Everful

Wholesale suction cups

Factory-direct selection, vetted for quality and ready to order.

Sign Up
Suction Cups

Find the perfect pieces: home decor, kitchen & dining, arts, crafts & sewing and more

All products in suction cups

filterShow Filters
Best Seller
New Arrivals
Price Drop
Free Shipping
Creative Color Clashing Glass Water Cup High Borosilicate Heat Resistant Sphere Base Ins Style Drinkware For Juice Coffee
Creative Color Clashing Glass Water Cup High Borosilicate Heat Resistant Sphere Base Ins Style Drinkware For Juice Coffee
like
Find Similar
Creative two-tone borosilicate glass cup with light yellow body and green wavy base - 350ml / Yellow & Green Contrast
Artistic high borosilicate glass cup with purple body and green wavy base contrast - 350ml / Purple & Blue-Green Contrast
Creative Color Clashing Glass Water Cup High Borosilicate Heat Resistant Sphere Base Ins Style Drinkware For Juice Coffee
$6.05
No MOQ
 · 
39 views
Powerful Manual Air Pressure Toilet Plunger Drain Unblocker Plastic Rubber Pump For Bathroom Sinks Bathtubs Sewers
Powerful Manual Air Pressure Toilet Plunger Drain Unblocker Plastic Rubber Pump For Bathroom Sinks Bathtubs Sewers
like
Find Similar
1 option
Powerful Manual Air Pressure Toilet Plunger Drain Unblocker Plastic Rubber Pump For Bathroom Sinks Bathtubs Sewers
$1.84
Mix MOQ : 4
Cowboy Hat Shape Ice Cream Bowl Plastic Snack Dessert Serving Cup Novelty Creative Party Tableware Stackable
Cowboy Hat Shape Ice Cream Bowl Plastic Snack Dessert Serving Cup Novelty Creative Party Tableware Stackable
like
Find Similar
Creative green cowboy hat shaped plastic bowl for ice cream and snacks storage - Green
Creative yellow cowboy hat shaped plastic ice cream bowl for kids and parties - Yellow
Cowboy hat shaped blue plastic ice cream bowl for kids featuring a glossy finish - Blue
Pink cowboy hat shaped plastic ice cream bowl for kids and pets creative snack container - Pink
+6
Cowboy Hat Shape Ice Cream Bowl Plastic Snack Dessert Serving Cup Novelty Creative Party Tableware Stackable
$0.45
Mix MOQ : 2
 · 
69 sold recently
Kitchen Food Tongs Silicone And Stainless Steel Heat Resistant Non-Stick Locking Clip BBQ Serving For Steak With Stand
Kitchen Food Tongs Silicone And Stainless Steel Heat Resistant Non-Stick Locking Clip BBQ Serving For Steak With Stand
like
Find Similar
Beige silicone and stainless steel food tongs with non-slip head and hanging ring - 9 Inch / Off-White
Beige silicone kitchen tongs with stainless steel handle and oil draining holes - 12 Inch / Off-White
Beige silicone and stainless steel food tongs with slotted heads for kitchen frying - 9 Inch-with Stand / Off-White
Beige silicone and stainless steel food tongs with draining slots and hanging loop - 12 Inch-with Stand / Off-White
+13
Kitchen Food Tongs Silicone And Stainless Steel Heat Resistant Non-Stick Locking Clip BBQ Serving For Steak With Stand
$1.30-1.57
No MOQ
 · 
11 views
Graffiti Stickers Waterproof DIY Decorative Decals For Water Bottle Laptop Phone Case Journal Retro Cartoon Style PVC
Graffiti Stickers Waterproof DIY Decorative Decals For Water Bottle Laptop Phone Case Journal Retro Cartoon Style PVC
like
Find Similar
57 pieces of waterproof graffiti stickers with cute Korean cartoon designs for DIY decor - Default
Graffiti Stickers Waterproof DIY Decorative Decals For Water Bottle Laptop Phone Case Journal Retro Cartoon Style PVC
$0.95
No MOQ
 · 
25 views
Kawaii Panda Summer Water Play Waterproof Stickers For Scrapbooking Journaling DIY Decorative Stickers For Kids Teens
Kawaii Panda Summer Water Play Waterproof Stickers For Scrapbooking Journaling DIY Decorative Stickers For Kids Teens
like
Find Similar
Collection of cute cartoon panda stickers showing various summer swimming and playing scenes - Cartoon Panda Water Play Style (T01043107)
Kawaii Panda Summer Water Play Waterproof Stickers For Scrapbooking Journaling DIY Decorative Stickers For Kids Teens
$0.86
Mix MOQ : 2
Vintage Travel Map Stickers Waterproof PVC Decals For Suitcase Laptop Water Bottle Scrapbooking Journaling DIY Retro Decor
Vintage Travel Map Stickers Waterproof PVC Decals For Suitcase Laptop Water Bottle Scrapbooking Journaling DIY Retro Decor
like
Find Similar
Vintage travel stickers set with maps and cameras for DIY luggage and laptops decoration - Best Selling Classic Style (DD223)
50 pieces of vintage world map graffiti stickers for luggage, guitars, and DIY journals - Potential New Style (YCK167)
Vintage Travel Map Stickers Waterproof PVC Decals For Suitcase Laptop Water Bottle Scrapbooking Journaling DIY Retro Decor
$0.86
No MOQ
Heart Shaped Phone Grip Holder Resin Glitter Expandable Airbag Stand For Desktop Korean INS Style Sweet Decorative Accessory
Heart Shaped Phone Grip Holder Resin Glitter Expandable Airbag Stand For Desktop Korean INS Style Sweet Decorative Accessory
like
Find Similar
Detail of pink glitter heart phone grip with handmade silver emblem on desk - Ancorra Red Glitter
