Everful

Wholesale suction cups

Factory-direct selection, vetted for quality and ready to order.

Sign Up
Suction Cups

Find the perfect pieces: home decor, kitchen & dining, arts, crafts & sewing and more

All products in suction cups

filterShow Filters
Best Seller
New Arrivals
Price Drop
Free Shipping
Vacuum Insulated Water Bottle 304 Stainless Steel Double Walled Frosted Matte Outdoor Sports Gym Flask Leak-proof Sleek
Vacuum Insulated Water Bottle 304 Stainless Steel Double Walled Frosted Matte Outdoor Sports Gym Flask Leak-proof Sleek
like
Find Similar
Minimalist 750ML stainless steel water bottle in cream beige matte finish - 750ml / Cream
750ml double-layer stainless steel sports bottle with a red matte finish and smooth cap - 750ml / Red
Minimalist 750ml double-layer 304 stainless steel sports water bottle in matte orange finish - 750ml / Earthy Yellow
Sleek 750ml orange matte finish double wall stainless steel vacuum insulated water bottle - 750ml / Cinnabar Orange
+18
Vacuum Insulated Water Bottle 304 Stainless Steel Double Walled Frosted Matte Outdoor Sports Gym Flask Leak-proof Sleek
$10.37
No MOQ
 · 
40 views
Waterproof PET Halloween Stickers Cartoon Goth Pumpkin Skeleton Ghost Patterns For Scrapbooking Journaling Laptop Decor
Waterproof PET Halloween Stickers Cartoon Goth Pumpkin Skeleton Ghost Patterns For Scrapbooking Journaling Laptop Decor
like
Find Similar
Pack of 50 transparent Halloween cartoon stickers with ghosts and pumpkins on white background - Halloween Series Stickers (SLP152)
Waterproof PET Halloween Stickers Cartoon Goth Pumpkin Skeleton Ghost Patterns For Scrapbooking Journaling Laptop Decor
$1.04
No MOQ
Magnetic Phone Holder Luxury Rhinestone Gemstone Artificial Pearl Alloy Expandable Folding Socket Grip Stand For Smartphone
Magnetic Phone Holder Luxury Rhinestone Gemstone Artificial Pearl Alloy Expandable Folding Socket Grip Stand For Smartphone
like
Find Similar
Close-up of luxury phone grip with sparkling rhinestones and elegant white pearls - Magnetic Airbag Stand / Vintage Aurora Gem
Close-up of luxury phone grip featuring blue gemstone, clear rhinestones and pearls - Magnetic Airbag Stand / Vintage Royal Blue Gem
Detail of luxury snowflake phone socket with pink gem, rhinestones and pearls on blue phone - Magnetic Airbag Stand / Vintage Pink Gem
Detailed close-up of luxury phone grip with crystals and pearls on a blue smartphone - Magnetic Airbag Stand / Vintage Gold Gem
+4
NewMagnetic Phone Holder Luxury Rhinestone Gemstone Artificial Pearl Alloy Expandable Folding Socket Grip Stand For Smartphone
-9%
$2.88-3.01
Mix MOQ : 2
Free Shipping
Mixed Sports Ball Theme Waterproof PVC Stickers Cartoon Football Basketball Rugby Laptop Luggage Decoration For Kids Reward
Mixed Sports Ball Theme Waterproof PVC Stickers Cartoon Football Basketball Rugby Laptop Luggage Decoration For Kids Reward
like
Find Similar
Pack of 50 colorful sports stickers featuring soccer, basketball and cute cartoon designs - Mixed Sports Ball Style (T01041668各式球混搭50张)
Mixed Sports Ball Theme Waterproof PVC Stickers Cartoon Football Basketball Rugby Laptop Luggage Decoration For Kids Reward
$0.95
Mix MOQ : 2
Magnetic Expandable Phone Grip Stand Circular 3D Micro Landscape Marine Theme Koi Fish Seashell Resin Holographic Decorative Accessory
Magnetic Expandable Phone Grip Stand Circular 3D Micro Landscape Marine Theme Koi Fish Seashell Resin Holographic Decorative Accessory
like
Find Similar
Close-up of 3D koi fish and starfish ocean scene inside a round phone socket grip - Magnetic - Crystal Ball Blue Light - No.1 Star Conch Goldfish
Macro view of ocean-themed phone grip with miniature starfish, fish, and pearl detail - Magnetic - Crystal Ball Blue Light - No.2 Star Pearl Red Fish
Detail of a dreamy ocean-style phone grip featuring a yellow fish, pearl, and glitter - Magnetic - Crystal Ball Blue Light - No.3 Shell Yellow Fish
Macro shot of 3D koi fish and pearl inside a transparent MagSafe phone socket stand - Magnetic - Crystal Ball Blue Light - No.4 Pearl Gold Powder Double Fish
+5
Magnetic Expandable Phone Grip Stand Circular 3D Micro Landscape Marine Theme Koi Fish Seashell Resin Holographic Decorative Accessory
-9%
$2.04
No MOQ
Triangle Onigiri Rice Ball Mold Food Grade PP Non-Stick DIY Sushi Press Maker Japanese Kitchen Tools Bento Accessories
Triangle Onigiri Rice Ball Mold Food Grade PP Non-Stick DIY Sushi Press Maker Japanese Kitchen Tools Bento Accessories
like
Find Similar
Transparent triangular rice ball mold with non-stick texture on wooden surface - Clear / Small
Single white triangular plastic onigiri mold for DIY rice balls and kids meals - White / Small
Single white triangular sushi mold made of food-grade plastic for DIY rice balls - White / Large
Japanese triangle rice ball mold in pale yellow food grade silicone material - Yellow / Small
+8
Triangle Onigiri Rice Ball Mold Food Grade PP Non-Stick DIY Sushi Press Maker Japanese Kitchen Tools Bento Accessories
-8%
$0.11-0.38
No MOQ
 · 
25 sold recently
Cartoon Cat And Plant Stickers Waterproof PVC Graffiti Decals For Laptop Water Bottle Suitcase DIY Aesthetic
Cartoon Cat And Plant Stickers Waterproof PVC Graffiti Decals For Laptop Water Bottle Suitcase DIY Aesthetic
like
