
-9%
$0.93
No MOQ
 · 
18 views
50PCS Biology Lab Graffiti Stickers Waterproof PVC Science DNA Microscope Decals For Laptop Guitar Water Bottle Skateboard
50PCS Biology Lab Graffiti Stickers Waterproof PVC Science DNA Microscope Decals For Laptop Guitar Water Bottle Skateboard
like
Find Similar
Set of 50 waterproof biology stickers featuring DNA, microscope, and science puns - Biology Stickers Set 1 (UU075)
Collage of biological science stickers with DNA cells and lab tools for laptop decor - Biology Stickers Set 2 (UU076)
50PCS Biology Lab Graffiti Stickers Waterproof PVC Science DNA Microscope Decals For Laptop Guitar Water Bottle Skateboard
$0.86
No MOQ
Protein Shaker Bottle Plastic Frosted Sport Water Cup With Mixing Ball Scale For Gym Fitness Mixing Drink
Protein Shaker Bottle Plastic Frosted Sport Water Cup With Mixing Ball Scale For Gym Fitness Mixing Drink
like
Find Similar
Pink and white protein shaker bottle with mixing ball for fitness and sports gym use - 500ml / Pink
Yellow protein shaker bottle set with mixing ball and scale on wooden table - 500ml / Yellow
Protein Shaker Bottle Plastic Frosted Sport Water Cup With Mixing Ball Scale For Gym Fitness Mixing Drink
-5%
$1.15-1.31
No MOQ
Waterproof Siberian Husky Dog Decorative Stickers For Luggage Skateboard Laptop Vinyl Decals Graffiti Style Ornaments
Waterproof Siberian Husky Dog Decorative Stickers For Luggage Skateboard Laptop Vinyl Decals Graffiti Style Ornaments
like
Find Similar
50pcs waterproof Siberian Husky stickers for luggage, skateboards, and laptops - Siberian Husky Series
Waterproof Siberian Husky Dog Decorative Stickers For Luggage Skateboard Laptop Vinyl Decals Graffiti Style Ornaments
$0.96
No MOQ
Creative Dishwashing Puppy Wall Sticker PVC Dishwasher Oven Decorative Decal Cute Dog Washing Dishes Kitchen Decoration
Creative Dishwashing Puppy Wall Sticker PVC Dishwasher Oven Decorative Decal Cute Dog Washing Dishes Kitchen Decoration
like
Find Similar
Detail showing dog in bathtub wall sticker with dimensions 34cm by 34cm for home decor - 34*34cm/fun-f920 107 Milky White
NewCreative Dishwashing Puppy Wall Sticker PVC Dishwasher Oven Decorative Decal Cute Dog Washing Dishes Kitchen Decoration
$1.15
No MOQ
Go to

More in home & kitchen

Explore more in suction cups

wallplasticwindowbabystainlessadjustableholidaypartyroundstorage rack
hangingracksteelshapewarmcleaningfoothomeopenpet

Ready to source like an insider

Get a direct line to the factory floor — no minimums, no middlemen, no guesswork.
iconReal factory pricing, no markup in betweeniconEvery order hand-inspected before it shipsicon5,000+ new products added daily
Get Inside Access