Detail of pearlescent white heart phone grip with handmade text on a white surface - White Glitter
Close-up of heart-shaped phone grip with orange glitter resin and handmade metal plate - Orange Glitter
Close-up of pink glitter heart phone grip with silver handmade engraving detail - Pink Glitter
+6
Heart Shaped Phone Grip Holder Resin Glitter Expandable Airbag Stand For Desktop Korean INS Style Sweet Decorative Accessory
-9%
$1.00
No MOQ
Woven Wall Hanging Storage Basket PP Imitation Rattan Semicircular Fruit Vegetable Organizer Handle Retro Home Decor
Woven Wall Hanging Storage Basket PP Imitation Rattan Semicircular Fruit Vegetable Organizer Handle Retro Home Decor
like
Find Similar
Detail of hand-woven vintage wall basket with a decorative mushroom wood hook on wall - Small
Detail of vintage faux rattan wall hanging basket with thick hand-woven texture and loop - Large
Woven Wall Hanging Storage Basket PP Imitation Rattan Semicircular Fruit Vegetable Organizer Handle Retro Home Decor
$2.68-3.17
No MOQ
Groovy Skull Stickers Roll Waterproof PVC Cartoon Halloween Decorative Labels For Scrapbooking Envelope Seal DIY Crafts
Groovy Skull Stickers Roll Waterproof PVC Cartoon Halloween Decorative Labels For Scrapbooking Envelope Seal DIY Crafts
like
Find Similar
500pcs roll of groovy cartoon skull stickers in various gothic patterns for decoration - Skull Series
Groovy Skull Stickers Roll Waterproof PVC Cartoon Halloween Decorative Labels For Scrapbooking Envelope Seal DIY Crafts
$0.86
No MOQ
Kids Plastic Hangers Bow Design Non-Slip Baby Clothes Hangers For Nursery Wardrobe Macaron Colors
Kids Plastic Hangers Bow Design Non-Slip Baby Clothes Hangers For Nursery Wardrobe Macaron Colors
like
Find Similar
Pink bow-knot kids clothes hangers with non-slip hooks for babies and toddlers - Pink
Creamy white bow-knot plastic hangers for kids aged 0-10 with non-slip hooks - Off-white
Nordic Blue bow-knot plastic non-slip kids hangers for children aged 0-10 years - Nordic Blue
Kids Plastic Hangers Bow Design Non-Slip Baby Clothes Hangers For Nursery Wardrobe Macaron Colors
$0.07
No MOQ
 · 
36 views
Twisted Stem Dessert Glass Cup Borosilicate Heat Resistant Ice Cream Bowl Milkshake Fruit Yogurt Goblet Kitchen Cafe
Twisted Stem Dessert Glass Cup Borosilicate Heat Resistant Ice Cream Bowl Milkshake Fruit Yogurt Goblet Kitchen Cafe
like
Find Similar
Pink glass sundae cup with yellow wavy stem, 93mm diameter and 138mm height specifications - 240ml / Pink Cup/Yellow Stem
Gray high-legged glass dessert bowl with unique S-shaped black stem, size 93x138mm - 240ml / Grey Cup/Black Stem
Ice cream glass bowl with white cup and black twisted stem, 138mm height - 240ml / White Cup/Black Stem
Artistic glass ice cream bowl with light green top and twisted blue stem 138mm height - 240ml / Light Green Cup/Blue Stem
Twisted Stem Dessert Glass Cup Borosilicate Heat Resistant Ice Cream Bowl Milkshake Fruit Yogurt Goblet Kitchen Cafe
-4%
$6.17
No MOQ
 · 
18 sold recently
Iridescent Watercolor Shell Stickers Waterproof PET Clear Decorative Decals For Scrapbooking Journaling Laptop Guitar Bottle
Iridescent Watercolor Shell Stickers Waterproof PET Clear Decorative Decals For Scrapbooking Journaling Laptop Guitar Bottle
like
Find Similar
50pcs waterproof holographic shell and pearl PET stickers for journal decoration - Iridescent Shell Stickers Set
Iridescent Watercolor Shell Stickers Waterproof PET Clear Decorative Decals For Scrapbooking Journaling Laptop Guitar Bottle
$1.04
No MOQ
Pink Fairy Tale Waterproof PET Stickers Cute Watercolor Animal Floral Stationery Aesthetic Stickers For Journal Laptop DIY Decor
Pink Fairy Tale Waterproof PET Stickers Cute Watercolor Animal Floral Stationery Aesthetic Stickers For Journal Laptop DIY Decor
like
Find Similar
Waterproof pink watercolor stickers pack with teddy bears, cats, and strawberry motifs - Pink Fairy Tale Style
Pink Fairy Tale Waterproof PET Stickers Cute Watercolor Animal Floral Stationery Aesthetic Stickers For Journal Laptop DIY Decor
$1.04
No MOQ
Waterproof Ocean Biological Temporary Tattoo Stickers Cartoon Watercolor Sea Animal Kids Face Arm Body Tattoo Decals
Waterproof Ocean Biological Temporary Tattoo Stickers Cartoon Watercolor Sea Animal Kids Face Arm Body Tattoo Decals
like
Find Similar
20 PCS waterproof ocean creature temporary tattoos featuring watercolor sea animal designs - Ocean Creature Series
Waterproof Ocean Biological Temporary Tattoo Stickers Cartoon Watercolor Sea Animal Kids Face Arm Body Tattoo Decals
-19%
$0.04
Mix MOQ : 20
Stainless Steel Cake Server And Fruit Fork Set Mirror Polished Dessert Shovel Cutlery For Birthday Wedding Party Gift Box
Stainless Steel Cake Server And Fruit Fork Set Mirror Polished Dessert Shovel Cutlery For Birthday Wedding Party Gift Box
like
Find Similar
Stainless steel cutlery set with knife fork and spoon in a white window gift box - White Gift Box / Silver