Find Similar
Waterproof PVC cat and plant stickers set for DIY laptops and water bottles decoration - 50Pcs Non-repeating Cat and Plant
Cartoon Cat And Plant Stickers Waterproof PVC Graffiti Decals For Laptop Water Bottle Suitcase DIY Aesthetic
$0.96
No MOQ
 · 
13 views
Faucet Aerator Extender Stainless Steel ABS Rotatable Splash Proof Dual Water Mode Kitchen Sink Bathroom Accessory Universal
Faucet Aerator Extender Stainless Steel ABS Rotatable Splash Proof Dual Water Mode Kitchen Sink Bathroom Accessory Universal
like
Find Similar
Universal rotating silver faucet aerator with chrome finish and anti-splash extension - Short Style
Universal faucet connector with adjustable stainless steel clamp and white threaded adapter - Adapter
Universal silver flexible faucet extender with chrome swivel nozzle and white adapter - Long Style
Faucet Aerator Extender Stainless Steel ABS Rotatable Splash Proof Dual Water Mode Kitchen Sink Bathroom Accessory Universal
$0.17-0.69
No MOQ
 · 
29 views
Portable Mesh Shower Caddy Bath Storage Bag Breathable Organizer For Bathroom Gym Travel Waterproof PVC Polyester Tote
Portable Mesh Shower Caddy Bath Storage Bag Breathable Organizer For Bathroom Gym Travel Waterproof PVC Polyester Tote
like
Find Similar
Portable black mesh shower caddy bath storage basket with sturdy woven handles - Large / Black
Portable light grey mesh shower caddy with black rope handles and Bath Storage text - Large / Gray
Portable black mesh shower caddy with grey straps and Bath Storage print for travel - Small / Black
Silver-grey mesh bath storage bag with black rope handles and Bath Storage text - Small / Gray
Portable Mesh Shower Caddy Bath Storage Bag Breathable Organizer For Bathroom Gym Travel Waterproof PVC Polyester Tote
-4%
$1.78-1.97
No MOQ
Crystal Glass Phone Griptok Expanding Stand Laser Starry Sky Marble Pattern Heart Round Shape Desktop Holder
Crystal Glass Phone Griptok Expanding Stand Laser Starry Sky Marble Pattern Heart Round Shape Desktop Holder
like
Find Similar
Pink rose quartz crystal phone grip with smooth polished finish on white texture - White Base Stand / Crystal Glass Style-Round Solid-Light Pink
Pink laser starry glass crystal phone grip holder with vibrant orange gradient center - White Base Stand / Crystal Glass Style-Round-Orange Dot
Round laser galaxy glass phone socket with green and white marble resin texture - White Base Stand / Crystal Glass Style-Round-Ink Wash Green
Pink and white marble texture circular grip for phone with stylish aesthetic design - White Base Stand / Crystal Glass Style-Round-Ink Wash Red
+12
Crystal Glass Phone Griptok Expanding Stand Laser Starry Sky Marble Pattern Heart Round Shape Desktop Holder
-10%
$0.42-0.52
No MOQ
Mini Stainless Steel Spoon Colorful Mirror Polished Coffee Stirring Dessert Honey Small Round Head
Mini Stainless Steel Spoon Colorful Mirror Polished Coffee Stirring Dessert Honey Small Round Head
like
Find Similar
Polished silver stainless steel coffee spoon 14cm with elegant mirror finish - Regular 14cm / Natural
Golden stainless steel coffee spoon with mirror polish on white book background - Regular 14cm / Gold
Mini stainless steel coffee spoon in rose gold finish with elegant mirror polish - Regular 14cm / Rose Gold
Mini stainless steel coffee spoon 14cm in elegant matte gun black finish for desserts - Regular 14cm / Black
+8
Mini Stainless Steel Spoon Colorful Mirror Polished Coffee Stirring Dessert Honey Small Round Head
$0.20-0.48
Mix MOQ : 2
 · 
13 views
Retro Gold Stamping PET Stickers Architecture Floral Waterproof Transparent Decorative Decals For Journal Guitar Water Bottle
Retro Gold Stamping PET Stickers Architecture Floral Waterproof Transparent Decorative Decals For Journal Guitar Water Bottle
like
Find Similar
50 pieces of waterproof PET gold-stamped stickers with world landmarks and floral patterns - Between Fragrance Architecture Floral Style (TJ017)
Retro Gold Stamping PET Stickers Architecture Floral Waterproof Transparent Decorative Decals For Journal Guitar Water Bottle
$1.04
No MOQ
Draining Tray Rectangular PP Plastic Removable Tea Tray For Cup Kitchen Storage Household Drying Rack With Base
Draining Tray Rectangular PP Plastic Removable Tea Tray For Cup Kitchen Storage Household Drying Rack With Base
like
Find Similar
Orange double-layer rectangular drainage tray for tea sets, 34x26x4cm dimensions - Tan
Minimalist beige rectangular tea tray with grid drainer, size 34x26x4cm for home kitchen - Beige
White rectangular drainage tea tray with dimensions 34x26x4cm on wooden surface - Off-White
Modern teal double-layer drainage tea tray for living room and kitchen, size 34x26x4cm - Green
Draining Tray Rectangular PP Plastic Removable Tea Tray For Cup Kitchen Storage Household Drying Rack With Base
$2.02
No MOQ
 · 
27 views
50Pcs Halloween Cartoon Sticker Pack Waterproof PVC Pumpkin Ghost Decals For Laptop Water Bottle Skateboard Party Decor
50Pcs Halloween Cartoon Sticker Pack Waterproof PVC Pumpkin Ghost Decals For Laptop Water Bottle Skateboard Party Decor
like
Find Similar
Collection of Halloween cartoon stickers featuring pumpkins, ghosts, and festive motifs - 50 Sheets/Pack
50Pcs Halloween Cartoon Sticker Pack Waterproof PVC Pumpkin Ghost Decals For Laptop Water Bottle Skateboard Party Decor