Golden stainless steel cake knife and forks set in a white window gift box packaging - White Gift Box / Gold
Stainless steel cake server and forks set in brown gift box with mirror polish finish - Brown Gift Box / Silver
9-piece gold stainless steel cake server and dessert fork set in elegant gift box - Brown Gift Box / Gold
Stainless Steel Cake Server And Fruit Fork Set Mirror Polished Dessert Shovel Cutlery For Birthday Wedding Party Gift Box
$2.51-3.17
Mix MOQ : 2
 · 
12 views
Reusable Coffee Cup Wheat Straw Double Layer Heat Resistant Travel Mug With Leak Proof Lid Portable Drinkware
Reusable Coffee Cup Wheat Straw Double Layer Heat Resistant Travel Mug With Leak Proof Lid Portable Drinkware
like
Find Similar
Portable beige wheat straw coffee cup with black lid and natural speckled texture - White
Pink wheat straw double-wall travel coffee cup with black lid on white background - Pink
Portable orange wheat straw coffee cup with black lid for travel and car use - Yellow
Portable double-layer wheat straw coffee cup in red finish with black lid - Red
+9
Reusable Coffee Cup Wheat Straw Double Layer Heat Resistant Travel Mug With Leak Proof Lid Portable Drinkware
$4.47
Mix MOQ : 2
 · 
17 views
Stainless Steel Cutlery Knife Fork Spoon Collection With Compartment Drawer Organizer Tray Mirror Polished Finish Modern Minimalist Tableware For Kitchen Dining Room Home
Stainless Steel Cutlery Knife Fork Spoon Collection With Compartment Drawer Organizer Tray Mirror Polished Finish Modern Minimalist Tableware For Kitchen Dining Room Home
like
Find Similar
24-piece black handled stainless steel cutlery set in a grey non-slip storage tray - Silver [storage Box *1 + 6-piece Cutlery Set *4]
24-piece gold stainless steel cutlery set with black handles in a white storage tray - Basic Collection (Gold)
24-piece rose gold stainless steel cutlery set with black handles and organizer tray - Rose Gold [storage Box *1 + Dinnerware Set Of 6 *4]
24-piece rainbow stainless steel cutlery set with black handles and white storage tray - Colorful Storage Box *1 + 6-piece Dinnerware Set *4
+16
Stainless Steel Cutlery Knife Fork Spoon Collection With Compartment Drawer Organizer Tray Mirror Polished Finish Modern Minimalist Tableware For Kitchen Dining Room Home
$13.34-35.71
No MOQ
 · 
13 views
Japanese Simulation Snack Candy Phone Grip Expandable Stand Portable Plastic Creative Food Design Desktop Holder Cute Accessory
Japanese Simulation Snack Candy Phone Grip Expandable Stand Portable Plastic Creative Food Design Desktop Holder Cute Accessory
like
Find Similar
Detailed view of pink strawberry bread phone grip in cute Japanese style packaging - Pink (Strawberry Snack Bag)
Macro view of mango bread scented squeeze toy in clear packaging on a white porcelain plate - Yellow (Mango Snack Bag)
Close-up of green melon bread squeeze toy in clear packaging on a white plate - Green (Melon Snack Bag)
Detail of yellow checkered snack packaging on white plate with pearl decor - Brown (Chocolate Snack Bag)
Japanese Simulation Snack Candy Phone Grip Expandable Stand Portable Plastic Creative Food Design Desktop Holder Cute Accessory
-9%
$1.44
No MOQ
Free Shipping
Sunflower Cartoon Waterproof PVC Stickers DIY Decorative Decals For Laptop Luggage Guitar Cute Aesthetic Vinyl Stickers
Sunflower Cartoon Waterproof PVC Stickers DIY Decorative Decals For Laptop Luggage Guitar Cute Aesthetic Vinyl Stickers
like
Find Similar
50pcs colorful sun-themed doodle stickers for decorating guitars and laptops - Sunshine Illustration Series
NewSunflower Cartoon Waterproof PVC Stickers DIY Decorative Decals For Laptop Luggage Guitar Cute Aesthetic Vinyl Stickers
$0.98
No MOQ
Protein Shaker Bottle With Mixing Ball Plastic Sports Water Cup For Fitness Gym Workout Frosted Leakproof Portable
Protein Shaker Bottle With Mixing Ball Plastic Sports Water Cup For Fitness Gym Workout Frosted Leakproof Portable
like
Find Similar
Pink and white protein shaker bottle with mixing ball for fitness and sports gym use - 500ml / Pink
Yellow protein shaker bottle set with mixing ball and scale on wooden table - 500ml / Yellow
Protein Shaker Bottle With Mixing Ball Plastic Sports Water Cup For Fitness Gym Workout Frosted Leakproof Portable
$1.15-1.30
No MOQ
 · 
12 views
Neon Style Waterproof Vinyl Stickers For Laptop Luggage Skateboard Retro Graffiti Decals For Car Guitar Phone Decoration
Neon Style Waterproof Vinyl Stickers For Laptop Luggage Skateboard Retro Graffiti Decals For Car Guitar Phone Decoration
like
Find Similar
50-piece set of neon-style retro stickers featuring glowing animals and pop icons - Handshake Neon Style
NewNeon Style Waterproof Vinyl Stickers For Laptop Luggage Skateboard Retro Graffiti Decals For Car Guitar Phone Decoration
$0.88
Mix MOQ : 2
Electroplated Alloy Phone Grip Expanding Airbag Desktop Stand Adhesive Retractable Tablet Holder Round Heart Shape Glossy