$0.86
No MOQ
Vintage Retro Aesthetic Art Stickers For Laptop Guitar Suitcase Waterproof Vinyl DIY Decor Graffiti Decals Art Poster
Vintage Retro Aesthetic Art Stickers For Laptop Guitar Suitcase Waterproof Vinyl DIY Decor Graffiti Decals Art Poster
like
Find Similar
50pcs vintage aesthetic stickers for guitar and laptop with retro magazine and tarot designs - Creative Poster Style
NewVintage Retro Aesthetic Art Stickers For Laptop Guitar Suitcase Waterproof Vinyl DIY Decor Graffiti Decals Art Poster
$0.95
Mix MOQ : 2
Cute Colorful Sea Turtle Stickers Waterproof Vinyl Animal Cartoon Graffiti Decals For Water Bottle Laptop Scrapbooking Kids Adults Decorative Stickers
Cute Colorful Sea Turtle Stickers Waterproof Vinyl Animal Cartoon Graffiti Decals For Water Bottle Laptop Scrapbooking Kids Adults Decorative Stickers
like
Find Similar
Pack of 4 cute colorful sea turtle stickers for kids water bottle and craft decoration - T01041418 Flat Sheet Sticker - Tortoise - 4 Sheets/pack Of 100 Stickers
Cute Colorful Sea Turtle Stickers Waterproof Vinyl Animal Cartoon Graffiti Decals For Water Bottle Laptop Scrapbooking Kids Adults Decorative Stickers
$1.29
Mix MOQ : 2
Glass Straw Cup With Built-in Tea Infuser MBTI Personality Theme Portable Handle Heat Resistant Water Bottle For Office
Glass Straw Cup With Built-in Tea Infuser MBTI Personality Theme Portable Handle Heat Resistant Water Bottle For Office
like
Find Similar
Close-up of glass tea cup with filter net, pink lid and straw on white shelf - Pink
Detail of ENFJ personality glass tumbler with light blue lid and yellow straw - Blue
Detail of ENFJ glass straw cup with tea strainer and pink lid on a minimalist shelf - Brown
Glass Straw Cup With Built-in Tea Infuser MBTI Personality Theme Portable Handle Heat Resistant Water Bottle For Office
-4%
$3.54
No MOQ
 · 
16 views
Biblical Verse Stickers Christian Inspirational Religious Bible Quote Decals Waterproof DIY Scrapbooking Stationery Gifts
Biblical Verse Stickers Christian Inspirational Religious Bible Quote Decals Waterproof DIY Scrapbooking Stationery Gifts
like
Find Similar
Set of 56 colorful vintage Bible verse stickers with cross and floral designs for journaling - Biblical Inspirational Text Sticker Style (T01043243)
Biblical Verse Stickers Christian Inspirational Religious Bible Quote Decals Waterproof DIY Scrapbooking Stationery Gifts
$0.86
Mix MOQ : 2
 · 
38 views
Adjustable Kids Clothes Hangers Plastic Anti-slip Extendable Stackable Baby Clothing Organizer Cute Bear Design Macaron Colors
Adjustable Kids Clothes Hangers Plastic Anti-slip Extendable Stackable Baby Clothing Organizer Cute Bear Design Macaron Colors
like
Find Similar
Mint green bear pattern kids clothes hanger with space-saving stackable hook design - Green (Thickened)
Blue cascading bear baby hanger with non-slip texture and space-saving hook design - Blue (Thickened)
Pink and white bear-shaped kids hangers with non-slip wide shoulders and hook linkage - Pink (Thickened)
Thickened stackable yellow bear cartoon hangers for children with space-saving design - Yellow (Thickened)
+4
Adjustable Kids Clothes Hangers Plastic Anti-slip Extendable Stackable Baby Clothing Organizer Cute Bear Design Macaron Colors
$0.13-0.17
Mix MOQ : 10
 · 
13 views
Magnetic Phone Grip Tok Resin Bowknot Expandable Socket Stand Foldable Mobile Holder Korean Ins Style
Magnetic Phone Grip Tok Resin Bowknot Expandable Socket Stand Foldable Mobile Holder Korean Ins Style
like
Find Similar
Detail of a 3D translucent resin bowknot magnetic phone socket with golden metal accent - White
Close-up of a 3D orange bow cell phone grip stand with a golden butterfly pattern on top - Orange
Detail of pink resin 3D bow phone socket with magnetic base and purple holder - Pink
Close-up of black 3D bow phone socket grip with shiny finish and gold metal bow detail - Black
+7
NewMagnetic Phone Grip Tok Resin Bowknot Expandable Socket Stand Foldable Mobile Holder Korean Ins Style
-8%
$2.23
No MOQ
Anti Scald Bowl Gripper Clip Silicone Non Slip Heat Resistant Plate Lifter Hot Dish Tong Kitchen Tool Ergonomic Handle
Anti Scald Bowl Gripper Clip Silicone Non Slip Heat Resistant Plate Lifter Hot Dish Tong Kitchen Tool Ergonomic Handle
like
Find Similar
3 options
Anti Scald Bowl Gripper Clip Silicone Non Slip Heat Resistant Plate Lifter Hot Dish Tong Kitchen Tool Ergonomic Handle
$0.27
No MOQ
 · 
11 sold recently
Stainless Steel Mini Sugar Tongs Small Food Ice Tongs For Coffee Bar Buffet Service Kitchen Gadget Multi-Color Polished
Stainless Steel Mini Sugar Tongs Small Food Ice Tongs For Coffee Bar Buffet Service Kitchen Gadget Multi-Color Polished
like
Find Similar
Golden 410 stainless steel 10.8cm sugar tongs with polished finish and U-shape design - 410 Stainless Steel 10.8cm Gold
Rose gold 304 stainless steel sugar tongs measuring 10.8cm for ice cubes and sweets - 410 Stainless Steel 10.8cm Rose Gold
Rainbow plated stainless steel sugar tongs for ice cubes and small appetizers - 410 Stainless Steel 10.8cm Rainbow
Sleek 410 stainless steel 10.8cm sugar tongs with rounded grips for ice cubes - 410 Stainless Steel 10.8cm Silver
+7
Stainless Steel Mini Sugar Tongs Small Food Ice Tongs For Coffee Bar Buffet Service Kitchen Gadget Multi-Color Polished
-5%
$0.26-0.63
Mix MOQ : 2
 · 
18 views
Plastic Faucet Filter Maifan Stone Stainless Steel Clamp Splash Proof Rotatable Sprayer Head Kitchen Bathroom Extender
Plastic Faucet Filter Maifan Stone Stainless Steel Clamp Splash Proof Rotatable Sprayer Head Kitchen Bathroom Extender
like
Find Similar
Pink kitchen faucet filter with mineralization balls and rotatable splash-proof nozzle - Large Pink (Boxed)
Green faucet filter with mineral beads and splash-proof rotating propeller - Large Green (Boxed)
Blue swiveling faucet filter with stone filter beads and adjustable metal clamp - Large Blue (Boxed)
+6
Plastic Faucet Filter Maifan Stone Stainless Steel Clamp Splash Proof Rotatable Sprayer Head Kitchen Bathroom Extender
$0.02-0.03
Mix MOQ : 4
 · 
18 views
Bear Phone Grip Tok Laser Glitter Expandable Air Cushion Stand Kawaii Cartoon Universal Mobile Accessory
Bear Phone Grip Tok Laser Glitter Expandable Air Cushion Stand Kawaii Cartoon Universal Mobile Accessory
like
Find Similar
Glitter bear phone grip with holographic finish and colorful sequins on paper backdrop - Laser Glitter Light Green
Blue-purple gradient glitter bear-shaped expandable phone grip with holographic resin finish - Laser Glitter Light Blue
Pink holographic glitter bear pop socket grip for smartphone with cute resin finish - Laser Glitter Pink
Bear-shaped glitter phone grip with iridescent finish and collapsible socket design - Laser Glitter White
+4
Bear Phone Grip Tok Laser Glitter Expandable Air Cushion Stand Kawaii Cartoon Universal Mobile Accessory
-8%
$1.05
No MOQ
Watercolor Animal Stickers Vintage Cartoon Decorative Decals For Laptop Water Bottle Scrapbooking Phone Case DIY Stickers
Watercolor Animal Stickers Vintage Cartoon Decorative Decals For Laptop Water Bottle Scrapbooking Phone Case DIY Stickers
like
Find Similar
50 pieces of watercolor animal stickers set for laptop and scrapbooking decoration - Animal Watercolor Style (T01042586)
Watercolor Animal Stickers Vintage Cartoon Decorative Decals For Laptop Water Bottle Scrapbooking Phone Case DIY Stickers
$0.86
No MOQ
Galaxy Colorful Animal Illustration Stickers Oil Painting Art Decals For Suitcase Journal Phone Case Stationery Decor
Galaxy Colorful Animal Illustration Stickers Oil Painting Art Decals For Suitcase Journal Phone Case Stationery Decor
like
Find Similar
Collection of 60 colorful animal art stickers in impressionist oil painting style for decor - Animal Oil Painting Illustration Series (OPQ299)
Galaxy Colorful Animal Illustration Stickers Oil Painting Art Decals For Suitcase Journal Phone Case Stationery Decor
$1.27
No MOQ
 · 
11 views
Waterproof PET Transparent Stickers Cartoon Inspirational Quotes Floral Animal Decals For Scrapbooking Journal Laptop Guitar Decor Variety Set
Waterproof PET Transparent Stickers Cartoon Inspirational Quotes Floral Animal Decals For Scrapbooking Journal Laptop Guitar Decor Variety Set
like
Find Similar
Set of 50 waterproof cartoon inspirational stickers for laptops, guitars and journals - Cartoon Inspirational Quotes Series
Waterproof PET Transparent Stickers Cartoon Inspirational Quotes Floral Animal Decals For Scrapbooking Journal Laptop Guitar Decor Variety Set
$1.04
No MOQ
Stackable Food Cover Insulated Transparent PET Plastic Dustproof Insect Proof Household Dining Table Vegetable Covers
Stackable Food Cover Insulated Transparent PET Plastic Dustproof Insect Proof Household Dining Table Vegetable Covers
like
Find Similar
Single layer yellow thermal food cover with transparent lid and round top handle - 1 Layer / Yellow
Green single layer insulated food cover with transparent lid and round handle for home use - 1 Layer / Green
Single-layer transparent food cover with cream tray, 28cm diameter and 9cm height - 1 Layer / Cream
Stackable Food Cover Insulated Transparent PET Plastic Dustproof Insect Proof Household Dining Table Vegetable Covers
$1.90
No MOQ
 · 
27 views
3D Funny Peeking Cat Wall Sticker Waterproof PVC Animal Decal For Toilet Fridge Washing Machine Kitchen Home Decoration
3D Funny Peeking Cat Wall Sticker Waterproof PVC Animal Decal For Toilet Fridge Washing Machine Kitchen Home Decoration
like
Find Similar
Detailed size chart for black peeping cat wall decal showing 30x30cm and 28x28cm dimensions - 30x30cm / KSA118A
Detailed dimension guide for black peeking cat wall sticker showing 20x30cm size - 20x30cm / KSA118B
Detailed size chart showing a 30x25cm cute peeking black cat self-adhesive wall sticker - 25x30cm / KSA118C
Detailed dimension guide for black peeking cat wall sticker measuring 20x30cm - 20x30cm / KSA118D
+4
3D Funny Peeking Cat Wall Sticker Waterproof PVC Animal Decal For Toilet Fridge Washing Machine Kitchen Home Decoration
-5%
$0.55
No MOQ
Cartoon Little Witch Stickers Waterproof PVC Vinyl Decals For DIY Laptop Guitar Luggage Decoration For Kids Girls
Cartoon Little Witch Stickers Waterproof PVC Vinyl Decals For DIY Laptop Guitar Luggage Decoration For Kids Girls
like
Find Similar
50pcs vintage cartoon witch stickers for waterproof laptop and guitar decoration - Assorted Q-version Witch Designs
NewCartoon Little Witch Stickers Waterproof PVC Vinyl Decals For DIY Laptop Guitar Luggage Decoration For Kids Girls