Electroplated Alloy Phone Grip Expanding Airbag Desktop Stand Adhesive Retractable Tablet Holder Round Heart Shape Glossy
like
Find Similar
White resin phone socket with gold trim on purple marble coaster and yellow tulips - White
Minimalist black and gold mirror cell phone grip stand on a pink agate coaster - Black
Adjustable green resin phone grip with gold rim on a marble surface with tulip accents - Emerald Green
Neon green popsocket with gold trim on marble coaster for phone and tablet grip - Gem Fluorescent Green
+9
Electroplated Alloy Phone Grip Expanding Airbag Desktop Stand Adhesive Retractable Tablet Holder Round Heart Shape Glossy
-9%
$1.00
No MOQ
Wall Mounted Soap Dish PP Plastic Draining Rack Punch Free Adhesive Soap Holder For Bathroom Shower Nordic Style
Wall Mounted Soap Dish PP Plastic Draining Rack Punch Free Adhesive Soap Holder For Bathroom Shower Nordic Style
like
Find Similar
4 options
Wall Mounted Soap Dish PP Plastic Draining Rack Punch Free Adhesive Soap Holder For Bathroom Shower Nordic Style
$0.16
No MOQ
56Pcs Cyberpunk Acid Graphic Stickers Waterproof Neon Abstract Art Decals For Laptop Suitcase Skateboard Phone DIY Decoration
56Pcs Cyberpunk Acid Graphic Stickers Waterproof Neon Abstract Art Decals For Laptop Suitcase Skateboard Phone DIY Decoration
like
Find Similar
56Pcs cyberpunk acid graphics stickers with neon cosmic and abstract metallic designs - T01042986
New56Pcs Cyberpunk Acid Graphic Stickers Waterproof Neon Abstract Art Decals For Laptop Suitcase Skateboard Phone DIY Decoration
$0.86
Mix MOQ : 2
50PCS Pink Girlhood DIY Stickers Waterproof PVC Scrapbooking Decals For Laptop Suitcase Water Bottle Kawaii Heart Cat Stickers
50PCS Pink Girlhood DIY Stickers Waterproof PVC Scrapbooking Decals For Laptop Suitcase Water Bottle Kawaii Heart Cat Stickers
like
Find Similar
Close-up of cute pink girlhood stickers featuring cats, hearts, and romantic DIY patterns - Pink Girlhood Series (50 Sheets)
50PCS Pink Girlhood DIY Stickers Waterproof PVC Scrapbooking Decals For Laptop Suitcase Water Bottle Kawaii Heart Cat Stickers
$0.86
No MOQ
Silicone Kitchen Utensils Cooking Tools Wooden Handle Heat Resistant Non-stick Spatula Spoon Turner Whisk Tongs Brush Pasta Fork Utensil Organizer
Silicone Kitchen Utensils Cooking Tools Wooden Handle Heat Resistant Non-stick Spatula Spoon Turner Whisk Tongs Brush Pasta Fork Utensil Organizer
like
Find Similar
Black silicone and stainless steel kitchen tongs with wooden handle and locking mechanism - Food Clip
Manual whisk with black silicone wire and ergonomic wooden handle for kitchen mixing - Whisk
Dark gray silicone oil brush with natural wood handle and convenient hanging hole - Paint Brush
Single slotted dark grey silicone turner with light wood handle on white background - Slotted Spatula
+15
Silicone Kitchen Utensils Cooking Tools Wooden Handle Heat Resistant Non-stick Spatula Spoon Turner Whisk Tongs Brush Pasta Fork Utensil Organizer
-6%
$0.43-10.95
Mix MOQ : 2
 · 
40 views
Pink Nurse Theme Waterproof PVC Stickers Collection Cute Stethoscope Bow Heart Teddy Bear Laptop Luggage Guitar DIY Decoration Stickers
Pink Nurse Theme Waterproof PVC Stickers Collection Cute Stethoscope Bow Heart Teddy Bear Laptop Luggage Guitar DIY Decoration Stickers
like
Find Similar
50 pieces of pink nurse theme waterproof stickers for laptops and luggage decoration - Default
Pink Nurse Theme Waterproof PVC Stickers Collection Cute Stethoscope Bow Heart Teddy Bear Laptop Luggage Guitar DIY Decoration Stickers
$0.98
No MOQ
Vintage Food Poster Stickers Waterproof PVC Vinyl Decals For Laptop Suitcase Scrapbook Retro Advertising Style
Vintage Food Poster Stickers Waterproof PVC Vinyl Decals For Laptop Suitcase Scrapbook Retro Advertising Style
like
Find Similar
50 pieces of vintage food posters and cartoon stickers for luggage and laptops - Vintage Food Posters
NewVintage Food Poster Stickers Waterproof PVC Vinyl Decals For Laptop Suitcase Scrapbook Retro Advertising Style
$0.92
No MOQ
Cartoon Animal Number Stickers For Early Childhood Learning Waterproof Vinyl Decals For Kids Laptop Notebook Education Decorative Stickers
Cartoon Animal Number Stickers For Early Childhood Learning Waterproof Vinyl Decals For Kids Laptop Notebook Education Decorative Stickers
like
Find Similar
51-piece colorful cartoon animal number stickers for early childhood learning education - Digital Cartoon Animals (0-50)
Cartoon Animal Number Stickers For Early Childhood Learning Waterproof Vinyl Decals For Kids Laptop Notebook Education Decorative Stickers
$0.95
Mix MOQ : 2
 · 
10 sold recently
Round Rhinestone Bowknot Phone Holder Foldable Plastic Griptok Socket Expanding Bracket Macaron Colors Cute Accessory
Round Rhinestone Bowknot Phone Holder Foldable Plastic Griptok Socket Expanding Bracket Macaron Colors Cute Accessory
like
Find Similar
Close-up of pink bow knot phone socket with sparkling rhinestones and woven texture - Pink
Detail of round phone grip with yellow bow and rhinestones on a clean desk - Yellow