$0.98
No MOQ
Kawaii Cartoon Animal Waterproof Stickers Assorted Zoo Critters For Laptop Luggage Journal Decoration Aesthetic Vinyl Decals
Kawaii Cartoon Animal Waterproof Stickers Assorted Zoo Critters For Laptop Luggage Journal Decoration Aesthetic Vinyl Decals
like
Find Similar
Detailed group view of 50 cute cartoon animal stickers featuring panda, frog and cat designs - Cute Animal Collection
NewKawaii Cartoon Animal Waterproof Stickers Assorted Zoo Critters For Laptop Luggage Journal Decoration Aesthetic Vinyl Decals
$0.88
Mix MOQ : 2
Mom Life Theme Stickers Waterproof PVC Decals For Laptop Luggage Guitar Messy Bun Leopard Sunflower DIY Decorative Sticker
Mom Life Theme Stickers Waterproof PVC Decals For Laptop Luggage Guitar Messy Bun Leopard Sunflower DIY Decorative Sticker
like
Find Similar
50pcs Mom Life cartoon stickers set with leopard messy bun designs for DIY decor - Mom Life Theme Style
NewMom Life Theme Stickers Waterproof PVC Decals For Laptop Luggage Guitar Messy Bun Leopard Sunflower DIY Decorative Sticker
$0.98
No MOQ
Transparent Toothpick Holder Cotton Swab Storage Jar Crystal Handle Minimalist Dustproof Container For Home Vanity Decor
Transparent Toothpick Holder Cotton Swab Storage Jar Crystal Handle Minimalist Dustproof Container For Home Vanity Decor
like
Find Similar
Luxe acrylic cotton swab holder with crystal lid handle and creamy white inner cylinder - Cotton Swab Box / White
Transparent acrylic cotton swab container with black insert and crystal lid knob, size 11.3cm - Cotton Swab Box / Black
Transparent Toothpick Holder Cotton Swab Storage Jar Crystal Handle Minimalist Dustproof Container For Home Vanity Decor
$0.95
No MOQ
 · 
10 sold recently
Cute Cartoon Blue Animal Stickers Waterproof PVC Vinyl Decal For Laptop Guitar Luggage DIY Scrapbooking Stationery Stickers
Cute Cartoon Blue Animal Stickers Waterproof PVC Vinyl Decal For Laptop Guitar Luggage DIY Scrapbooking Stationery Stickers
like
Find Similar
50 pieces of blue cartoon animal waterproof stickers for laptops and luggage DIY decor - Blue Cartoon Animal Series
NewCute Cartoon Blue Animal Stickers Waterproof PVC Vinyl Decal For Laptop Guitar Luggage DIY Scrapbooking Stationery Stickers
$0.98
No MOQ
Hair Accessory Organizer Wall Mounted PU Leather Wood Hanging Rack For Scrunchies Headbands Clips Display
Hair Accessory Organizer Wall Mounted PU Leather Wood Hanging Rack For Scrunchies Headbands Clips Display
like
Find Similar
Hanging DIY hair clip organizer with light wood rods, beige PU leather, and metal S-hooks - 86x38cm / Beige
Pink PU leather four-tier jewelry organizer with wooden rods and metal hooks - 86x38cm / Light Pink
Pink PU leather wall hanging earring organizer with four tiers and wooden rods - 86x38cm / Taro Purple
Hanging jewelry organizer with light blue PU leather straps and 4 wooden rods - 86x38cm / Light Blue
Hair Accessory Organizer Wall Mounted PU Leather Wood Hanging Rack For Scrunchies Headbands Clips Display
-5%
$6.57
No MOQ
 · 
28 views
Round Rhinestone Cherry Phone Griptok Retractable Folding Socket Sparkling Leather Texture Hand Grip Holder
Round Rhinestone Cherry Phone Griptok Retractable Folding Socket Sparkling Leather Texture Hand Grip Holder
like
Find Similar
Detailed close-up of a silver rhinestone cherry phone socket on a ceramic plate - Transparent Stand - Rhinestone Pearlescent - White Diamond Cherry / White
Close-up of sparkling rhinestone cherry phone grip with pink leather texture finish - Transparent Stand - Rhinestone Pearlescent - White Diamond Cherry / Pink
Close-up of rhinestone cherry phone grip holder with sparkling gems on black leather base - Transparent Stand - Rhinestone Pearlescent - White Diamond Cherry / Black
Detailed view of a round rhinestone cherry phone grip with black leather texture finish - Transparent Stand - Rhinestone Pearlescent - White Diamond Cherry / Gray
+12
Round Rhinestone Cherry Phone Griptok Retractable Folding Socket Sparkling Leather Texture Hand Grip Holder
-9%
$1.00-2.15
No MOQ
Free Shipping
Magnetic Cat Paw Phone Griptok Stand Frosted Plastic Heart Detail With Artificial Pearl Beads Decor Cute Kawaii Phone Accessory
Magnetic Cat Paw Phone Griptok Stand Frosted Plastic Heart Detail With Artificial Pearl Beads Decor Cute Kawaii Phone Accessory
like
Find Similar
Close-up of cat paw magnetic phone grip with iridescent rhinestones on white desk - Matte Cat Paw-Silver Grey
Detail of a cute cat paw phone grip with heart motif and iridescent beaded edge - Shimmering White
Detail of pink cat paw phone grip with heart relief and gold pearl bead edging - Shimmering Orange
Detail of pink cat paw phone grip with red rhinestones and frosted texture on white desk - Shimmering Red
+6
Magnetic Cat Paw Phone Griptok Stand Frosted Plastic Heart Detail With Artificial Pearl Beads Decor Cute Kawaii Phone Accessory
-9%
$2.04
No MOQ
Free Shipping
Japanese Style Retro Girl Stickers Waterproof PVC Decorative Decals For Scrapbooking Phone Case Laptop Tablet Journal
Japanese Style Retro Girl Stickers Waterproof PVC Decorative Decals For Scrapbooking Phone Case Laptop Tablet Journal
like
Find Similar
1 option
Japanese Style Retro Girl Stickers Waterproof PVC Decorative Decals For Scrapbooking Phone Case Laptop Tablet Journal
-4%
$0.69
No MOQ
Universal LED Cabinet Hinge Light For Wardrobe Kitchen Closet Automatic Sensor Interior Lamp Cool White Warm Light
Universal LED Cabinet Hinge Light For Wardrobe Kitchen Closet Automatic Sensor Interior Lamp Cool White Warm Light
like
Find Similar
2 options
Universal LED Cabinet Hinge Light For Wardrobe Kitchen Closet Automatic Sensor Interior Lamp Cool White Warm Light
$0.50
No MOQ
Vintage Butterfly Flower Scrapbook Stickers Retro Botanical Decorative Decals For Laptop Phone Journaling DIY Art Craft
Vintage Butterfly Flower Scrapbook Stickers Retro Botanical Decorative Decals For Laptop Phone Journaling DIY Art Craft
like
Find Similar
Collection of vintage butterfly and floral stickers with antique clock and bird designs - Vintage Flower and Bird Style
Vintage Butterfly Flower Scrapbook Stickers Retro Botanical Decorative Decals For Laptop Phone Journaling DIY Art Craft
-10%
$0.86
No MOQ
Cyberpunk Vaporwave Waterproof PVC Stickers For Laptop Guitar Luggage DIY Decoration Retro Neon Art Decals For Teens
Cyberpunk Vaporwave Waterproof PVC Stickers For Laptop Guitar Luggage DIY Decoration Retro Neon Art Decals For Teens
like
Find Similar
52-piece waterproof cyberpunk vaporwave stickers for laptop and guitar decoration - Cyberpunk Vaporwave Set
Cyberpunk Vaporwave Waterproof PVC Stickers For Laptop Guitar Luggage DIY Decoration Retro Neon Art Decals For Teens
$0.98
No MOQ
Universe Galaxy Space Nebula Fridge Magnets Round Resin Decorative Magnetic Whiteboard Stickers For Home Kitchen Office Decor Gift
Universe Galaxy Space Nebula Fridge Magnets Round Resin Decorative Magnetic Whiteboard Stickers For Home Kitchen Office Decor Gift
like
Find Similar
Detailed comparison of galaxy glass fridge magnet front and black magnetic back surface - Dark Blue Nebula Style 1 (BXT2517-1)
Cosmic galaxy glass fridge magnet with deep blue nebula pattern on a black magnetic base - Purple Galaxy Style 2 (BXT2517-2)
Deep blue nebula galaxy glass crystal fridge magnet with round magnetic backing - Deep Blue Starry Sky Style 3 (BXT2517-3)
30mm galaxy nebula crystal glass fridge magnet with round magnetic base for home decor - Colorful Nebula Style 4 (BXT2517-4)
+8
Universe Galaxy Space Nebula Fridge Magnets Round Resin Decorative Magnetic Whiteboard Stickers For Home Kitchen Office Decor Gift
$0.29
No MOQ
LED Light Up Hawaiian Party Glasses Tropical Beach Luau Flamingo Pineapple Coconut Tree Glowing Eyewear Frame For Summer Vacation Night Party Holiday Decorations
LED Light Up Hawaiian Party Glasses Tropical Beach Luau Flamingo Pineapple Coconut Tree Glowing Eyewear Frame For Summer Vacation Night Party Holiday Decorations
like
Find Similar
Detail showing dimensions and LED controls of a Summer-themed party glasses frame - Hawaiian Glasses (Glowing) / Coconut Juice Watermelon
Detail of LED Hawaii party glasses with Hello Summer motif and size dimensions - Hawaiian Glasses (Glowing) / Hello Summer Surfboard
Detail view of Hawaiian party glasses with Hello Summer text and tropical bird design - Hawaiian Glasses (Glowing) / Toucan Palm Leaf
Detail view of Hawaiian party LED glasses with flamingo and summer time design specifications - Hawaiian Glasses (Glowing) / Summer Time Flamingo
+6
LED Light Up Hawaiian Party Glasses Tropical Beach Luau Flamingo Pineapple Coconut Tree Glowing Eyewear Frame For Summer Vacation Night Party Holiday Decorations
-4%
$1.15
Mix MOQ : 2
Heart Shaped Phone Grip Holder Glitter Star Sequins Resin Griptok Foldable Adhesive Cell Phone Socket Stand
Heart Shaped Phone Grip Holder Glitter Star Sequins Resin Griptok Foldable Adhesive Cell Phone Socket Stand
like
Find Similar
Detail of heart-shaped phone grip with white marble texture and silver metallic edge - Electroplated Heart Stand - Shell Texture Glue
Detail of watermelon red heart phone grip with star sequins and silver metal edge decoration - Electroplated Heart Stand - Starry Shell - Andorra Red
Detail of heart-shaped phone grip with iridescent white finish and star sequins - Electroplated Heart Stand - Starry Shell - White
Close-up of heart-shaped glitter phone grip with blue resin and star sequins - Electroplated Heart Stand - Starry Shell - Royal Blue
+8
Heart Shaped Phone Grip Holder Glitter Star Sequins Resin Griptok Foldable Adhesive Cell Phone Socket Stand
-9%
$1.10
No MOQ
Free Shipping
Cartoon Bear Phone Holder Transparent Resin Glitter Fruit Slices Magnetic Retractable Desk Stand Expanding Grip
Cartoon Bear Phone Holder Transparent Resin Glitter Fruit Slices Magnetic Retractable Desk Stand Expanding Grip
like
Find Similar
Close-up of clear resin bear phone grip with pink strawberry sequins and magnetic ring - Transparent Magnetic Grip - Strawberry Bear
Detail of transparent bear phone grips with strawberry and orange glitter sand design - Transparent Magnetic Grip - Orange Bear
Macro detail of transparent bear phone grip with pink strawberry prints and silver glitter - Transparent Socket Grip - Strawberry Bear
Macro shot of 3D astronaut bear phone stand featuring orange slices and gold glitter flakes - Transparent Socket Grip - Orange Bear
Cartoon Bear Phone Holder Transparent Resin Glitter Fruit Slices Magnetic Retractable Desk Stand Expanding Grip