Close-up of light blue round phone grip with a 3D bow and sparkling rhinestones - Blue
Close-up of light green leather phone grip with crystal rhinestones and a 3D bow - Green
+1
NewRound Rhinestone Bowknot Phone Holder Foldable Plastic Griptok Socket Expanding Bracket Macaron Colors Cute Accessory
-9%
$1.00
No MOQ
3D Miniature Beverage Bottle Fruit Resin Phone Grip Tok Expandable Airbag Finger Stand Universal Folding Smartphone Holder
3D Miniature Beverage Bottle Fruit Resin Phone Grip Tok Expandable Airbag Finger Stand Universal Folding Smartphone Holder
like
Find Similar
Miniature beer flavor drink phone socket stand featuring juice bottles and orange slices - Soda Orange
Miniature beer bottle phone grip and air cushion stand with orange slice design - Beer Orange
3D Miniature Beverage Bottle Fruit Resin Phone Grip Tok Expandable Airbag Finger Stand Universal Folding Smartphone Holder
-9%
$1.00
No MOQ
Cartoon Shark Slipper Phone Grip Stand Silicone Expandable Adhesive Desk Support Cute Cellphone Accessory
Cartoon Shark Slipper Phone Grip Stand Silicone Expandable Adhesive Desk Support Cute Cellphone Accessory
like
Find Similar
Detail of yellow shark-slipper phone grip with silicone finish and transparent base - Transparent Stand-Shark Slipper / Yellow
Close-up of cute shark-shaped phone accessories with matte finish on a minimalist desk - Transparent Stand-Shark Slipper / Off-White
Close-up of cute light blue shark-shaped phone grips with white jagged teeth detail - Transparent Stand-Shark Slipper / Blue
Detail of cute green silicone shark phone accessories paired with aesthetic floral background - Transparent Stand-Shark Slipper / Green
Cartoon Shark Slipper Phone Grip Stand Silicone Expandable Adhesive Desk Support Cute Cellphone Accessory
-9%
$1.70
No MOQ
Free Shipping
Watercolor Cartoon Kids Stickers For Water Bottle Skateboard DIY Decoration Cute Vehicles Transport Characters Kids Stickers Set
Watercolor Cartoon Kids Stickers For Water Bottle Skateboard DIY Decoration Cute Vehicles Transport Characters Kids Stickers Set
like
Find Similar
56Pcs watercolor cartoon children stickers featuring vehicles and various professions - Kids Playing Daily Cartoon Style(T01042785)
Watercolor Cartoon Kids Stickers For Water Bottle Skateboard DIY Decoration Cute Vehicles Transport Characters Kids Stickers Set
$0.86
Mix MOQ : 2
Round Phone Grip Holder Resin Water Ripple Gold Silver Foil Glitter Expandable Stand Adhesive Universal Desktop Finger Support
Round Phone Grip Holder Resin Water Ripple Gold Silver Foil Glitter Expandable Stand Adhesive Universal Desktop Finger Support
like
Find Similar
Macro detail of circular phone grip with silver foil and grey marble texture design - White
Macro detail of round light green phone grip with silver foil and vertical textures - Emerald Green
Detail shot of the glossy red marble texture and glitter on the round phone socket holder - Cherry Red
Macro detail of round amber resin phone grip featuring luxury embedded gold foil flakes - Orange
+11
Round Phone Grip Holder Resin Water Ripple Gold Silver Foil Glitter Expandable Stand Adhesive Universal Desktop Finger Support
-9%
$0.60
No MOQ
Creative Transparent Sphere Phone Grip Expanding Airbag Holder With 3D Miniature Food Apple Tableware Gold Ingot Plastic
Creative Transparent Sphere Phone Grip Expanding Airbag Holder With 3D Miniature Food Apple Tableware Gold Ingot Plastic
like
Find Similar
Transparent spherical phone socket with lucky gold ingot and red berries inside - Transparent Stand-Ball-Candy Haws-Gold Ingot
Detail of a clear sphere phone grip featuring miniature red hawthorns and gold coins inside - Transparent Stand-Ball-Candy Haws-Yellow Ingot
Macro detail of miniature apple food model with golden utensils in a clear round case - Transparent Stand-Ball-Bitten Apple+Fork Spoon
Detail view of round transparent phone socket featuring a miniature red apple and golden cutlery - Transparent Stand-Ball-Bitten Apple+Knife Fork
Creative Transparent Sphere Phone Grip Expanding Airbag Holder With 3D Miniature Food Apple Tableware Gold Ingot Plastic
-8%
$0.92
Mix MOQ : 2
Square Plastic Water Bottle Leakproof Pop Lid With Adjustable Shoulder Strap For Sports Fitness Gym Outdoor Portable Clear
Square Plastic Water Bottle Leakproof Pop Lid With Adjustable Shoulder Strap For Sports Fitness Gym Outdoor Portable Clear
like
Find Similar
Sleek 750ml square fitness water bottle in transparent finish with white strap and time scale - 750ml / Time Scale Style / YB-0791 White
Pink 750ml square fitness water bottle with straw, time marker and carrying strap - 750ml / Time Scale Style / YB-0791 Pink
Cyan 750ml square fitness water bottle with time markers and adjustable strap - 750ml / Time Scale Style / YB-0791 Green
Minimalist square 750ml blue plastic sports bottle with straw and time marker - 750ml / Time Scale Style / YB-0791 Blue
+4
Square Plastic Water Bottle Leakproof Pop Lid With Adjustable Shoulder Strap For Sports Fitness Gym Outdoor Portable Clear
-4%
$3.54
No MOQ
 · 
32 views
Japanese Style Natural Beech Wood Cat Paw Coaster Round Heat Insulated Wooden Mat For Coffee Tea Cup Home Decor
Japanese Style Natural Beech Wood Cat Paw Coaster Round Heat Insulated Wooden Mat For Coffee Tea Cup Home Decor
like
Find Similar
Japanese style natural round wood coaster with cute cat paw engraving for heat insulation - Cat Paw Style
Japanese Style Natural Beech Wood Cat Paw Coaster Round Heat Insulated Wooden Mat For Coffee Tea Cup Home Decor
$2.31
Mix MOQ : 10
Mint Green Aesthetic Stickers Waterproof PVC Decals For Laptop Luggage Guitar DIY Scrapbooking Journaling Decoration
Mint Green Aesthetic Stickers Waterproof PVC Decals For Laptop Luggage Guitar DIY Scrapbooking Journaling Decoration
like
Find Similar
50 pieces of mint green aesthetic graffiti stickers for guitars, laptops and luggage - Mint Green
Mint Green Aesthetic Stickers Waterproof PVC Decals For Laptop Luggage Guitar DIY Scrapbooking Journaling Decoration
$0.98
No MOQ
Realistic Marine Life Stickers PET Watercolor Sea Animal Decals For DIY Scrapbook Laptop Water Bottle Phone Case Kids Gift
Realistic Marine Life Stickers PET Watercolor Sea Animal Decals For DIY Scrapbook Laptop Water Bottle Phone Case Kids Gift
like
Find Similar
1 option
Realistic Marine Life Stickers PET Watercolor Sea Animal Decals For DIY Scrapbook Laptop Water Bottle Phone Case Kids Gift
-9%
$0.93
No MOQ
Phone Grip Holder Round Iridescent Resin Expandable Socket With Metal Bow Heart Decor Cute Y2K Mobile Accessories
Phone Grip Holder Round Iridescent Resin Expandable Socket With Metal Bow Heart Decor Cute Y2K Mobile Accessories
like
Find Similar
Close-up of clear bubble heart phone grip featuring a silver ribbon bow detail - Crystal Ball Grip - Dreamy Bubble - No. 69
Detailed close-up of iridescent resin phone grip featuring a silver strawberry relief - Crystal Ball Grip - Dreamy Bubble - No. 70
Macro shot of iridescent phone grip featuring a sparkling rhinestone-studded balloon dog - Crystal Ball Grip - Dreamy Bubble - No. 71
Detail view of a dreamy iridescent phone grip with a pearlescent white resin bow decor - Crystal Ball Grip - Dreamy Bubble - No. 72
+11
Phone Grip Holder Round Iridescent Resin Expandable Socket With Metal Bow Heart Decor Cute Y2K Mobile Accessories
-9%
$1.00
No MOQ
Waterproof PVC Book Reading Graffiti Stickers Cartoon Decorative Decals For Laptop Water Bottle Luggage Library Theme Gift
Waterproof PVC Book Reading Graffiti Stickers Cartoon Decorative Decals For Laptop Water Bottle Luggage Library Theme Gift
like
Find Similar
50pcs waterproof reading stickers set for book lovers DIY laptops and luggage decor - Book Reading Theme
Waterproof PVC Book Reading Graffiti Stickers Cartoon Decorative Decals For Laptop Water Bottle Luggage Library Theme Gift
$0.96
No MOQ
Vintage Forest Animals Mushroom Stickers Waterproof PVC Hand Painted Watercolor Decals For Laptop Journal Luggage Guitar DIY Scrapbooking
Vintage Forest Animals Mushroom Stickers Waterproof PVC Hand Painted Watercolor Decals For Laptop Journal Luggage Guitar DIY Scrapbooking
like
Find Similar
50pcs forest animals and mushrooms watercolor waterproof stickers for laptops and guitars - Forest Fairy Tale
Vintage Forest Animals Mushroom Stickers Waterproof PVC Hand Painted Watercolor Decals For Laptop Journal Luggage Guitar DIY Scrapbooking
$0.98
No MOQ
BCBA Behavior Analyst Waterproof PVC Graffiti Stickers Career Motivational Theme Colorful Decor For Laptop Guitar Suitcase
BCBA Behavior Analyst Waterproof PVC Graffiti Stickers Career Motivational Theme Colorful Decor For Laptop Guitar Suitcase
like
Find Similar
50 pieces of BCBA behavior analyst stickers for laptops and guitars with colorful designs - Colorful Pattern
BCBA Behavior Analyst Waterproof PVC Graffiti Stickers Career Motivational Theme Colorful Decor For Laptop Guitar Suitcase
$0.98
No MOQ
Cute Cartoon Pink Rabbit PVC Waterproof Stickers For Laptop Suitcase Diary Decor DIY Kids Girls Stationery Gift
Cute Cartoon Pink Rabbit PVC Waterproof Stickers For Laptop Suitcase Diary Decor DIY Kids Girls Stationery Gift
like
Find Similar
Close-up of pink rabbit cartoon stickers for scrapbooking and decoration items - Pink Rabbit Series
Cute Cartoon Pink Rabbit PVC Waterproof Stickers For Laptop Suitcase Diary Decor DIY Kids Girls Stationery Gift
$0.86
No MOQ
Funny Cartoon Humorous Text Stickers Waterproof Vinyl Decals For Laptop Water Bottle Suitcase Journal Decor
Funny Cartoon Humorous Text Stickers Waterproof Vinyl Decals For Laptop Water Bottle Suitcase Journal Decor
like
Find Similar
56 pieces of funny humor cartoon stickers with English quotes for laptop decor - T01043039
NewFunny Cartoon Humorous Text Stickers Waterproof Vinyl Decals For Laptop Water Bottle Suitcase Journal Decor
$0.86
Mix MOQ : 2
Insulated Soup Cup 304 Stainless Steel Thermal Breakfast Cup With Folding Spoon Portable Leakproof Food Jar For Students