-9%
$1.18-2.31
No MOQ
PET Summer Girl Seaside Theme Waterproof Decorative Stickers Scrapbooking Journal DIY Stationery Material Hand Account Stickers
PET Summer Girl Seaside Theme Waterproof Decorative Stickers Scrapbooking Journal DIY Stationery Material Hand Account Stickers
like
Find Similar
Transparent Sea Salt summer girl PET stickers set for DIY scrapbooking and decoration - Transparent Sea Salt
Waterproof Rose Tide PET stickers featuring summer girls and beach scenery set of 12 - Rose Tide Rise
Summer waves PET stickers featuring 10 anime girl characters and 2 beach scenery motifs - Wave Moment
Summer girl series PET sticker set featuring anime characters in yellow and blue outfits - Glass Sunlight
+2
PET Summer Girl Seaside Theme Waterproof Decorative Stickers Scrapbooking Journal DIY Stationery Material Hand Account Stickers
-9%
$0.78
No MOQ
Coffee Time Cup Coffee Beans Heart Wall Sticker PVC Waterproof Removable DIY Mural Art Decal For Kitchen Cafe Home Decor
Coffee Time Cup Coffee Beans Heart Wall Sticker PVC Waterproof Removable DIY Mural Art Decal For Kitchen Cafe Home Decor
like
Find Similar
Detailed wall sticker layout showing coffee cup and beans dimensions 30x39cm - 30x39cm (fun-f415)
Coffee Time Cup Coffee Beans Heart Wall Sticker PVC Waterproof Removable DIY Mural Art Decal For Kitchen Cafe Home Decor
$1.01
No MOQ
Matte Black Round Chalkboard Labels Stickers Waterproof Removable Kitchen Storage Jar Organizer Labels For Home Office Decor
Matte Black Round Chalkboard Labels Stickers Waterproof Removable Kitchen Storage Jar Organizer Labels For Home Office Decor
like
Find Similar
1 option
Matte Black Round Chalkboard Labels Stickers Waterproof Removable Kitchen Storage Jar Organizer Labels For Home Office Decor
$0.72
No MOQ
Kawaii Cartoon Frog Graffiti Stickers Waterproof PVC Decorative Decals For Laptop Guitar Luggage DIY Journaling Scrapbooking
Kawaii Cartoon Frog Graffiti Stickers Waterproof PVC Decorative Decals For Laptop Guitar Luggage DIY Journaling Scrapbooking
like
Find Similar
Set of 50 cartoon frog stickers for decorating laptops and guitars in vibrant green - Vibrant Frog Mix
NewKawaii Cartoon Frog Graffiti Stickers Waterproof PVC Decorative Decals For Laptop Guitar Luggage DIY Journaling Scrapbooking
$0.98
No MOQ
Vintage Aesthetic Stickers 50Pcs Retro Waterproof PVC Decals For Scrapbooking Journaling Phone Case Laptop DIY Art Decor
Vintage Aesthetic Stickers 50Pcs Retro Waterproof PVC Decals For Scrapbooking Journaling Phone Case Laptop DIY Art Decor
like
Find Similar
Detailed collection of 50 vintage aesthetic stickers with butterflies and floral motifs - 50 Sheets/Pack
Vintage Aesthetic Stickers 50Pcs Retro Waterproof PVC Decals For Scrapbooking Journaling Phone Case Laptop DIY Art Decor
$0.86
No MOQ
Hippie Animal Graffiti Stickers Waterproof Vinyl Decals For Laptop Skateboard Luggage Water Bottle Car Cartoon DIY Decoration
Hippie Animal Graffiti Stickers Waterproof Vinyl Decals For Laptop Skateboard Luggage Water Bottle Car Cartoon DIY Decoration
like
Find Similar
Detail showing colorful graffiti cartoon animal stickers for suitcases and laptops - Hippie Animal Graffiti Style (T01040444)
Hippie Animal Graffiti Stickers Waterproof Vinyl Decals For Laptop Skateboard Luggage Water Bottle Car Cartoon DIY Decoration
$0.35
Mix MOQ : 5
Cream Style ABS Plastic Tissue Box Desktop Napkin Holder With Silver Bear And Pink Bow Vertical Stripe Smile Design
Cream Style ABS Plastic Tissue Box Desktop Napkin Holder With Silver Bear And Pink Bow Vertical Stripe Smile Design
like
Find Similar
Cream white tissue box with vertical stripes, silver bear decor and smile logo - Cream White (Bear & Bow & Smile)
Creamy white tissue box holder with vertical stripes and high-gloss finish, 18.5x13x10cm - Cream White (Box Only)
Creamy white luxury tissue box with silver bear figurine and vertical embossed texture - Cream White (With Smile Letters & Bear)
Creamy white tissue box with silver smile letter accent and minimalist Nordic style design - Cream White (With Smile Letters)
+6
Cream Style ABS Plastic Tissue Box Desktop Napkin Holder With Silver Bear And Pink Bow Vertical Stripe Smile Design
$1.73-2.74
No MOQ
 · 
21 sold recently
Universal Mobile Phone Socket Airbag Bracket Alloy Metal Irregular Oval Colorful Sequins Sparkly Retractable Stand Holder
Universal Mobile Phone Socket Airbag Bracket Alloy Metal Irregular Oval Colorful Sequins Sparkly Retractable Stand Holder
like
Find Similar
Detail of glitter heart phone socket with silver hammered metal frame on a dish - Multicolor Heart Sequins (No. 1)
Macro view of sequin-filled oval phone grip with glitter and silver metallic frame - Colorful Red and Blue Mixed Glitter (No. 2)
Close-up of oval phone grip with silver hammered metal frame and colorful sequins - Blue Green Pink Laser Sequins (No. 3)
Close-up of oval phone grip with colorful sequins and silver hammered metal frame - Colorful Round Sequins (No. 4)
+4
Universal Mobile Phone Socket Airbag Bracket Alloy Metal Irregular Oval Colorful Sequins Sparkly Retractable Stand Holder
-8%
$1.02
No MOQ
Cute Cartoon Girl Stickers Waterproof Macaron Color Decorative Decals For Scrapbooking Journaling DIY Hand Account Stationery
Cute Cartoon Girl Stickers Waterproof Macaron Color Decorative Decals For Scrapbooking Journaling DIY Hand Account Stationery
like
Find Similar
80pcs cute cartoon girl stickers set in pastel colors for DIY decor and scrapbooking - Cute Funny Characters (Glass Nori 80 Pieces) / Glass Nori
Cute Cartoon Girl Stickers Waterproof Macaron Color Decorative Decals For Scrapbooking Journaling DIY Hand Account Stationery
-4%
$0.69
No MOQ
Soccer Theme Party Glasses Football World Cup Fans Cheering Props Trophy Silhouette Decorative Eyewear For Sports Game Party Supplies
Soccer Theme Party Glasses Football World Cup Fans Cheering Props Trophy Silhouette Decorative Eyewear For Sports Game Party Supplies
like
Find Similar
Detail showing 16x12cm dimensions of the football party glasses with athlete silhouettes - Football Contention Black Purple
Detail view of soccer fan party glasses with size specs 15cm width and trophy decor - Soccer Trophy Celebration
Detail showing football party glasses dimensions 18.5x12.7cm with weight of 16.4g - Green Field Shooting
Detailed view of green football party glasses frame with 17x13cm dimension and weight info - FOOTBALL Stars
+16
Soccer Theme Party Glasses Football World Cup Fans Cheering Props Trophy Silhouette Decorative Eyewear For Sports Game Party Supplies
$0.55
Mix MOQ : 2
Vintage Red Aesthetic Stickers Waterproof PVC Retro Decorative Decals For DIY Scrapbooking Laptop Phone Case Journal Stickers
Vintage Red Aesthetic Stickers Waterproof PVC Retro Decorative Decals For DIY Scrapbooking Laptop Phone Case Journal Stickers
like
Find Similar
50 pieces of red vintage waterproof stickers with roses and retro patterns for journaling - Red Vintage Series
Vintage Red Aesthetic Stickers Waterproof PVC Retro Decorative Decals For DIY Scrapbooking Laptop Phone Case Journal Stickers
$0.95
No MOQ
Heart Shaped Phone Grip With Mirror Korean Ins Style Glitter Resin Simulated Fruit Slices Universal Adhesive Griptok Stand
Heart Shaped Phone Grip With Mirror Korean Ins Style Glitter Resin Simulated Fruit Slices Universal Adhesive Griptok Stand
like
Find Similar
Detail of heart-shaped phone socket with mirror and fruit slices in clear resin - Pink
Detail of heart-shaped phone grip with glitter mirror and colorful fruit slice accents - Silver Gray
Detail of heart-shaped mirror phone grip with purple resin and colorful fruit slices - Purple
Detailed view of heart-shaped glitter phone socket featuring colorful 3D fruit slices - Brown
+6
Heart Shaped Phone Grip With Mirror Korean Ins Style Glitter Resin Simulated Fruit Slices Universal Adhesive Griptok Stand
-9%
$1.00
No MOQ
Portable Magnetic Makeup Mirror For Magnetic Phone Case Round Folding Mirror Stand Accessory Universal Phone Case Mirror
Portable Magnetic Makeup Mirror For Magnetic Phone Case Round Folding Mirror Stand Accessory Universal Phone Case Mirror
like
Find Similar
Detail of pink magnetic MagSafe makeup mirror and phone socket on white smartphone - Red
Macro shot of circular MagSafe makeup mirror accessory attached to white smartphone - Black
Macro view of portable MagSafe mirror accessory on phone with floral background - White
Close-up of pink MagSafe vanity mirror and phone stand on a white textured background - Pink
+7
Portable Magnetic Makeup Mirror For Magnetic Phone Case Round Folding Mirror Stand Accessory Universal Phone Case Mirror
-9%
$2.10
No MOQ
Free Shipping
Luxury Desktop Tissue Box Holder Organizer With Phone Stand Multi-compartment Fluted Plastic Storage For Living Room
Luxury Desktop Tissue Box Holder Organizer With Phone Stand Multi-compartment Fluted Plastic Storage For Living Room
like
Find Similar
Creamy white multi-functional tissue box with gold legs and storage compartments - Cream White Gold
Light green multi-functional tissue box with vertical stripes and gold accents - Luxury Green Gold
Luxury Desktop Tissue Box Holder Organizer With Phone Stand Multi-compartment Fluted Plastic Storage For Living Room
$3.98
No MOQ
 · 
15 views
Vacuum Insulated Water Bottle 316 Stainless Steel Portable Cute Thermos Cup With Cartoon Charm Lanyard For Kids Women
Vacuum Insulated Water Bottle 316 Stainless Steel Portable Cute Thermos Cup With Cartoon Charm Lanyard For Kids Women
like
Find Similar
Detail of 400ml vacuum cup with cute cat print, red spherical lid and gift box - 400ml / Red
Off-white 400ml stainless steel vacuum flask with bear camping print and blue ball cap - 400ml / Blue
Creamy white stainless steel 400ml vacuum flask with pink cherry patterns and floral charm - 400ml / Pink
Cream yellow vacuum flask with cute puppy print and flower pendant 400ml water bottle - 400ml / Yellow
+4
Vacuum Insulated Water Bottle 316 Stainless Steel Portable Cute Thermos Cup With Cartoon Charm Lanyard For Kids Women
$6.28
No MOQ
 · 
16 views
Go to

More in home & kitchen

Explore more in suction cups

wallplasticwindowbabystainlessadjustableholidaypartyroundstorage rack
hangingracksteelshapewarmcleaningfoothomeopenpet

Ready to source like an insider

Get a direct line to the factory floor — no minimums, no middlemen, no guesswork.
iconReal factory pricing, no markup in betweeniconEvery order hand-inspected before it shipsicon5,000+ new products added daily
Get Inside Access