Insulated Soup Cup 304 Stainless Steel Thermal Breakfast Cup With Folding Spoon Portable Leakproof Food Jar For Students
like
Find Similar
Mint green 304 stainless steel insulated food jar with white lid and yellow handle - 380ml / 380ml Litan PP Plastic Green
Portable purple stainless steel soup cup with handle and 304 steel inner liner - 430ml / New Style 430ml Purple
Portable cream 304 stainless steel insulated soup cup with handle for breakfast - 430ml / New Style 430ml Yellow
Navy blue 304 stainless steel insulated soup cup with convenient carrying handle - 430ml / New Style 430ml Blue
Insulated Soup Cup 304 Stainless Steel Thermal Breakfast Cup With Folding Spoon Portable Leakproof Food Jar For Students
$1.94-3.86
No MOQ
 · 
33 views
Cartoon Round Cell Phone Grip Tok Expandable Stand Holder For Desk Cute Clear Acrylic Telescopic Phone Support
Cartoon Round Cell Phone Grip Tok Expandable Stand Holder For Desk Cute Clear Acrylic Telescopic Phone Support
like
Find Similar
Detail of round yellow phone grip featuring a cute cartoon fried egg on a white surface - White Base Stand / Egg Yolk Expression
Detail of round phone socket with cute cartoon girl and yellow RICH text on a phone - White Base Stand / Rich Girl
Detail shot of a round phone grip featuring a cute potato chips packet design on a tray - White Base Stand / Potato Chips
+3
Cartoon Round Cell Phone Grip Tok Expandable Stand Holder For Desk Cute Clear Acrylic Telescopic Phone Support
-9%
$0.42-0.50
No MOQ
Waterproof PVC Cartoon Girl Stickers Original Hand Drawn Doodle Laptop Guitar Scrapbook Decorative Decals For Teens Girls
Waterproof PVC Cartoon Girl Stickers Original Hand Drawn Doodle Laptop Guitar Scrapbook Decorative Decals For Teens Girls
like
Find Similar
50pcs waterproof cartoon girl graffiti stickers for laptop and guitar decoration - Stick Figure Girl
Waterproof PVC Cartoon Girl Stickers Original Hand Drawn Doodle Laptop Guitar Scrapbook Decorative Decals For Teens Girls
$0.98
No MOQ
Wall Mounted Soap Holder Stainless Steel Self Adhesive Dish Tray Drain Rack Bathroom Shower Storage Organiser
Wall Mounted Soap Holder Stainless Steel Self Adhesive Dish Tray Drain Rack Bathroom Shower Storage Organiser
like
Find Similar
Silver stainless steel wall-mounted soap dish with adhesive pad for bathroom storage - Transparent Sticker / Silver
Wall-mounted stainless steel soap dish with adhesive base for bathroom or kitchen - Gold Thread Sticker / Silver
Wall-mounted black stainless steel soap dish with adhesive hook and drainage design - Black Sticker / Black
Wall Mounted Soap Holder Stainless Steel Self Adhesive Dish Tray Drain Rack Bathroom Shower Storage Organiser
-4%
$0.77-0.88
No MOQ
 · 
18 views
Monstera Leaf Shape Plant Support Clamps Transparent Acrylic Reusable Climbing Vine Fixing Clips Garden Stem Holder
Monstera Leaf Shape Plant Support Clamps Transparent Acrylic Reusable Climbing Vine Fixing Clips Garden Stem Holder
like
Find Similar
Clear leaf-shaped acrylic plant stem support clip for bamboo and turtle shell plants - Single Pack A (Leaf Shape)
Transparent butterfly-shaped acrylic support clip for plant stems and garden bamboo - Single Pack B (Butterfly Shape)
Mirror acrylic Monstera leaf wall stickers in transparent finish for plant stem support - A+B Combination Set
Monstera Leaf Shape Plant Support Clamps Transparent Acrylic Reusable Climbing Vine Fixing Clips Garden Stem Holder
$1.38-2.88
Mix MOQ : 2
 · 
13 views
Free Shipping
Magnetic Phone Grip Round Rhinestone Faceted Crystal Airbag Stand Foldable Mobile Holder Korean Ins Style Luxury Dopamine Color
Magnetic Phone Grip Round Rhinestone Faceted Crystal Airbag Stand Foldable Mobile Holder Korean Ins Style Luxury Dopamine Color
like
Find Similar
Top view of a round magnetic phone grip with large faceted crystal and dual-tone frame - Magnetic-Large Round Rhinestone-White
Detailed top view of pink crystal rhinestone phone socket on grey matte background - Magnetic-Large Round Rhinestone-Pink
Detail of a luxury magnetic phone socket with faceted red gemstone and red circular rim - Magnetic-Large Round Rhinestone-Red
Detailed macro view of faceted black gemstone phone grip with transparent acrylic finish - Magnetic-Large Round Rhinestone-Black
+16
NewMagnetic Phone Grip Round Rhinestone Faceted Crystal Airbag Stand Foldable Mobile Holder Korean Ins Style Luxury Dopamine Color
-9%
$0.42-1.65
No MOQ
Boston City Theme Graffiti Stickers Waterproof PVC Vinyl Decal For Laptop Skateboard Luggage Guitar Water Bottle DIY Decor
Boston City Theme Graffiti Stickers Waterproof PVC Vinyl Decal For Laptop Skateboard Luggage Guitar Water Bottle DIY Decor
like
Find Similar
50pcs waterproof Boston city theme vinyl stickers for luggage and laptop decoration - Default
NewBoston City Theme Graffiti Stickers Waterproof PVC Vinyl Decal For Laptop Skateboard Luggage Guitar Water Bottle DIY Decor
$0.98
No MOQ
Cute Cartoon Girl Dress Up Stickers DIY Decorative Decals For Phone Case Tablet Scrapbooking Educational Character Toys
Cute Cartoon Girl Dress Up Stickers DIY Decorative Decals For Phone Case Tablet Scrapbooking Educational Character Toys
like
Find Similar
Set of original cartoon girl dress-up stickers for DIY phone cases and tablet decoration - Cartoon Girl Dress Up Stickers (8ZD042)
Cute Cartoon Girl Dress Up Stickers DIY Decorative Decals For Phone Case Tablet Scrapbooking Educational Character Toys
$0.86
No MOQ
Transparent Gradient Circular Phone Grip Holder Retractable Folding Airbag Stand Adhesive Plastic Smartphone Accessory
Transparent Gradient Circular Phone Grip Holder Retractable Folding Airbag Stand Adhesive Plastic Smartphone Accessory
like
Find Similar
Collapsible phone socket grip in translucent gradient blue-green and pink resin - Blue Green Gradient
Universal gradient telescopic cell phone socket grip in black glossy circular finish - Black Grey Gradient
Universal orange gradient telescopic phone socket grip on a mint green smartphone - Orange Yellow Gradient
Pink translucent expandable circular phone grip stand with multi-stage folding structure - Red-Pink Gradient
+2
Transparent Gradient Circular Phone Grip Holder Retractable Folding Airbag Stand Adhesive Plastic Smartphone Accessory
-10%
$0.52
Mix MOQ : 5
50Pcs Vintage Travel Stickers For Journaling Scrapbooking Retro World Landmark Camera Waterproof PVC Decorative Aesthetic Stickers
50Pcs Vintage Travel Stickers For Journaling Scrapbooking Retro World Landmark Camera Waterproof PVC Decorative Aesthetic Stickers
like
Find Similar
Set of 50 vintage travel stickers with world landmarks and retro art for DIY luggage decor - Vintage Travel (50 Sheets/Pack)
50Pcs Vintage Travel Stickers For Journaling Scrapbooking Retro World Landmark Camera Waterproof PVC Decorative Aesthetic Stickers
$0.86
No MOQ
Magnetic Phone Grip Mother Of Artificial Pearl Texture Magnet Compatible Expandable Colorful Shell Socket With Gold Edge Holder
Magnetic Phone Grip Mother Of Artificial Pearl Texture Magnet Compatible Expandable Colorful Shell Socket With Gold Edge Holder
like
Find Similar
Detail showing pink shell texture phone grip with golden edge on white smartphone - Magnetic Stand / Pink Gradient Shell With Gold Edge
Detailed view of round shell pattern phone grip with golden edge on white smartphone - Magnetic Stand / Red Gradient Shell With Gold Edge
Macro shot of a round gradient shell texture phone socket grip on a blue smartphone - Magnetic Stand / Blue Gradient Shell With Gold Edge
Detail of magnetic phone socket with pearlescent shell pattern and golden metallic edge - Magnetic Stand / Green Gradient Shell With Gold Edge
+3
NewMagnetic Phone Grip Mother Of Artificial Pearl Texture Magnet Compatible Expandable Colorful Shell Socket With Gold Edge Holder
-8%
$3.67
Mix MOQ : 2
Free Shipping
Spanish Inspirational Motivational Stickers Waterproof PVC Vinyl Cartoon Graffiti Decals For Laptop Scrapbook Luggage DIY Decor Gift
Spanish Inspirational Motivational Stickers Waterproof PVC Vinyl Cartoon Graffiti Decals For Laptop Scrapbook Luggage DIY Decor Gift
like
Find Similar
50 Spanish motivational stickers with colorful cartoon illustrations for laptops and journals - Spanish Inspirational Style (RXHB0212)
Spanish Inspirational Motivational Stickers Waterproof PVC Vinyl Cartoon Graffiti Decals For Laptop Scrapbook Luggage DIY Decor Gift
$0.86
Mix MOQ : 5
Kawaii DIY Dress Up Anime Character PVC Waterproof Stickers Korean Ins Style Decorative Decals For Phone Case Scrapbook
Kawaii DIY Dress Up Anime Character PVC Waterproof Stickers Korean Ins Style Decorative Decals For Phone Case Scrapbook
like
Find Similar
Set of 8 sheets DIY anime girl dress-up stickers for scrapbooking and phone case decoration - Default Character Style (SJS176)
Kawaii DIY Dress Up Anime Character PVC Waterproof Stickers Korean Ins Style Decorative Decals For Phone Case Scrapbook
$0.86
No MOQ
Welder Welding Industrial PVC Waterproof Stickers For Laptop Luggage Toolbox Helmet Guitar DIY Graffiti Decals Gift For Workers
Welder Welding Industrial PVC Waterproof Stickers For Laptop Luggage Toolbox Helmet Guitar DIY Graffiti Decals Gift For Workers
like
Find Similar
Set of 50 waterproof PVC welder theme graffiti stickers for laptops and toolboxes - Welding Theme Set
NewWelder Welding Industrial PVC Waterproof Stickers For Laptop Luggage Toolbox Helmet Guitar DIY Graffiti Decals Gift For Workers
$0.98
No MOQ
Go to

More in home & kitchen

Explore more in suction cups

wallplasticwindowbabystainlessadjustableholidaypartyroundstorage rack
hangingracksteelshapewarmcleaningfoothomeopenpet

Ready to source like an insider

Get a direct line to the factory floor — no minimums, no middlemen, no guesswork.
iconReal factory pricing, no markup in betweeniconEvery order hand-inspected before it shipsicon5,000+ new products added daily
Get Inside Access